NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105747

Metagenome / Metatranscriptome Family F105747

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105747
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 52 residues
Representative Sequence MATKGSAFRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEALRRETWGLV
Number of Associated Samples 87
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.88 %
% of genes near scaffold ends (potentially truncated) 95.00 %
% of genes from short scaffolds (< 2000 bps) 92.00 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(24.000 % of family members)
Environment Ontology (ENVO) Unclassified
(41.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.57%    β-sheet: 7.79%    Coil/Unstructured: 63.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF00076RRM_1 38.00
PF02518HATPase_c 2.00
PF00072Response_reg 1.00
PF00118Cpn60_TCP1 1.00
PF00011HSP20 1.00
PF13561adh_short_C2 1.00
PF07978NIPSNAP 1.00
PF00872Transposase_mut 1.00
PF03007WES_acyltransf 1.00
PF00365PFK 1.00
PF03486HI0933_like 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0493NADPH-dependent glutamate synthase beta chain or related oxidoreductaseAmino acid transport and metabolism [E] 2.00
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 2.00
COG0029Aspartate oxidaseCoenzyme transport and metabolism [H] 1.00
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 1.00
COG02056-phosphofructokinaseCarbohydrate transport and metabolism [G] 1.00
COG0446NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductaseLipid transport and metabolism [I] 1.00
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 1.00
COG0492Thioredoxin reductasePosttranslational modification, protein turnover, chaperones [O] 1.00
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 1.00
COG1053Succinate dehydrogenase/fumarate reductase, flavoprotein subunitEnergy production and conversion [C] 1.00
COG1249Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductaseEnergy production and conversion [C] 1.00
COG2072Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcDInorganic ion transport and metabolism [P] 1.00
COG2081Predicted flavoprotein YhiNGeneral function prediction only [R] 1.00
COG2509FAD-dependent dehydrogenaseGeneral function prediction only [R] 1.00
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 1.00
COG3634Alkyl hydroperoxide reductase subunit AhpFDefense mechanisms [V] 1.00
COG4908Uncharacterized conserved protein, contains a NRPS condensation (elongation) domainGeneral function prediction only [R] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.00 %
UnclassifiedrootN/A23.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_103537487All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium540Open in IMG/M
3300000955|JGI1027J12803_108174364All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1099Open in IMG/M
3300004055|Ga0055480_10006310All Organisms → cellular organisms → Bacteria → Proteobacteria4650Open in IMG/M
3300005167|Ga0066672_10881701All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300005178|Ga0066688_10105783All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1724Open in IMG/M
3300005180|Ga0066685_10069363All Organisms → cellular organisms → Bacteria2306Open in IMG/M
3300005180|Ga0066685_10101768All Organisms → cellular organisms → Bacteria1919Open in IMG/M
3300005180|Ga0066685_10646128All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium727Open in IMG/M
3300005186|Ga0066676_10114858All Organisms → cellular organisms → Bacteria1652Open in IMG/M
3300005187|Ga0066675_10396635All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1018Open in IMG/M
3300005353|Ga0070669_100454841All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300005364|Ga0070673_102240904All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium519Open in IMG/M
3300005441|Ga0070700_101878842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300005445|Ga0070708_100684703Not Available965Open in IMG/M
3300005445|Ga0070708_101293255All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium681Open in IMG/M
3300005447|Ga0066689_10643316All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium666Open in IMG/M
3300005447|Ga0066689_10699835Not Available634Open in IMG/M
3300005457|Ga0070662_101881360All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005467|Ga0070706_101762341Not Available563Open in IMG/M
3300005518|Ga0070699_101618702All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300005526|Ga0073909_10145807Not Available982Open in IMG/M
3300005536|Ga0070697_100952164All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium762Open in IMG/M
3300005549|Ga0070704_102182306All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium515Open in IMG/M
3300005558|Ga0066698_10096322All Organisms → cellular organisms → Bacteria1947Open in IMG/M
3300005559|Ga0066700_10594716All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium771Open in IMG/M
3300005598|Ga0066706_10188340All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1578Open in IMG/M
3300005713|Ga0066905_100663708All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium890Open in IMG/M
3300005719|Ga0068861_100776233All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300005719|Ga0068861_101130348All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium754Open in IMG/M
3300005843|Ga0068860_102740837All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300005844|Ga0068862_102106130All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium575Open in IMG/M
3300006173|Ga0070716_100583182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium839Open in IMG/M
3300006796|Ga0066665_10844190Not Available716Open in IMG/M
3300006796|Ga0066665_11332241Not Available552Open in IMG/M
3300006797|Ga0066659_10502281All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium972Open in IMG/M
3300006797|Ga0066659_11518210All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M
3300006844|Ga0075428_101278484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium772Open in IMG/M
3300006844|Ga0075428_101876462All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium623Open in IMG/M
3300006845|Ga0075421_101384743All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium775Open in IMG/M
3300006854|Ga0075425_102448591Not Available578Open in IMG/M
3300006871|Ga0075434_101376988All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium716Open in IMG/M
3300006904|Ga0075424_100756539All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1037Open in IMG/M
3300009094|Ga0111539_10777041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1115Open in IMG/M
3300009137|Ga0066709_102010541All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium801Open in IMG/M
3300009162|Ga0075423_13124629All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300010102|Ga0127453_1018167Not Available595Open in IMG/M
3300010304|Ga0134088_10176973Not Available1019Open in IMG/M
3300010320|Ga0134109_10021802All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1972Open in IMG/M
3300010321|Ga0134067_10095196All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1013Open in IMG/M
3300010329|Ga0134111_10402285Not Available586Open in IMG/M
3300010336|Ga0134071_10247248All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium888Open in IMG/M
3300010336|Ga0134071_10471196All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300010336|Ga0134071_10701997Not Available535Open in IMG/M
3300010399|Ga0134127_10683541All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1064Open in IMG/M
3300012199|Ga0137383_11084014All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium581Open in IMG/M
3300012200|Ga0137382_10596075All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium789Open in IMG/M
3300012361|Ga0137360_10390282All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1172Open in IMG/M
3300012362|Ga0137361_11773322All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300012371|Ga0134022_1043759All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium718Open in IMG/M
3300012384|Ga0134036_1201102Not Available501Open in IMG/M
3300012387|Ga0134030_1131302All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium627Open in IMG/M
3300012582|Ga0137358_10236914Not Available1243Open in IMG/M
3300012582|Ga0137358_10915424All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300012922|Ga0137394_10861628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium757Open in IMG/M
3300012929|Ga0137404_10226333All Organisms → cellular organisms → Bacteria1596Open in IMG/M
3300012930|Ga0137407_12440824All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300012977|Ga0134087_10114641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1141Open in IMG/M
3300013297|Ga0157378_11153674All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium813Open in IMG/M
3300013308|Ga0157375_13180280All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300014157|Ga0134078_10335954All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium660Open in IMG/M
3300014317|Ga0075343_1169044All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300014867|Ga0180076_1000909All Organisms → cellular organisms → Bacteria → Proteobacteria3947Open in IMG/M
3300015357|Ga0134072_10023880Not Available1547Open in IMG/M
3300015358|Ga0134089_10089870All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1166Open in IMG/M
3300017654|Ga0134069_1072475Not Available1102Open in IMG/M
3300018468|Ga0066662_12386597Not Available556Open in IMG/M
3300019248|Ga0180117_1151870All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium601Open in IMG/M
3300025922|Ga0207646_11364535All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium617Open in IMG/M
3300025986|Ga0207658_11915606All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium540Open in IMG/M
3300026067|Ga0207678_11820792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium533Open in IMG/M
3300026118|Ga0207675_100276900All Organisms → cellular organisms → Bacteria1629Open in IMG/M
3300026121|Ga0207683_12148315All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300026343|Ga0209159_1032838Not Available2749Open in IMG/M
3300026524|Ga0209690_1205242All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium626Open in IMG/M
3300026524|Ga0209690_1240279All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium569Open in IMG/M
3300026528|Ga0209378_1146529Not Available954Open in IMG/M
3300026528|Ga0209378_1169513All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium818Open in IMG/M
3300026540|Ga0209376_1254612All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium747Open in IMG/M
3300026548|Ga0209161_10412471All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300028592|Ga0247822_11477849All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300029636|Ga0222749_10325395All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium800Open in IMG/M
3300031547|Ga0310887_11139325All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300031720|Ga0307469_11613621Not Available623Open in IMG/M
3300031797|Ga0318550_10466847All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300032136|Ga0316201_10187615All Organisms → cellular organisms → Bacteria1800Open in IMG/M
3300032180|Ga0307471_102474224All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium657Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil24.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil16.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.00%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.00%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow1.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.00%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.00%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004055Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D2EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010102Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012371Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012384Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012387Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014317Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300014867Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10DEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019248Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10353748723300000559SoilLPTKGSTCRAEGNPTLRTICANCGKSIPTEVGHRHPLDEALRRETWGL
JGI1027J12803_10817436433300000955SoilLPTKGSAYRAEGNPTLRTVCSNCDKSIPTEVGHAHPLDEGLRRETWGLVGYHEGRK
Ga0055480_1000631013300004055Natural And Restored WetlandsVAIKGSAVRAEGNQSLRTLCASCGTSIPTEVGHAHPLDESVRRETWGLLGR
Ga0066672_1088170123300005167SoilMATKGSAFRAEGNRALRTLCAHCATSIPTEVGHAHPRDEALRRETWGLVGHTDGPPSVFP
Ga0066688_1010578353300005178SoilMATKGSAFRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEALRRETWG
Ga0066685_1006936353300005180SoilMATRGSALRAEGNVGLRTLCVHCGTSIPTEVGHAHPLDQAIRRETWGLVGHT
Ga0066685_1010176853300005180SoilMATKGSAFRAEGNRALRTLCAHCGTLIPTEVGHAHPLDEALRRETWGLVGHTDGPPSVFP
Ga0066685_1064612823300005180SoilMPTKGSSCRAEGNQTLRTVCANCGRSIPTEVGHAHPLDEDIRRETWGLVGYHA
Ga0066676_1011485833300005186SoilMATRGSAFRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEALRRETWGLV
Ga0066675_1039663513300005187SoilMPSKGSAYRAEGNPTLRTVCAHCGKSIPTEVGHAHPLDVDLRRETWGLVGYH
Ga0070669_10045484113300005353Switchgrass RhizosphereVAVKGSALRAEGNPTLRTVCAKCGKSIPTEAGHPHPLDETLVRETWGLVGYLAGEKTVF
Ga0070673_10224090413300005364Switchgrass RhizosphereVAAKGSALRAEGNPTLRTTCASCGKSIPTEVGHAHPLDEAVRHETWGLVGTV
Ga0070700_10187884223300005441Corn, Switchgrass And Miscanthus RhizosphereMPVKGSALRAEGNPLLRTVCARCGAAIPTEVGHAHPLDETRRRETWGLVGHGDGPP
Ga0070708_10068470313300005445Corn, Switchgrass And Miscanthus RhizosphereMATKGSAFRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEAL
Ga0070708_10129325513300005445Corn, Switchgrass And Miscanthus RhizosphereVAIKGSAYRSEGNPTLRTTCAHCGKSIPTETGNAHPLDEAVRRET
Ga0066689_1064331613300005447SoilMATKGSAFRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEA
Ga0066689_1069983523300005447SoilMATRGSALRAEGNVGLRTLCVHCGTSIPTEVGHAHPLDQAIRRETWGLVGH
Ga0070662_10188136013300005457Corn RhizosphereMATKGSAHRAEVNQTLRTVCAHCGKSIPTEVGHAHPLEEGIRRETWGLVGHQAAHKMVF
Ga0070706_10176234113300005467Corn, Switchgrass And Miscanthus RhizosphereMAIRGSALRAEGNRSLRTLCVHCGTSIPTEVGHAHPLEEAFRRETWG
Ga0070699_10161870223300005518Corn, Switchgrass And Miscanthus RhizosphereMATKGSAHRAEVNQTLRTVCAHCGKSIPTEVGHAHPLEEGIRRETWGLVGHQAAHKMV
Ga0073909_1014580713300005526Surface SoilMATRGSAVRAEGNRGLRTLCAPCGTSIPTEVGHAHPLDEAL
Ga0070697_10095216423300005536Corn, Switchgrass And Miscanthus RhizosphereMATRGSAVRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEALRRETWGLVGHTDGPPSVFPTCTA
Ga0070704_10218230613300005549Corn, Switchgrass And Miscanthus RhizosphereMATKGSTLRAEGNSLLRTVCAHCGTSIPTEVGHAHPLDQSLRRETWG
Ga0066698_1009632213300005558SoilMATRGSAFRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEALRRETWG
Ga0066700_1059471633300005559SoilMATRGSAFRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEA
Ga0066706_1018834043300005598SoilMATKGSAFRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEALRRETWGLVGHTDGPPSVFPTC
Ga0066905_10066370833300005713Tropical Forest SoilLPTKGSACRAEGNPTLRARCARCGKSIPTEIGHAHPLDEDLRRETWGLVGYRDGRKTVFP
Ga0068861_10077623323300005719Switchgrass RhizosphereMATKGSAHRAEVNQTLRTVCAHCGKSIPTEVGHAHPLEEGIRRETWGLVGHQAAHKMVFP
Ga0068861_10113034813300005719Switchgrass RhizosphereMAIKGSAVRAEGNPLLRTLCAHCGAPIPTEVGHAHPLDEAVRRETWGLVGHTD
Ga0068860_10274083723300005843Switchgrass RhizosphereMATKGSAVRAEGNSLLRTLCAHCGTSIPTEVGHAHPLDEARRRETWGLVGHTDGPPSVFPTCTP
Ga0068862_10210613013300005844Switchgrass RhizosphereMAIKGSTFRAEGNALLRTLCAHCGTSIPTEVGHAHPLDEALRRETWGLVGHGDGPPS
Ga0070716_10058318213300006173Corn, Switchgrass And Miscanthus RhizosphereMATRGSAVRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEALRRETWGLVGHTDGP
Ga0066665_1084419023300006796SoilMAIRGSALRAEGNRSLRTLCVHCGTSIPTEVGHAHPLDEAIRRETWGLVGHTDGPPSVFP
Ga0066665_1133224113300006796SoilMATRGSALRAEGNVGLRTLCVHCGTSIPTEVGHAHPLDQAIRRETWGLVGHTHGA
Ga0066659_1050228133300006797SoilMATKGSAFRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEALRRETWGLV
Ga0066659_1151821033300006797SoilMATRGSAFRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEALRRET
Ga0075428_10127848433300006844Populus RhizosphereVPSKGSSYRAEGNPTLRTVCASCGRSIPTEVGHAHPLDEDVRRETWGLVGYHA
Ga0075428_10187646223300006844Populus RhizosphereMAARGSSLRAEGNLTLRTVCASCGKSIPTEVGHPHPLDESLRRETYALVGYLRGLRAIY
Ga0075421_10138474313300006845Populus RhizosphereMAIKGSALRAEGNHVLRTLCAHCGTSIPTEVGHAHPLDEALRRETWGLVGHGDGPP
Ga0075425_10244859133300006854Populus RhizosphereMATRGSAVRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEALRRETWGLVGH
Ga0075434_10137698823300006871Populus RhizosphereLPTKGSACRAEGNPTLRTICASCGKSIPTEVGHAHPLDEDVRRETWGLVGYHGEEK
Ga0075424_10075653913300006904Populus RhizosphereMPTKGSAIRAEGNSLLRTVCAHCGTSIPTEVGHAHPL
Ga0111539_1077704123300009094Populus RhizosphereVAVKGSALRAEGNATLRTVCAKCGKSIPTEAGHPHPLDETLARETWGLVGYL
Ga0075418_1272574423300009100Populus RhizosphereMAIKGSALRAEGNHILRTLCAHCGTSIPTEVGHAHPL
Ga0066709_10201054113300009137Grasslands SoilMATRGSAFRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEALRRETWGLVG
Ga0075423_1312462913300009162Populus RhizosphereMPTKGSAIRAEGNSLLRTVCAHCGTSIPTEVGHAHPLDEAYRRETWGLVGHGDGPPSVFP
Ga0127453_101816713300010102Grasslands SoilMAIRGSALRAEGNRSLRTLCVHCGTSIPTEVGHAHPLDEAIRRETWGLVGHTAGPPSVFPTC
Ga0134088_1017697333300010304Grasslands SoilMATKGSALRAEGNVGLRTLCVHCGTSIPTEVGHAHPLDQAIRRETWGLVGHT
Ga0134109_1002180213300010320Grasslands SoilMPTKGSACRAEGNQTLRTVCASCGRSIPTEVGHAHPLDADIRRETWGL
Ga0134067_1009519613300010321Grasslands SoilMATKGSAFRAEGNRALRTLCARCGTSIPAEVGHAHPLDEALRRETWGLVGHTDGPPSVFPTC
Ga0134111_1040228513300010329Grasslands SoilMAIRGSALRAEGNRALRTLCVHCGTSIPTEVGHAHPLDEAIRRETWGLVGHTDGPPSV
Ga0134071_1024724823300010336Grasslands SoilMATRGSAFRAEGNRALRTLCAHSGTSIPTEVGHAHPLDEALRRETWGLVGHTDGPPSVF
Ga0134071_1047119623300010336Grasslands SoilMATKGSAFRAEGNRALRTLCARCGTSIPAEVGHAHPLDEALRRETWGLVGHTDGPP
Ga0134071_1070199723300010336Grasslands SoilMATRGSALRAEGNVGLRTLCVHCGTSIPTEVGHAHPLDQA
Ga0134127_1068354133300010399Terrestrial SoilMATKGSALRAESNPTLRTVCASCGKSIPTEAGHPHPLDEALRRETWGLVGYRDGRK
Ga0134122_1172316413300010400Terrestrial SoilMVTKGSTFRAERIPALRTFCAHCGKWIPAAVGHAHPLD
Ga0137383_1108401423300012199Vadose Zone SoilMPIKGSACRAEGNQTLRTVCANCGKSIPTEIGHAHPLDEDVRRETWGLVGY
Ga0137382_1059607513300012200Vadose Zone SoilMATKGSAVRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEALRRETWGL
Ga0137360_1039028213300012361Vadose Zone SoilMPSRGSAYRAEGNPTLRTVCAHCGKSIPTEVGHAHPLDVDLRRETWGLVGYHAALKTVFP
Ga0137361_1177332213300012362Vadose Zone SoilMPTKGSACRAEGNQTLRTVCASCGRSIPTEVGHAHPLDEEIRRETWGLVGYHA
Ga0134022_104375913300012371Grasslands SoilMAVRGSALRAEGNRSLRTLCVHCGMSIPTEVGHAHPLDEAIRRETWG
Ga0134036_120110213300012384Grasslands SoilMAIRGSALRAEGNRSLRTLCVHCGTSIPTEVGHAHPLDEAIRRETWGLVGHTDGPPSVF
Ga0134030_113130223300012387Grasslands SoilMPTRGSACRAEGNQTLRTVCANCGKSIPTEVGHAHPLDVDLRRETWGLVGYHAAL
Ga0137358_1023691413300012582Vadose Zone SoilMATRGSALRAEGNVGLRTLCVHCGTSIPTEVGHAHPLDQAIRRETW
Ga0137358_1091542413300012582Vadose Zone SoilMATRGSAFRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEALRRETWGLVGHTDGPPSVFP
Ga0137394_1086162833300012922Vadose Zone SoilMATRGSAVRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEARRRE
Ga0137404_1022633313300012929Vadose Zone SoilMPTKGSACRAEGNQTLRTVCASCGRSIPTEVGHAHPLDEEIRRETWGLVGYHAKQKAVFPTC
Ga0137407_1244082413300012930Vadose Zone SoilMATRGSAFRAEGNRALRTLCAHCGTSIPTEVGHAHPLDEAL
Ga0134087_1011464133300012977Grasslands SoilMATKGSAFPAEGNRALRTLCARCGTSIPAEVGHAHPLDEALRRETWGLVGHTDG
Ga0157378_1115367413300013297Miscanthus RhizosphereVSIKGSAQRAEGNATLRTQCANCGKSIPTESGHAHPLDEAIERETWGL
Ga0157375_1318028013300013308Miscanthus RhizosphereMAIKGSTFRAEGNALLRTVCAHCGTSIPTEVGHAHPLDEALRRETWGLV
Ga0134078_1033595413300014157Grasslands SoilMATKGSAFRAEGNRALRTLCARCGTSIPAEVGHAHPLDEALRRETWG
Ga0075343_116904413300014317Natural And Restored WetlandsMATKGSAFRAEGNATLRTTCAECGKSIPTEVGHAHPLDEAVRRETWGLVGLVAGHQT
Ga0180076_100090983300014867SoilMAAKGSALRAEGNPTLRTICVNCDRSIPTEAGHPHPLDETLRRETWGLVGLHA
Ga0134072_1002388043300015357Grasslands SoilMAIRGSALRAEGNRSLRTLCVHCGTSIPTEVGHAHPLD
Ga0134089_1008987023300015358Grasslands SoilMPTKGSSCRAEGNQTLRTVCANCGRSIPTEVGHAHPLDEDIRRETWGLVGYH
Ga0134069_107247543300017654Grasslands SoilMAIRGSALRAEGNRSLRTLCVHCGTSIPTEVGRAHPLDEAIRRETWGLVGHT
Ga0066662_1238659723300018468Grasslands SoilMATRGSALRAEGNGSLRTLCVHCGTSIPTEVGHAHPLDQAIRRETWGLVGHTHGAPSVFP
Ga0180117_115187013300019248Groundwater SedimentVATKGSAHRAEVNQTLRTICAHCGKSIPTEVGHAHPLDEAIRRETWGLVGHQAAQK
Ga0207684_1117852613300025910Corn, Switchgrass And Miscanthus RhizosphereMATKGSAVRAEGNRLLRTLCTHCGTSIPTEVGHAHP
Ga0207646_1136453523300025922Corn, Switchgrass And Miscanthus RhizosphereMAVKGSTVRAEGNVLLRTLCAHCGTSIPTEVGHAHPLDEAVRRETWGLVGHTDGPPIVF
Ga0207658_1191560613300025986Switchgrass RhizosphereMAARGSSLRAEGNLTLRTVCASCGKSIPTEVGHPHPLDESLRRETYALVGYL
Ga0207678_1182079213300026067Corn RhizosphereMAIKGSTFRAEGNALLRTLCAHCGTSIPTEVGHAHPLDE
Ga0207675_10027690043300026118Switchgrass RhizosphereMATKGSTLRAEGNSLLRTVCAHCGTSIPTEVGHAHPLDQSLRRETWGLVGHGDGPPSVFP
Ga0207683_1214831513300026121Miscanthus RhizosphereVAVKGSALRAEGNATLRTVCAKCGKSIPTEAGHPHPLDETLARETWGLVGYLAGEKTVFA
Ga0209159_103283813300026343SoilMPTKGSACRAEGNQTLRTVCARCGRSIPTEVGHAHPLDQDIRRETWGLVGY
Ga0209690_120524223300026524SoilMPTKGSACRAEGNQTLRTVCASCGRSIPTEVGHAHPLDADIRRETWGLVGYHVKQK
Ga0209690_124027913300026524SoilMPTKGSACRAEGNQTLRTVCASCGRSIPTEVGHAHPLDEQIRRETWGLVGYHAKQK
Ga0209378_114652913300026528SoilMAIRGSALRAEGNRSLRTLCVHCGTSIPTEVGHAHPLDEAIRRETWG
Ga0209378_116951313300026528SoilMATKGSAFRAEGNRALRTLCARCGTSIPAEVGHAHPLDEALRRETWGLV
Ga0209376_125461223300026540SoilMATKGSAFRAEGNRALRTLCAHCGTSIPTEVGHAHPL
Ga0209161_1041247123300026548SoilMPTKGSACRAEGNQTLRTVCARCGRSIPTEVGHAHPLDQDIRRETW
Ga0247822_1147784913300028592SoilMAIKGSTFRAEGNALLRTLCAHCGTSIPTEVGHAHPLDEALRRETWGLVGHGDGPPSVFP
Ga0222749_1032539513300029636SoilMATKGSAVRAEGNPLLRTLCAHCATSIPTEVGHAHPLDEALRRETWGLVGHTDGPPTVFP
Ga0310887_1113932523300031547SoilVATKGSAYRAEVNQTLRTVCAHCDKSIPTEVGHAHPLDEGIRRETWGLVGHQAAQKIVFPTCAD
Ga0307469_1161362113300031720Hardwood Forest SoilMATRGSAVRAEGNRGLRTLCARCGTSIPTEVGHAHPLDEALR
Ga0318550_1046684723300031797SoilMPTKGSAYRAEQNPTLRATCAHCGKSIPTEVGHAHPLDEDIRRETWGLVGHYAGRKTVF
Ga0316201_1018761523300032136Worm BurrowMAIKGSAIRAEGNESLRAVCASCGKSIPTEVGNAHPLDEKVKRETWGLLGRHAGQPKIFP
Ga0307471_10247422413300032180Hardwood Forest SoilSSCRAEGNQTLRTVCAKCGRSIPTEVGHAHPLDEDIRRETWGLVGYHARQ
Ga0307472_10243636213300032205Hardwood Forest SoilMAIKGSTLRAEGNALLRTVCAHCGTSIPTEVGHAHPLDEALR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.