NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F104077

Metagenome / Metatranscriptome Family F104077

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F104077
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 43 residues
Representative Sequence VVTTRLTEVKGNKLYFEVACHQGEKLLGSGTHKRAIVPADF
Number of Associated Samples 91
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.97 %
% of genes near scaffold ends (potentially truncated) 94.06 %
% of genes from short scaffolds (< 2000 bps) 88.12 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.65

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.020 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(21.782 % of family members)
Environment Ontology (ENVO) Unclassified
(34.653 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.436 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 43.48%    Coil/Unstructured: 56.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.65
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF00291PALP 27.72
PF01037AsnC_trans_reg 13.86
PF01370Epimerase 3.96
PF12697Abhydrolase_6 1.98
PF00561Abhydrolase_1 1.98
PF04261Dyp_perox 0.99
PF02720DUF222 0.99
PF00483NTP_transferase 0.99
PF03176MMPL 0.99
PF00107ADH_zinc_N 0.99
PF01035DNA_binding_1 0.99
PF00155Aminotran_1_2 0.99
PF05694SBP56 0.99
PF02515CoA_transf_3 0.99
PF02754CCG 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG0247Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcFEnergy production and conversion [C] 0.99
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 0.99
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.99
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.99
COG2048Heterodisulfide reductase, subunit BEnergy production and conversion [C] 0.99
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.99
COG2837Periplasmic deferrochelatase/peroxidase EfeBInorganic ion transport and metabolism [P] 0.99
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.02 %
UnclassifiedrootN/A1.98 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001405|JGI20186J14852_1001207All Organisms → cellular organisms → Bacteria → Terrabacteria group1934Open in IMG/M
3300001412|JGI20173J14856_1047496All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300001537|A2065W1_10051882All Organisms → cellular organisms → Bacteria → Terrabacteria group979Open in IMG/M
3300001661|JGI12053J15887_10254002All Organisms → cellular organisms → Bacteria → Terrabacteria group873Open in IMG/M
3300005176|Ga0066679_10461210All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300005176|Ga0066679_10767675All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005177|Ga0066690_10504041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium814Open in IMG/M
3300005187|Ga0066675_11271028All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300005434|Ga0070709_11468057All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005447|Ga0066689_10881062All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300005471|Ga0070698_100391019All Organisms → cellular organisms → Bacteria1323Open in IMG/M
3300005518|Ga0070699_101515623All Organisms → cellular organisms → Bacteria → Terrabacteria group615Open in IMG/M
3300005536|Ga0070697_101408279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium622Open in IMG/M
3300005542|Ga0070732_10858006All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300005545|Ga0070695_100045844All Organisms → cellular organisms → Bacteria2788Open in IMG/M
3300005549|Ga0070704_100008883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6049Open in IMG/M
3300005549|Ga0070704_100443689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1116Open in IMG/M
3300005555|Ga0066692_10786696All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005557|Ga0066704_10276842All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300005558|Ga0066698_10059275All Organisms → cellular organisms → Bacteria2440Open in IMG/M
3300005559|Ga0066700_11124973All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005569|Ga0066705_10260380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1100Open in IMG/M
3300005574|Ga0066694_10238881All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300006028|Ga0070717_11722592All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300006034|Ga0066656_10056302All Organisms → cellular organisms → Bacteria → Terrabacteria group2283Open in IMG/M
3300006755|Ga0079222_12663940All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300006791|Ga0066653_10588773All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300006794|Ga0066658_10855245All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300006797|Ga0066659_10303995All Organisms → cellular organisms → Bacteria1218Open in IMG/M
3300006800|Ga0066660_10131418All Organisms → cellular organisms → Bacteria1826Open in IMG/M
3300006854|Ga0075425_100901756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1011Open in IMG/M
3300006893|Ga0073928_11013090All Organisms → cellular organisms → Bacteria → Terrabacteria group565Open in IMG/M
3300006914|Ga0075436_101087909All Organisms → cellular organisms → Bacteria → Terrabacteria group601Open in IMG/M
3300007076|Ga0075435_101269947All Organisms → cellular organisms → Bacteria → Terrabacteria group645Open in IMG/M
3300007258|Ga0099793_10171842All Organisms → cellular organisms → Bacteria → Terrabacteria group1033Open in IMG/M
3300007265|Ga0099794_10581160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium593Open in IMG/M
3300009088|Ga0099830_10703011All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300009090|Ga0099827_10267379All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300009090|Ga0099827_11979028All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300009093|Ga0105240_11777814All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300009137|Ga0066709_100324603All Organisms → cellular organisms → Bacteria2103Open in IMG/M
3300009147|Ga0114129_10143988All Organisms → cellular organisms → Bacteria3265Open in IMG/M
3300010303|Ga0134082_10006813All Organisms → cellular organisms → Bacteria4080Open in IMG/M
3300010303|Ga0134082_10024882All Organisms → cellular organisms → Bacteria2227Open in IMG/M
3300010304|Ga0134088_10106846All Organisms → cellular organisms → Bacteria → Terrabacteria group1319Open in IMG/M
3300010329|Ga0134111_10065920All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300010335|Ga0134063_10223033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium892Open in IMG/M
3300010358|Ga0126370_10181763All Organisms → cellular organisms → Bacteria1569Open in IMG/M
3300010358|Ga0126370_10469347All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300010375|Ga0105239_11918235All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300011271|Ga0137393_11270232All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300012019|Ga0120139_1177419All Organisms → cellular organisms → Bacteria → Terrabacteria group562Open in IMG/M
3300012203|Ga0137399_10222549All Organisms → cellular organisms → Bacteria1539Open in IMG/M
3300012207|Ga0137381_11180915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium658Open in IMG/M
3300012210|Ga0137378_10243829All Organisms → cellular organisms → Bacteria → Terrabacteria group1673Open in IMG/M
3300012210|Ga0137378_11268784Not Available653Open in IMG/M
3300012211|Ga0137377_10772926All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300012362|Ga0137361_11692573All Organisms → cellular organisms → Bacteria → Terrabacteria group552Open in IMG/M
3300012363|Ga0137390_10032307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4998Open in IMG/M
3300012363|Ga0137390_10259961All Organisms → cellular organisms → Bacteria1721Open in IMG/M
3300012363|Ga0137390_10761739All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300012397|Ga0134056_1293704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium521Open in IMG/M
3300012398|Ga0134051_1028051Not Available551Open in IMG/M
3300012401|Ga0134055_1117918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium781Open in IMG/M
3300012917|Ga0137395_10014265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4448Open in IMG/M
3300012918|Ga0137396_11307547All Organisms → cellular organisms → Bacteria → Terrabacteria group503Open in IMG/M
3300012924|Ga0137413_10192165All Organisms → cellular organisms → Bacteria → Terrabacteria group1366Open in IMG/M
3300012927|Ga0137416_11448304All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300012971|Ga0126369_12254242All Organisms → cellular organisms → Bacteria → Terrabacteria group631Open in IMG/M
3300013501|Ga0120154_1048857All Organisms → cellular organisms → Bacteria → Terrabacteria group1013Open in IMG/M
3300013766|Ga0120181_1054803All Organisms → cellular organisms → Bacteria → Terrabacteria group894Open in IMG/M
3300018468|Ga0066662_12044532All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300018482|Ga0066669_10140211All Organisms → cellular organisms → Bacteria1760Open in IMG/M
3300019883|Ga0193725_1116496All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300019886|Ga0193727_1043482All Organisms → cellular organisms → Bacteria1479Open in IMG/M
3300020581|Ga0210399_10552852All Organisms → cellular organisms → Bacteria → Terrabacteria group954Open in IMG/M
3300021088|Ga0210404_10314747All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300021170|Ga0210400_11441356All Organisms → cellular organisms → Bacteria → Terrabacteria group548Open in IMG/M
3300021432|Ga0210384_11112568All Organisms → cellular organisms → Bacteria → Terrabacteria group693Open in IMG/M
3300021479|Ga0210410_10549968All Organisms → cellular organisms → Bacteria → Terrabacteria group1028Open in IMG/M
3300021559|Ga0210409_11498152All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300025915|Ga0207693_11228646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300025916|Ga0207663_10844568All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300025922|Ga0207646_10349002All Organisms → cellular organisms → Bacteria1337Open in IMG/M
3300026223|Ga0209840_1013504All Organisms → cellular organisms → Bacteria1865Open in IMG/M
3300026301|Ga0209238_1266280All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300026317|Ga0209154_1003496All Organisms → cellular organisms → Bacteria8516Open in IMG/M
3300026320|Ga0209131_1368441All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300026335|Ga0209804_1254609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium648Open in IMG/M
3300026529|Ga0209806_1067899All Organisms → cellular organisms → Bacteria1614Open in IMG/M
3300026536|Ga0209058_1113643All Organisms → cellular organisms → Bacteria1346Open in IMG/M
3300026537|Ga0209157_1228376All Organisms → cellular organisms → Bacteria → Terrabacteria group760Open in IMG/M
3300027748|Ga0209689_1268405All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300027968|Ga0209061_1012163All Organisms → cellular organisms → Bacteria5417Open in IMG/M
3300028784|Ga0307282_10236557All Organisms → cellular organisms → Bacteria → Terrabacteria group876Open in IMG/M
3300031962|Ga0307479_10294803All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300031962|Ga0307479_11892746All Organisms → cellular organisms → Bacteria → Terrabacteria group547Open in IMG/M
3300032089|Ga0318525_10619957All Organisms → cellular organisms → Bacteria → Terrabacteria group551Open in IMG/M
3300032205|Ga0307472_100469952All Organisms → cellular organisms → Bacteria → Terrabacteria group1075Open in IMG/M
3300032205|Ga0307472_101436873All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300032261|Ga0306920_102934815All Organisms → cellular organisms → Bacteria646Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil21.78%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil18.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.95%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.97%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.98%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.98%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.99%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001405Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012EnvironmentalOpen in IMG/M
3300001412Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012397Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012398Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012401Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026223Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027968Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20186J14852_100120713300001405Arctic Peat SoilEVKGNHLYFDVECRQGDKLIGSGIHKRAIVPAAF*
JGI20173J14856_104749613300001412Arctic Peat SoilTVVITTRLTEVKGNKLYFDVECRQAETLIGSGRHKRAIVPANF*
A2065W1_1005188213300001537PermafrostTEVKGNKLYFEVECRQGDKVLGSGTHKRAIVPASF*
JGI12053J15887_1025400213300001661Forest SoilGSTIVVTTRLNEVKGNKLYFEVECRQGDTVLGTGVHKRAIVPANY*
Ga0066679_1046121013300005176SoilLAPTAPGRTVVVTSRVAEVRGNKLQFDVECRDGDMILGSGIHKRAVVPATF*
Ga0066679_1076767523300005176SoilVVVTSRVAEVKGNKLQFEVECREGDTVLGTGIHKRAVVPATF*
Ga0066690_1050404143300005177SoilTSRLQEVRDNKLVFEVECRLGDRVIGSGIHKRAIVPANF*
Ga0066675_1127102813300005187SoilGRTIVVTTRLIEVKGNKLHFEVECREGEKLLGSGIHKRAIVPATF*
Ga0070709_1146805713300005434Corn, Switchgrass And Miscanthus RhizosphereGHTIVVTSRVAEVRGNKLVFEVECREGEQLLGSGTHKRAIVPALS*
Ga0066689_1088106213300005447SoilAPAPPGSTVVVTARLTEVKDNKLYFDVQCELDGKVIGTGTHKRAIVPANF*
Ga0070698_10039101923300005471Corn, Switchgrass And Miscanthus RhizospherePTAPGTTIVVTTKLTEVKGNKLYFEVACHQGETLLGSGTHKRAIVPADF*
Ga0070699_10151562323300005518Corn, Switchgrass And Miscanthus RhizosphereGSTIVVTTRLTEVKGNKLHFEVECREGDKLLGSGIHKRAIVPATF*
Ga0070697_10140827933300005536Corn, Switchgrass And Miscanthus RhizosphereGRTIVVTSRLTEVKGNKLYFEVECREGDKLLGSGIHKRAIVAATF*
Ga0070732_1085800623300005542Surface SoilGTTIVVTSHLTEVNGNKLMFEVECHEGDRLLGSGMHKRAVVPANF*
Ga0070695_10004584413300005545Corn, Switchgrass And Miscanthus RhizosphereTSRLTEVKGNKLYFEVECREGDKLLGSGIHKRAIVAATF*
Ga0070704_10000888313300005549Corn, Switchgrass And Miscanthus RhizosphereTIVVTSRLTEVKGNKLYFDVECHEGDRLLGSGTHKRAIVPAEF*
Ga0070704_10044368933300005549Corn, Switchgrass And Miscanthus RhizosphereVVTTRLTEVKGNKLYFEVACHQGEKLLGSGTHKRAIVPADF*
Ga0066692_1078669613300005555SoilTVVVTARLTEVKDNKLYFDVQCELDGKVIGTGTHKRAIVPANF*
Ga0066704_1027684213300005557SoilTEVKGNKLLFEVDCYEGETLLGSGIHKRAVVPATF*
Ga0066698_1005927563300005558SoilPTAPGHTIVVTSRVTEVKGNKLHFEVECREGDKLLGSGIHKRAIVPATF*
Ga0066700_1112497313300005559SoilPGSTIVVTTRVTEVKGNKLLFEVDCYEGETLLGSGIHKRAVVPATF*
Ga0066705_1026038013300005569SoilSRLQEVRDNKLVFEVECRLGDQVIGSGTHKRAIVPANF*
Ga0066694_1023888113300005574SoilVTTRLTEVKGNKLHFEVECHDGDTLLGSGMHKRAIVAATF*
Ga0070717_1172259213300006028Corn, Switchgrass And Miscanthus RhizospherePTAPGTTIVVTTRLTEVKGNKLYFEVACHQGEKLLGSGTHKRAIVPADF*
Ga0066656_1005630213300006034SoilVTTRVAEVKGNKLKFQVECHEGDTLLGDGIHKRAVVPAMF*
Ga0079222_1266394023300006755Agricultural SoilGRTIVVTTKLADVKGNKLYFDVACHEAETLLGSGTHKRAIVPATF*
Ga0066653_1058877323300006791SoilTVVVSSTLTEVKGNKLYFDVECHQGDKLLGSGTHKRAIVPADF*
Ga0066658_1085524513300006794SoilRLADVKGNKLYFDVECREGDTLLGSGTHKRAVVPATF*
Ga0066659_1030399513300006797SoilTRLTEVKGNKLHFEVECREGEKLLGSGIHKRAIVPATF*
Ga0066660_1013141843300006800SoilRTVVVTTRVAEVKGNKLKFEVECHEGDPLLGDGIHKRAVVPAMF*
Ga0075425_10090175613300006854Populus RhizosphereTLKEVNGNKLYFDVLCEMDGKVIGSGTHKRAIVPANF*
Ga0073928_1101309023300006893Iron-Sulfur Acid SpringTEVKGNKLYFDVECRQGEKLIGSGIHKRAIVPASF*
Ga0075436_10108790913300006914Populus RhizosphereTAPGHTIVVTSHLNEVKGNKLYFEVECREGDTLLGTGVHKRAVVPANF*
Ga0075435_10126994713300007076Populus RhizospherePTAPGSTIVVTTRLTEVKGNKLHFEVECREGDKLLGSGIHKRAIVPATF*
Ga0099793_1017184223300007258Vadose Zone SoilIVVTTRLNEVKGNKLYFEVECRQGDKVIGSGMHKRAIVPANY*
Ga0099794_1058116033300007265Vadose Zone SoilPAPPGSTVVVTATLTEVKDNKLYFDVSCELDGKVIGTGTHKRAIVPANF*
Ga0099830_1070301133300009088Vadose Zone SoilPGTTIVVTTRLTEVNGNKLYFEVACHEGEKLLGSGTHKRAIVPADF*
Ga0099827_1026737943300009090Vadose Zone SoilVTARLTEVKGNKLYFDVACHQGDVLLGSGTHKRAIVPASF*
Ga0099827_1197902823300009090Vadose Zone SoilVVVTARLTEVKGNKLYFDVACHQGEVLLGSGTHKRAIVPAEF*
Ga0105240_1177781413300009093Corn RhizosphereVSSRLVEVNGNKLVFEVECHLGDMLIGTGTHKRAVVPANF*
Ga0066709_10032460313300009137Grasslands SoilTSSLKEVNGNKLLFDVACELDGKVIGTGTHKRAVVPANF*
Ga0114129_1014398813300009147Populus RhizosphereEVTGNKLRFEVECHEGDKLLGSGYHKRAVVPASF*
Ga0134082_1000681363300010303Grasslands SoilVTTRGAEVKGNKLKFQVECHEGDTLLGDGIHKRAVVPAMF*
Ga0134082_1002488213300010303Grasslands SoilRVAEVKGNKLQFEVECREGDTVLGTGIHKRAVVPATF*
Ga0134088_1010684633300010304Grasslands SoilTAPGHTIVVTSHLSEVKGNKLYFEVECREGDTLLGTGVHKRAVVPANF*
Ga0134111_1006592033300010329Grasslands SoilVTARLTEVKDNKLYFDVQCELDGKVIGTGTHKRAIVPANF*
Ga0134063_1022303313300010335Grasslands SoilHATGRSEVHVRPLGRTAPGRAIVVSSRLPEVKGNKLYFEVECREGDTLLGSGIHKRAIVPATF*
Ga0126370_1018176313300010358Tropical Forest SoilTSRVTEVKGNKLYFDVECREGETLLGTGIHKRAVVPATF*
Ga0126370_1046934743300010358Tropical Forest SoilTLKDVNGNKLYFDVQCELDGKVIGSGTHKRAIVPANF*
Ga0105239_1191823533300010375Corn RhizospherePGSKVVVVSRLAEVKGNKLYFDVSCHEGQRLLGTGTHKRAIVAANF*
Ga0137393_1127023233300011271Vadose Zone SoilVVSTMLTEVKSNKLYFDVACHEGGVLLGSGKHKRAIVRADF*
Ga0120139_117741913300012019PermafrostTGKLTEVKGNKLYFDVECHQGDKLLGTGTHKRAIVPADF*
Ga0137399_1022254943300012203Vadose Zone SoilVTTRLTEVKGNKLYFDVACHQGETLLGSGTHKRAIVPADF*
Ga0137381_1118091513300012207Vadose Zone SoilTIVVSTRLTEVKGNKLYFEVECREGDTLLGSGIHKRAVVPATF*
Ga0137378_1024382913300012210Vadose Zone SoilSTIVVTTRLNEVKGNKLYFEVECRQGDKVIGSGMHKRAIVPAKY*
Ga0137378_1126878423300012210Vadose Zone SoilVVTSLLKEVNGNKLLFDVQCRDGDRLVGTGTHKRAVVPARR*
Ga0137377_1077292613300012211Vadose Zone SoilVVTSKLTEVKGNKLYFDVACHQGDKLLGAGTHKRAIVPKEF*
Ga0137361_1169257323300012362Vadose Zone SoilEVKGNKLQFEVACHEGDKLLGSGIHKRAIVPATF*
Ga0137390_1003230713300012363Vadose Zone SoilLTEVKDNKLYFDVSCELDGKVIGTGTHKRAIVPANF*
Ga0137390_1025996113300012363Vadose Zone SoilLTEVKGNKLYFDVACHQGEKLLGSGTHKRAIVPADF*
Ga0137390_1076173913300012363Vadose Zone SoilMAPAPPGSTVVVTSTLTQVKGNKLYFDVECRQGETLVGSGIHKRAIVPATF*
Ga0134056_129370433300012397Grasslands SoilPTAPGRTIVVSSRLTEVKGNKLYFEVECREGDTLLGSGIHKRAIVPATF*
Ga0134051_102805123300012398Grasslands SoilVDGRKVAFEVACHEGEKVVGSGIHKRAIVPATAD*
Ga0134055_111791813300012401Grasslands SoilLAPTAPGRTIVVSSRLTEVKGNKLYFEVECREGDTLLGSGIHKRAIVPATF*
Ga0137395_1001426513300012917Vadose Zone SoilLAPAPPGSTVVVTATVTDVKDNKLYFDVSCELDGKVIGTGTHKRAIVPANF*
Ga0137396_1130754713300012918Vadose Zone SoilTEVKGNKLYFEVECHEGEKLLGSGTHKRAIVPATF*
Ga0137413_1019216533300012924Vadose Zone SoilTTRLNEVKGNKLYFEVECRQGDKVIGSGMHKRAIVPANY*
Ga0137416_1144830413300012927Vadose Zone SoilITVTTKLTEVKGNKLYFDVACHLGDVLVGSGTHKRAIVPADF*
Ga0126369_1225424223300012971Tropical Forest SoilVVTSRLTEVKGNKLLFEVECFEGDKLLGSGIHKRAVVPASF*
Ga0120154_104885723300013501PermafrostPGSTVVVTTHLTEVKGNKLYFEVECRQGDKVLGSGTHKRAILPASF*
Ga0120181_105480313300013766PermafrostTRLTEVKGNKLYFEVECRQGDKVLGTGLHKRAIVPANY*
Ga0066662_1204453233300018468Grasslands SoilRNVAPTAPGSTIVVTTRLTEVKGTKLYFDVQFHEGDKLLGAGIHKRAIVPANF
Ga0066669_1014021113300018482Grasslands SoilTRLIEVKGNKLHFEVECREGEKLLGSGIHKRAIVPATF
Ga0193725_111649613300019883SoilVVVTARLNEVKGNKLYFDVSCHQGDKLLGSGTHKRAIVPADF
Ga0193727_104348243300019886SoilLNEVKGNKLYFDVSCHQGEKLLGSGTHKRAIVPADF
Ga0210399_1055285213300020581SoilTSRLTEVKGNKLYFNVECRDGDKLLGSGTHKRAIVPADF
Ga0210404_1031474723300021088SoilKTIVVTSRLTEVKGNKLYFDVECHEGETLLGSGTHKRAVVPANF
Ga0210400_1144135623300021170SoilIVVATRLTEVNGNKLYFEVECHQGDKLLGSGIHKRAIVPAIF
Ga0210384_1111256813300021432SoilRLTEVNGNKLYFEVECRDGERLLGSGIHKRAVVPATF
Ga0210410_1054996813300021479SoilTILVTTKVTEVKGNKLYFDVECRQGEKLIGSGIHKRAIVPAEF
Ga0210409_1149815223300021559SoilTRLTEVKGNKLYFDVFCHEGETLLGSGIHKRAIVEATF
Ga0207693_1122864623300025915Corn, Switchgrass And Miscanthus RhizosphereVVVTTKLTEVKGNKLYFDVECRQGDKLIGSGLHKRAIVPADF
Ga0207663_1084456823300025916Corn, Switchgrass And Miscanthus RhizosphereVTTKLTEVKGNKLYFDVECHDGETLLDSGIHKRAIVPATF
Ga0207646_1034900213300025922Corn, Switchgrass And Miscanthus RhizosphereAPAPPGSTVVVTAMLTEVKDNKLYFDVSCELDGKVIGTGTHKRAIVAANF
Ga0209840_101350413300026223SoilSTVIITTRLTEVKGNKLYFDVECRQGEKLIGSGLHKRAIVPTDF
Ga0209238_126628013300026301Grasslands SoilVVVTTRVAEVKGNKLKFEVECHEGDTLLGDGIHKRAVVPAVF
Ga0209154_100349613300026317SoilRLTEVKGTKLYFDVQCHEGDKLLGAGIHKRAIVPANF
Ga0209131_136844123300026320Grasslands SoilKLTEVKGNKLYFDVACHQGDKLLGSGTHKRAIVPADF
Ga0209804_125460933300026335SoilARLTDVKDNKLYFDVQCELAGKVIGTGTHKRAIVPANF
Ga0209806_106789913300026529SoilRHVAPTAPGSTIVVTTKLTEVKGNKLYFDVACHQGDVRVGSGIHKRAIVPADF
Ga0209058_111364333300026536SoilTSTLKEVNGNKLLFDVACELEGKVIGTGTHKRAIVPANF
Ga0209157_122837613300026537SoilGRTITVTTRLTEVKGNKLHFEVECHEGDTLLGSGMHKRAIVPATF
Ga0209689_126840533300027748SoilVTARLTEVKDNKLYFDVQCELDGKVIGTGTHKRAIVPANF
Ga0209061_101216373300027968Surface SoilSSRLTEVNGNRLTFEVQCRRGEVLIGTGTHRRAIVPSL
Ga0307282_1023655713300028784SoilLNEVKGNKLYFEVECRQGDKLIGSGIHKRAIVSANY
Ga0307479_1029480313300031962Hardwood Forest SoilLTEVKGNKLHFEVECREGDTLLGSGIHKRAIVPANF
Ga0307479_1189274613300031962Hardwood Forest SoilSTIVVTSRLTEVNGNKLLFEVSCSLGDKLVGTGTHKRAIVPANF
Ga0318525_1061995723300032089SoilSAPGSTIVVTSRLTEVKGNKLYFEVECRDGDTLLGAGTHKRAIVPAEF
Ga0307472_10046995223300032205Hardwood Forest SoilHMAPTAPGSMVTVTTHLSEVRGNKLHFEVECRQGEQLLGSGIHKRAIVPADF
Ga0307472_10143687313300032205Hardwood Forest SoilVVTSRLTEVKGNKLYFDVECHEGQTLLGSGTHKRAVVPANF
Ga0306920_10293481523300032261SoilLAPAKAGDTVVVTARLAEVKGNRLQFDVACSSLDGDTLIGTGTHKRAVIPALG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.