NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F105834

Metagenome Family F105834

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105834
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 50 residues
Representative Sequence MDEYLKTLLAGDISAATREALLKQLEPSDPATKVVGLILGTPEFQRQ
Number of Associated Samples 78
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 95.00 %
Associated GOLD sequencing projects 68
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(13.000 % of family members)
Environment Ontology (ENVO) Unclassified
(65.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(68.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.33%    β-sheet: 0.00%    Coil/Unstructured: 58.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF07394DUF1501 72.00
PF02875Mur_ligase_C 1.00
PF04389Peptidase_M28 1.00
PF03551PadR 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 1.00
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.00
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.00 %
UnclassifiedrootN/A8.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003993|Ga0055468_10009840All Organisms → cellular organisms → Bacteria1807Open in IMG/M
3300004114|Ga0062593_103093172All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300004156|Ga0062589_100874477All Organisms → cellular organisms → Bacteria → Acidobacteria824Open in IMG/M
3300004156|Ga0062589_100901951All Organisms → cellular organisms → Bacteria → Acidobacteria814Open in IMG/M
3300004157|Ga0062590_102520078All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300004157|Ga0062590_102567743All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300004643|Ga0062591_101718715All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300004643|Ga0062591_101831015All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300004643|Ga0062591_101977508All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300004643|Ga0062591_102723149All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005332|Ga0066388_106601723All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005334|Ga0068869_100458550All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1058Open in IMG/M
3300005338|Ga0068868_101172647All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300005343|Ga0070687_101252763All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300005345|Ga0070692_10882778All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300005354|Ga0070675_102167331All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005355|Ga0070671_101167230All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300005564|Ga0070664_102088015Not Available538Open in IMG/M
3300005577|Ga0068857_101948992All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300005577|Ga0068857_102329362All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005578|Ga0068854_101937858All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300005615|Ga0070702_101588325All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300005616|Ga0068852_101469495All Organisms → cellular organisms → Bacteria → Acidobacteria704Open in IMG/M
3300005834|Ga0068851_11001105Not Available527Open in IMG/M
3300005834|Ga0068851_11105102All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005842|Ga0068858_100144067All Organisms → cellular organisms → Bacteria2237Open in IMG/M
3300005843|Ga0068860_102314771All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300006169|Ga0082029_1720686All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300006358|Ga0068871_100427372All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300006755|Ga0079222_10267777All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1089Open in IMG/M
3300006844|Ga0075428_100453459All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1374Open in IMG/M
3300006881|Ga0068865_101465189All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia611Open in IMG/M
3300006881|Ga0068865_101597298All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300006954|Ga0079219_10123400All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300007004|Ga0079218_10287294All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1326Open in IMG/M
3300009093|Ga0105240_10964897All Organisms → cellular organisms → Bacteria → Acidobacteria914Open in IMG/M
3300009098|Ga0105245_11115131All Organisms → cellular organisms → Bacteria → Acidobacteria835Open in IMG/M
3300009098|Ga0105245_12292057All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300009098|Ga0105245_12347767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300009098|Ga0105245_12925677All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300009100|Ga0075418_11602990All Organisms → cellular organisms → Bacteria → Acidobacteria707Open in IMG/M
3300009101|Ga0105247_10050672All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2555Open in IMG/M
3300009148|Ga0105243_10673490All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1005Open in IMG/M
3300009156|Ga0111538_12796922All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300009174|Ga0105241_11118479Not Available743Open in IMG/M
3300009174|Ga0105241_11338526All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300009177|Ga0105248_13121651All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300010044|Ga0126310_10970431All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300010166|Ga0126306_10780231All Organisms → cellular organisms → Bacteria → Acidobacteria770Open in IMG/M
3300010396|Ga0134126_11454729All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300010399|Ga0134127_13605839All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300010400|Ga0134122_10915876All Organisms → cellular organisms → Bacteria → Acidobacteria850Open in IMG/M
3300013296|Ga0157374_11118002All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300013297|Ga0157378_10373836Not Available1398Open in IMG/M
3300013307|Ga0157372_11440569Not Available794Open in IMG/M
3300013308|Ga0157375_11152607All Organisms → cellular organisms → Bacteria → Acidobacteria908Open in IMG/M
3300014325|Ga0163163_11791451Not Available674Open in IMG/M
3300014968|Ga0157379_10673416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium970Open in IMG/M
3300014968|Ga0157379_10802665All Organisms → cellular organisms → Bacteria → Acidobacteria888Open in IMG/M
3300015374|Ga0132255_102023591All Organisms → cellular organisms → Bacteria → Acidobacteria877Open in IMG/M
3300018476|Ga0190274_10104777All Organisms → cellular organisms → Bacteria2261Open in IMG/M
3300021445|Ga0182009_10814583All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300025904|Ga0207647_10199403All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300025911|Ga0207654_11195096All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300025923|Ga0207681_10659397All Organisms → cellular organisms → Bacteria → Acidobacteria868Open in IMG/M
3300025933|Ga0207706_10479041All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300025942|Ga0207689_11458451All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300025945|Ga0207679_10693588All Organisms → cellular organisms → Bacteria → Acidobacteria923Open in IMG/M
3300025960|Ga0207651_10932974All Organisms → cellular organisms → Bacteria → Acidobacteria774Open in IMG/M
3300025960|Ga0207651_10933474All Organisms → cellular organisms → Bacteria → Acidobacteria774Open in IMG/M
3300025981|Ga0207640_12144458All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300026032|Ga0208419_1043453All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300026035|Ga0207703_10541116All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1097Open in IMG/M
3300026035|Ga0207703_11354758Not Available684Open in IMG/M
3300026088|Ga0207641_12497690All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300026095|Ga0207676_10425648All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300026095|Ga0207676_10728874All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium963Open in IMG/M
3300026116|Ga0207674_11607293All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300026116|Ga0207674_11716458Not Available596Open in IMG/M
3300026116|Ga0207674_11788572All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300026118|Ga0207675_100117939All Organisms → cellular organisms → Bacteria2509Open in IMG/M
3300026118|Ga0207675_100361268All Organisms → cellular organisms → Bacteria → Acidobacteria1425Open in IMG/M
3300026118|Ga0207675_101122071All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium806Open in IMG/M
3300026142|Ga0207698_10774389All Organisms → cellular organisms → Bacteria → Acidobacteria960Open in IMG/M
3300026142|Ga0207698_11412462All Organisms → cellular organisms → Bacteria → Acidobacteria711Open in IMG/M
3300027787|Ga0209074_10088834All Organisms → cellular organisms → Bacteria → Acidobacteria1024Open in IMG/M
3300027886|Ga0209486_11284993All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300027909|Ga0209382_10430635All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1465Open in IMG/M
3300028380|Ga0268265_12542612All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300028381|Ga0268264_11427543All Organisms → cellular organisms → Bacteria → Acidobacteria703Open in IMG/M
3300028381|Ga0268264_11572809All Organisms → cellular organisms → Bacteria → Acidobacteria668Open in IMG/M
3300031455|Ga0307505_10006950All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes6104Open in IMG/M
3300031547|Ga0310887_10883021All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300031716|Ga0310813_11263126All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300031908|Ga0310900_11959023All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031911|Ga0307412_10385045All Organisms → cellular organisms → Bacteria1137Open in IMG/M
3300032004|Ga0307414_10262089All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1443Open in IMG/M
3300032126|Ga0307415_101147634All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300032179|Ga0310889_10315269All Organisms → cellular organisms → Bacteria → Acidobacteria758Open in IMG/M
3300033412|Ga0310810_10454309All Organisms → cellular organisms → Bacteria1296Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere13.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere13.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil9.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.00%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest1.00%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026032Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0055468_1000984033300003993Natural And Restored WetlandsAILAGEISATTKATLLKQLDQSDPVTKVVGLILGTPEFQRQ*
Ga0062593_10309317223300004114SoilSKVMDDYLKIILAGEISVATKEAMLKQLDKSDPVTKVVGLILGTPEFQRQ*
Ga0062589_10087447713300004156SoilLLAGDISAATRETLLKQLQPSDATTKVVGLILGTPEFQRQ*
Ga0062589_10090195123300004156SoilYLKQLLAGDISAATRETLLKQLQPSDSTTKVVGLILGTPEFQRQ*
Ga0062590_10252007823300004157SoilNGDQSKVMDEYLKQLLAGDISAATRETLLKQLQPSDSTTKVVGLILGTPEFQRQ*
Ga0062590_10256774313300004157SoilVQGTTVSLANTNGAQAKVMDEYLKTILGGEISSATRETLLKQLEPSDPATKVVGLILGTPEFQRQ*
Ga0062591_10171871523300004643SoilLKTILAGEISSATRETLLKQLEPSDPATKVVGLILGTPEFQRQ*
Ga0062591_10183101523300004643SoilMDEYLNTLLAGDISAATREALLKQLEPTDPVTKVVGLILGTPEFQRQ*
Ga0062591_10197750813300004643SoilGNQSKVMDEYLKQLLAADISAATRETLLKQLQPSDSTTKVVGLILGTPEFQRQ*
Ga0062591_10272314923300004643SoilSLATTNGAQAKVMDEYLKTILGGEISSATRETLLKQLEPSDPATKVVGLILGTPEFQRQ*
Ga0066388_10660172313300005332Tropical Forest SoilSKLSTDQSEVMADYLKILLAGEISVATKEAMLKQLDKSDPVTKVVGLILGTPEFQRQ*
Ga0068869_10045855013300005334Miscanthus RhizosphereVSLSTLNGDQAKVMDQYLKTLLAGEISSATRETLLKQLDPADPVTKVVGLILGTPEFQRQ
Ga0068868_10117264723300005338Miscanthus RhizosphereILAAEVSAATRETLLKQLDQSDPVTKVVGLILGTPEFQRQ*
Ga0070687_10125276323300005343Switchgrass RhizosphereDEYLKTLLAGDISAATRDALLKQLEPSDPATKVVGLILGTPEFQRQ*
Ga0070692_1088277823300005345Corn, Switchgrass And Miscanthus RhizosphereSNRVQGTRVDLAKSGEQAKVMDEYLNTLLAGDISAATREALLKQLEPTDPVTKVVGLILGTPEFQRQ*
Ga0070675_10216733123300005354Miscanthus RhizosphereKTILAGEVSAATRATLVKQVEPADPITKVVGLILGTPEFQRQ*
Ga0070671_10116723013300005355Switchgrass RhizosphereKLMDEYLRTLLAGEISAATRETLLKQLDPADPVTKVVGLILGTPEFQRQ*
Ga0070664_10208801513300005564Corn RhizosphereAGANPEKRKMIDDSLKSILAGEVSTATRETLLKQVDQADPIAKVIGLILGTPEFQRQ*
Ga0068857_10194899223300005577Corn RhizosphereMDEYLKNLLAGEVSTATRAALVKQLDQSDPVTKVVGLILGTPEFQRQ*
Ga0068857_10232936223300005577Corn RhizosphereLAGEISTPTRETLLKQLDPADPVTKVVGLILGTPEFQRQ*
Ga0068854_10193785823300005578Corn RhizosphereTKVAGANTDKAKVIDESVKTILAGELSAATRETLMKQLDPSDPVTKVVGLILGTPEFQRQ
Ga0070702_10158832523300005615Corn, Switchgrass And Miscanthus RhizosphereKTLLAGDISAATREALLKQLEPSDPATKVVGLILGTPEFQRQ*
Ga0068852_10146949523300005616Corn RhizosphereDISAATRDALLKQLEPSDPATKVVGLILGTPEFQRQ*
Ga0068851_1100110513300005834Corn RhizosphereEQAKVMDEYLKTLLTGDISAASREALLKQLEPTDPATKVVGLILGTPEFQRQ*
Ga0068851_1110510213300005834Corn RhizosphereEQAKVMDEYLKTLLAGDISAATREALLKQLEPTDPVAKVVGLILGTPEFQRQ*
Ga0068858_10014406733300005842Switchgrass RhizosphereNGDQSKVMDEYLKQLLAGDISAATRETLLKQLQPSDATTKVVGLILGTPEFQRQ*
Ga0068860_10231477113300005843Switchgrass RhizosphereALANNRVQGTKVSLSQTKGEQVKVMDEYLKTLLAGDISAATREALLKQLEPSDPPTKVVGLILGTPEFQRQ*
Ga0082029_172068613300006169Termite NestRVSLSKTDGDQTKVMDEYLKTLLAGEISSPTRETLLKQLDPADPVTKVVGLILGTPEFQRQ*
Ga0068871_10042737223300006358Miscanthus RhizosphereANTNGAQAKVMDEYLKTILGGEISSATRETLLKQLEPSDPATKVVGLILGTPEFQRQ*
Ga0079222_1026777713300006755Agricultural SoilVMDDYLKTLLAGDISAATREALLKQLEPADPATKVVGLILGTPEFQRQ*
Ga0075428_10045345913300006844Populus RhizosphereTSQAKVLDQSLKTILAGEMSAGTRETLLKQLDQSDPVTKVVGLILGTPEFQRQ*
Ga0068865_10146518923300006881Miscanthus RhizosphereVDLSKLTANETSQAKVLDQSLKTILAGEMSAATRETLLKQLDQSDPVTKVVGLILGTPEIQRQ*
Ga0068865_10159729823300006881Miscanthus RhizosphereQSKVMDDYLKILLAGEISAGTREAMLKQLDKSDPVTKVVGLILGTPEFQRQ*
Ga0079219_1012340013300006954Agricultural SoilLNSDQSRVMDDYLKNLLAGEVSTATREALVKQLDQSDPVTKVVGLILGTPEFQRQ*
Ga0079218_1028729423300007004Agricultural SoilKRKLIDQSLRTILAGEVSAATRETLLKQVGDVDRADPVTKVVGLILGTPEFQRQ*
Ga0105240_1096489723300009093Corn RhizosphereYLQTILAGDISASTKDALMKQLAQSDRPTKVVGLILGTPEFQRQ*
Ga0105245_1111513113300009098Miscanthus RhizosphereDISAATREALLKQLEPSDPATKVVGLILGTPEFQRQ*
Ga0105245_1229205713300009098Miscanthus RhizosphereETSQAKVLDQSLKTILAGEMSAATRETLLKQLDQSDTVTKVVGLILGTPEFQRQ*
Ga0105245_1234776713300009098Miscanthus RhizosphereTVSLVKTNGEQAKVMDEYLKTLLAGDISAATRDALLKQLEPTDPATKVVGLILGTPEFQRQ*
Ga0105245_1292567723300009098Miscanthus RhizosphereTVSLVKTNGEQAKVMDEYLKTILAGEISATTRETLLKQLEPSDPVTKVVGLILGTPEFQRQ*
Ga0075418_1160299013300009100Populus RhizosphereTTILAGEVSATTKETLLKQVNEADPVAKVVGLILGTPEFQRQ*
Ga0105247_1005067213300009101Switchgrass RhizosphereMDEYLKTILGGEISPATRETLLKQLEPSDPATKVVGLILGTP
Ga0105243_1067349013300009148Miscanthus RhizosphereKVMDEYLKTLLAGDISAATREALLKQLEPSDPATKVVGLILGTPEFQRQ*
Ga0111538_1279692223300009156Populus RhizosphereILAGEISASTKEALMKQRGQSAPARKGARLILGTPEFQRQ*
Ga0105241_1111847923300009174Corn RhizosphereVLDEYLKSMLAGDISASTREALTKQLKQTDPPTKVVGLILGTPEFQRQ*
Ga0105241_1133852623300009174Corn RhizosphereLKSLLAGEISSPTRETLLKQLDPADPVTKVVGLILGTPEFQRQ*
Ga0105248_1312165113300009177Switchgrass RhizosphereRRQLFDESVKTILAGELSAATRETLMKQLDPSDPVTKVVGLILGTPEFQRQ*
Ga0126310_1097043113300010044Serpentine SoilGTRVDLAKLTAGDMNQARMMDESLKTILAGEISQATRETLLKQLDQSDPPAKVVGLILGTPEFQRQ*
Ga0126306_1078023113300010166Serpentine SoilDESLKTILAGEVSAATRETLLKQLAQSDPVTKVVGLILGTPEFQRQ*
Ga0134126_1145472913300010396Terrestrial SoilAKVMDEYLNTLLAGDISAATREALLKQLEPTDPVTKVVGLILGTPEFQRQ*
Ga0134127_1360583913300010399Terrestrial SoilNKMIDESLKTILAGEVSAATRATLLKQVEAADPITKVVGLILGTPEFQRQ*
Ga0134122_1091587613300010400Terrestrial SoilTSGDKSQSKVMDESLKTILAGEISSATRETLLKQLDQSDPVTKVVGLILGTPEFQRQ*
Ga0157374_1111800223300013296Miscanthus RhizosphereMDEYLKTILAGEISVATREALLKQLEPADPVTKVVGLILGTPEFQRQ*
Ga0157378_1037383613300013297Miscanthus RhizosphereEISSATRETLLKQLDPADPVTKVVGLILGTPEFQRQ*
Ga0157372_1144056923300013307Corn RhizosphereDLAKSGEQAKVMDEYLNTLLAGDISAATREALLKQLEPTDPVTKVVGLILGTPEFQRQ*
Ga0157375_1115260713300013308Miscanthus RhizosphereAGEVSAATRATLVKQVEPADPITKVVGLILGTPEFQRQ*
Ga0163163_1179145123300014325Switchgrass RhizosphereMDEYLKTLLAGDISAATREALLKQLEPSDPATKVVGLILGTPEFQRQ*
Ga0157379_1067341613300014968Switchgrass RhizosphereKTILAGEMSAATRETLLKQLDQSDPVTKVVGLILGTPEFQRQ*
Ga0157379_1080266513300014968Switchgrass RhizosphereLAGDISAATRETLLKQLHPSDATTKVVGLILGTPEFQRQ*
Ga0132255_10202359123300015374Arabidopsis RhizospherePGTIVSLSKANGEQSKVMDEYLKQLLAGDISAATRETLLKQLQPSDSTTKVVGLILGTPEFQRQ*
Ga0190274_1010477733300018476SoilDQSKLLDEYLKTILAGDISASTKEALAKQLRQSDPATKVVGLILGTPEFQRQ
Ga0182009_1081458323300021445SoilETSQAKVMDESLKTILAGDISAATKETLLKQLAQNDPASKVVGLILGTPEFQRQ
Ga0207647_1019940313300025904Corn RhizosphereRVDLTRFTSGDKSQSKVMDESLKTILAGEISSATRETLLKQLDQSDPVTKVVGLILGTPEFQRQ
Ga0207654_1119509613300025911Corn RhizosphereLSKLTANETSQAKVLDQSLKTILAGEMSAATRETLLKQLDQSDPVTKVVGLILGTPEFQR
Ga0207681_1065939723300025923Switchgrass RhizosphereNVSLSKSNGDQSKVMDEYLKQLLAGDISAATRETLLKQLQPSDSTTKVVGLILGTPEFQR
Ga0207706_1047904123300025933Corn RhizosphereYLKTLLAGDISAATREALLKQLEPSDPATKVVGLILGTPEFQRQ
Ga0207689_1145845113300025942Miscanthus RhizosphereVNLANTNGDQSKVLDEYLKSILAGDISASTKEALMKQLGQSDPATKVVGLILGTPEFQRQ
Ga0207679_1069358823300025945Corn RhizosphereTLLAGDISAATREALLKQLEPTDPATKVVGLILGTPEFQRQ
Ga0207651_1093297413300025960Switchgrass RhizosphereLLAGEISAGTREAMLKQLDKSDPVTKVVGLILGTPEFQRQ
Ga0207651_1093347423300025960Switchgrass RhizosphereLANNRVQGTKVSLSQTNGEQAKVMDEYLKTLLAGDISAATREALLKQLEPSDPPTKVVGLILGTPEFQRQ
Ga0207640_1214445823300025981Corn RhizosphereKVDLTKVAGANTDKAKVIDESVKTILAGELSAATRETLMKQLDPSDPVTKVVGLILGTPEFQRQ
Ga0208419_104345313300026032Natural And Restored WetlandsAGEVSAATRQTLLKQVDQADPITKVVGLILGTPEFQRQ
Ga0207703_1054111613300026035Switchgrass RhizosphereLSKSNGDQSKVMDEYLKQLLAGDISAATRETLLKQLQPSDATTKVVGLILGTPEFQRQ
Ga0207703_1135475813300026035Switchgrass RhizosphereTLLAGDISPATREALLKQLEPSDPATKVVGLILGTPEFQRQ
Ga0207641_1249769023300026088Switchgrass RhizosphereISAATRETLLKQLDPADPVTKVVGLILGTPEFQRQ
Ga0207676_1042564813300026095Switchgrass RhizosphereNTLLAGDISAATREALLKQLEPTDPVTKVVGLILGTPEFQRQ
Ga0207676_1072887413300026095Switchgrass RhizosphereDEYLKTLLAGDISASTREALLKQLEPSDPVTKVVGLILGTPEFQRQ
Ga0207674_1160729323300026116Corn RhizosphereNLLAGEVSTATRAALVKQLDQSDPVTKVVGLILGTPEFQRQ
Ga0207674_1171645813300026116Corn RhizosphereYLKSLLAGEISSPTRETLLKQLDPADPVAKVVGLILGTPEFQRQ
Ga0207674_1178857223300026116Corn RhizosphereYLNTLLAGDISAATREALLKQLEPTDPVTKVVGLILGTPEFQRQ
Ga0207675_10011793943300026118Switchgrass RhizosphereTNGGQAKVMDEYLKTILGGEISSATRETLLKQLEPSDPATKVVGLILGTPEFQRQ
Ga0207675_10036126833300026118Switchgrass RhizosphereLDEYLKTILAGEISASTKEALMKQLGQSDPATKVVGLILGTPEFQRQ
Ga0207675_10112207113300026118Switchgrass RhizosphereLAGEISAGTREAMLKQLDKSDPVTKVVGLILGTPEFQRQ
Ga0207698_1077438913300026142Corn RhizosphereGANTDKAKVIDESVKTILAGELSAATRETLMKQLDPSDPVTKVVGLILGTPEFQRQ
Ga0207698_1141246213300026142Corn RhizosphereTILAAEVSAATRETLLKQLDQSDPVTKVVGLILGTPEFQRQ
Ga0209074_1008883423300027787Agricultural SoilMDDYLKTLLAGDISAATREALLKQLEPADPATKVVGLILGTPEFQRQ
Ga0209486_1128499313300027886Agricultural SoilAPIVKENTEKKKLVDESLKLILAGDVSAATRETLLKQVDQSDPITKVVGLILGTPEFQRQ
Ga0209382_1043063513300027909Populus RhizosphereRLLDEYLKTILAGEISASTKEALMKQLGQSDPATKVVGLILGTPEFQRQ
Ga0268265_1254261213300028380Switchgrass RhizosphereEYLKILLAGEISADTRETMLKQLDPSDPVTKVVGLILGTPEFQRQ
Ga0268264_1142754323300028381Switchgrass RhizosphereNRAATRETLMKQLDPSDPVTKVVGLILGTPEFQRQ
Ga0268264_1157280923300028381Switchgrass RhizosphereKTLLAGDISAATREALLKQLEPSDPATKVVGLILGTPEFQRQ
Ga0307505_1000695083300031455SoilAGEVSTATKETLLKQLDQADPIAKVVGLILGTPEFQRQ
Ga0310887_1088302123300031547SoilILAREVSAATRATLLKQVEAADPITKVVGLILGTPEFQRQ
Ga0310813_1126312623300031716SoilLAKLDGDQGKVLDEYLQTILAGEISATTKEALRKQLAQTDPPTKVVGLILGTPEFQRQ
Ga0310900_1195902323300031908SoilISAATRETLLKQLEPSDPATKVVGLILGTPEFQRQ
Ga0307412_1038504523300031911RhizosphereTRVDLTRFTSGDKSQSKVMDESLKTILAGEISSATRETLLKQLDQSDPVTKVVGLILGTPEFQRQ
Ga0307414_1026208923300032004RhizosphereQSKVIDDYLKILLAGEISAATKEAMLKQLDKSDPVTKVVGLILGTPEFQRQ
Ga0307415_10114763423300032126RhizosphereNTDKSKLIDESLKTILAGEVSATTKQTLLKQVDQSDPITKVVGLILGTPEFQRQ
Ga0310889_1031526913300032179SoilNKMIDESLKTILAGEVSAATRATLVKQVEPADPITKVVGLILGTPEFQRQ
Ga0310810_1045430913300033412SoilEYLKTILGGEISSATRETLLKQLEPSDPATKVVGLILGTPEFQRQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.