| Basic Information | |
|---|---|
| Family ID | F103255 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MKLTADILQELSMYINLNYEDDWYLQEKVNELKTRIYEQ |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.98 % |
| % of genes near scaffold ends (potentially truncated) | 24.75 % |
| % of genes from short scaffolds (< 2000 bps) | 78.22 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (45.545 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (14.852 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.436 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.178 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 82.05% β-sheet: 0.00% Coil/Unstructured: 17.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF13662 | Toprim_4 | 1.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.46 % |
| Unclassified | root | N/A | 45.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2100351011|ASMM170b_contig04184__length_704___numreads_9 | Not Available | 704 | Open in IMG/M |
| 2140918005|contig01282 | Not Available | 744 | Open in IMG/M |
| 2140918005|contig02947 | Not Available | 539 | Open in IMG/M |
| 2189573025|GS310G0146KB_1113984222764 | Not Available | 857 | Open in IMG/M |
| 2189573025|GS310G0146KB_1113984224606 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 906 | Open in IMG/M |
| 2236876009|none_p147937 | Not Available | 527 | Open in IMG/M |
| 2236876010|none_p0295368 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 556 | Open in IMG/M |
| 2236876010|none_p0328582 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 585 | Open in IMG/M |
| 2236876010|none_p0579617 | Not Available | 553 | Open in IMG/M |
| 3300000118|TDF_OR_ARG05_123mDRAFT_c1009568 | Not Available | 818 | Open in IMG/M |
| 3300000128|SA_S1_NOR08_45mDRAFT_c10039521 | All Organisms → Viruses → Predicted Viral | 1843 | Open in IMG/M |
| 3300000133|SA_S1_NOR02_45mDRAFT_c1005853 | All Organisms → Viruses → Predicted Viral | 1583 | Open in IMG/M |
| 3300000243|SA_S2_NOR18_50mDRAFT_1035221 | Not Available | 801 | Open in IMG/M |
| 3300000928|OpTDRAFT_10015242 | All Organisms → Viruses → Predicted Viral | 1187 | Open in IMG/M |
| 3300001278|BBAY75_10055107 | All Organisms → Viruses → Predicted Viral | 1771 | Open in IMG/M |
| 3300001348|JGI20154J14316_10049823 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1794 | Open in IMG/M |
| 3300001349|JGI20160J14292_10044708 | All Organisms → Viruses → Predicted Viral | 2067 | Open in IMG/M |
| 3300001352|JGI20157J14317_10072313 | All Organisms → Viruses → Predicted Viral | 1405 | Open in IMG/M |
| 3300001352|JGI20157J14317_10078233 | Not Available | 1306 | Open in IMG/M |
| 3300001450|JGI24006J15134_10107569 | Not Available | 988 | Open in IMG/M |
| 3300001472|JGI24004J15324_10059219 | Not Available | 1107 | Open in IMG/M |
| 3300003580|JGI26260J51721_1011217 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2304 | Open in IMG/M |
| 3300004279|Ga0066605_10240904 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 680 | Open in IMG/M |
| 3300004461|Ga0066223_1146578 | Not Available | 694 | Open in IMG/M |
| 3300005239|Ga0073579_1551991 | Not Available | 824 | Open in IMG/M |
| 3300005824|Ga0074474_1503857 | All Organisms → Viruses → Predicted Viral | 2466 | Open in IMG/M |
| 3300005825|Ga0074476_1619743 | Not Available | 569 | Open in IMG/M |
| 3300005828|Ga0074475_10468347 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1170 | Open in IMG/M |
| 3300005837|Ga0078893_14522115 | All Organisms → Viruses → Predicted Viral | 2054 | Open in IMG/M |
| 3300006484|Ga0070744_10007173 | All Organisms → Viruses → Predicted Viral | 3341 | Open in IMG/M |
| 3300006484|Ga0070744_10040704 | Not Available | 1368 | Open in IMG/M |
| 3300006750|Ga0098058_1095949 | Not Available | 804 | Open in IMG/M |
| 3300006752|Ga0098048_1061356 | All Organisms → Viruses → Predicted Viral | 1168 | Open in IMG/M |
| 3300006789|Ga0098054_1065360 | Not Available | 1380 | Open in IMG/M |
| 3300006789|Ga0098054_1153342 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 850 | Open in IMG/M |
| 3300006793|Ga0098055_1304197 | Not Available | 595 | Open in IMG/M |
| 3300006920|Ga0070748_1015788 | All Organisms → cellular organisms → Bacteria | 3208 | Open in IMG/M |
| 3300006920|Ga0070748_1049872 | Not Available | 1666 | Open in IMG/M |
| 3300007229|Ga0075468_10012356 | All Organisms → Viruses → Predicted Viral | 3307 | Open in IMG/M |
| 3300007540|Ga0099847_1094915 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 911 | Open in IMG/M |
| 3300007543|Ga0102853_1009069 | All Organisms → Viruses → Predicted Viral | 1552 | Open in IMG/M |
| 3300008050|Ga0098052_1403825 | Not Available | 507 | Open in IMG/M |
| 3300008221|Ga0114916_1029471 | All Organisms → Viruses → Predicted Viral | 1725 | Open in IMG/M |
| 3300008470|Ga0115371_10292463 | All Organisms → Viruses → Predicted Viral | 1940 | Open in IMG/M |
| 3300008470|Ga0115371_10704702 | Not Available | 1326 | Open in IMG/M |
| 3300008470|Ga0115371_10717026 | Not Available | 556 | Open in IMG/M |
| 3300008919|Ga0103484_1010514 | Not Available | 598 | Open in IMG/M |
| 3300009074|Ga0115549_1016135 | All Organisms → cellular organisms → Bacteria | 3084 | Open in IMG/M |
| 3300009076|Ga0115550_1023765 | All Organisms → Viruses → Predicted Viral | 2856 | Open in IMG/M |
| 3300009076|Ga0115550_1306676 | Not Available | 509 | Open in IMG/M |
| 3300009420|Ga0114994_10166476 | All Organisms → Viruses → Predicted Viral | 1490 | Open in IMG/M |
| 3300009426|Ga0115547_1280565 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 519 | Open in IMG/M |
| 3300009428|Ga0114915_1062889 | All Organisms → Viruses → Predicted Viral | 1166 | Open in IMG/M |
| 3300009436|Ga0115008_10112441 | Not Available | 2011 | Open in IMG/M |
| 3300009436|Ga0115008_11045682 | Not Available | 612 | Open in IMG/M |
| 3300009467|Ga0115565_10194950 | Not Available | 935 | Open in IMG/M |
| 3300009495|Ga0115571_1020599 | All Organisms → Viruses → Predicted Viral | 3375 | Open in IMG/M |
| 3300009496|Ga0115570_10117238 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1279 | Open in IMG/M |
| 3300017744|Ga0181397_1182395 | Not Available | 529 | Open in IMG/M |
| 3300020165|Ga0206125_10030194 | All Organisms → Viruses → Predicted Viral | 2972 | Open in IMG/M |
| 3300020165|Ga0206125_10302955 | Not Available | 597 | Open in IMG/M |
| 3300020166|Ga0206128_1011608 | Not Available | 5584 | Open in IMG/M |
| 3300020166|Ga0206128_1024068 | All Organisms → Viruses → Predicted Viral | 3379 | Open in IMG/M |
| 3300020166|Ga0206128_1200533 | Not Available | 765 | Open in IMG/M |
| 3300020175|Ga0206124_10015451 | All Organisms → Viruses → Predicted Viral | 4019 | Open in IMG/M |
| 3300020187|Ga0206130_10156790 | Not Available | 1176 | Open in IMG/M |
| 3300021185|Ga0206682_10163166 | Not Available | 1040 | Open in IMG/M |
| 3300021371|Ga0213863_10046859 | All Organisms → Viruses → Predicted Viral | 2268 | Open in IMG/M |
| 3300021371|Ga0213863_10060952 | All Organisms → Viruses → Predicted Viral | 1914 | Open in IMG/M |
| 3300022178|Ga0196887_1046760 | All Organisms → Viruses → Predicted Viral | 1121 | Open in IMG/M |
| 3300022217|Ga0224514_10354055 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 541 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10249872 | Not Available | 609 | Open in IMG/M |
| (restricted) 3300023089|Ga0233408_10162956 | Not Available | 521 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10285970 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 726 | Open in IMG/M |
| 3300023567|Ga0228694_102433 | All Organisms → Viruses → Predicted Viral | 1909 | Open in IMG/M |
| 3300023699|Ga0228695_1006450 | All Organisms → Viruses → Predicted Viral | 1585 | Open in IMG/M |
| 3300023699|Ga0228695_1023029 | Not Available | 873 | Open in IMG/M |
| 3300024183|Ga0228603_1005801 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1522 | Open in IMG/M |
| 3300024223|Ga0228601_1005269 | Not Available | 1428 | Open in IMG/M |
| 3300024231|Ga0233399_1136773 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 532 | Open in IMG/M |
| 3300024236|Ga0228655_1063882 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 823 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10130495 | All Organisms → Viruses → Predicted Viral | 1252 | Open in IMG/M |
| 3300024319|Ga0228670_1123177 | Not Available | 501 | Open in IMG/M |
| 3300024329|Ga0228631_1011505 | All Organisms → cellular organisms → Bacteria | 3147 | Open in IMG/M |
| 3300024343|Ga0244777_10000453 | Not Available | 32132 | Open in IMG/M |
| 3300024343|Ga0244777_10551467 | Not Available | 703 | Open in IMG/M |
| 3300024346|Ga0244775_10143072 | All Organisms → Viruses → Predicted Viral | 2020 | Open in IMG/M |
| 3300024413|Ga0233393_1085690 | Not Available | 695 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10534990 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 563 | Open in IMG/M |
| 3300025103|Ga0208013_1022856 | All Organisms → Viruses → Predicted Viral | 1843 | Open in IMG/M |
| 3300025133|Ga0208299_1154635 | Not Available | 717 | Open in IMG/M |
| 3300025137|Ga0209336_10038742 | All Organisms → Viruses → Predicted Viral | 1549 | Open in IMG/M |
| 3300025138|Ga0209634_1002270 | Not Available | 13513 | Open in IMG/M |
| 3300025266|Ga0208032_1003037 | Not Available | 6421 | Open in IMG/M |
| 3300025276|Ga0208814_1114513 | Not Available | 656 | Open in IMG/M |
| 3300025276|Ga0208814_1134763 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 574 | Open in IMG/M |
| 3300025483|Ga0209557_1021725 | All Organisms → Viruses → Predicted Viral | 2044 | Open in IMG/M |
| 3300025483|Ga0209557_1103970 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 580 | Open in IMG/M |
| 3300025543|Ga0208303_1074348 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 766 | Open in IMG/M |
| 3300027845|Ga0209271_10153808 | Not Available | 943 | Open in IMG/M |
| 3300028129|Ga0228634_1092299 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 678 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 14.85% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 12.87% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 6.93% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 6.93% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.94% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 4.95% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.96% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine | 3.96% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 3.96% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.96% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.97% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.97% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.97% |
| Coastal Water And Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment | 2.97% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.97% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 2.97% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 1.98% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.98% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.99% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.99% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.99% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.99% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.99% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.99% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.99% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.99% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.99% |
| Bay Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2100351011 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from medium methane PC12-240-170cm | Environmental | Open in IMG/M |
| 2140918005 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from high methane PC12-225-485cm | Environmental | Open in IMG/M |
| 2189573025 | Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-FOS-0p8-Hyp-75m | Environmental | Open in IMG/M |
| 2236876009 | Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-0p8-Hyp-75m | Environmental | Open in IMG/M |
| 2236876010 | Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-0p1-Hyp-75m | Environmental | Open in IMG/M |
| 3300000118 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 06_12.3m | Environmental | Open in IMG/M |
| 3300000128 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45m | Environmental | Open in IMG/M |
| 3300000133 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 02_45m | Environmental | Open in IMG/M |
| 3300000243 | Svalbard Archipelago station 2 sample NOR 18_50m | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300001278 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY75 | Host-Associated | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005824 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBC | Environmental | Open in IMG/M |
| 3300005825 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB | Environmental | Open in IMG/M |
| 3300005828 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300008919 | Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NA1 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022217 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
| 3300023089 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023567 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 80R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023699 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 81R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024183 | Seawater microbial communities from Monterey Bay, California, United States - 3D | Environmental | Open in IMG/M |
| 3300024223 | Seawater microbial communities from Monterey Bay, California, United States - 1D | Environmental | Open in IMG/M |
| 3300024231 | Seawater microbial communities from Monterey Bay, California, United States - 43D | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024319 | Seawater microbial communities from Monterey Bay, California, United States - 85D | Environmental | Open in IMG/M |
| 3300024329 | Seawater microbial communities from Monterey Bay, California, United States - 39D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024413 | Seawater microbial communities from Monterey Bay, California, United States - 21D | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028129 | Seawater microbial communities from Monterey Bay, California, United States - 42D | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ASMM170b_01013690 | 2100351011 | Coastal Water And Sediment | MKLTADILQELSMYVQVNYEDDWYLQEKVNELKEKLYENDR |
| ASHM485C_01374780 | 2140918005 | Coastal Water And Sediment | MNQNPYNNMKLTADILQELSMYVQVNYEDDWYLQEKVNELKEKLYENDR |
| ASHM485C_06355130 | 2140918005 | Coastal Water And Sediment | MRLTADILQELSMYVQVNYEDDWYLQEKVNELKEKLYENDR |
| GS310G0146KB_00025330 | 2189573025 | Marine Estuarine | MKSTADILQELSMYANLNYEDDWYLKDKINELKTRIYEQTNN |
| GS310G0146KB_00027210 | 2189573025 | Marine Estuarine | MKLTADLLQELSMYINLNYEDDWYLQEKVNELKTRIYEQ |
| none_1479371 | 2236876009 | Marine Estuarine | TADLLQELSMYINLNYEDDWYLQEKVNELKTRIYEQ |
| none_02953682 | 2236876010 | Marine Estuarine | MKLTADLLQELSMYINLNYEDDWYLQEKVNELKTRIYEPIKETYTK |
| none_03285821 | 2236876010 | Marine Estuarine | MKLTADLLQELSMYINLNYEDDWYLQEKVNELKTR |
| none_05796173 | 2236876010 | Marine Estuarine | SMKLTADLLQELSMYINLNYEDDWYLQEKVNEFKN |
| TDF_OR_ARG05_123mDRAFT_10095682 | 3300000118 | Marine | MKFTADILQELAMYVQVNYEDDWYLQEKVNELKEKIYEND* |
| SA_S1_NOR08_45mDRAFT_100395214 | 3300000128 | Marine | MKNTADILQELSMYVQVNYEDDWYLMEKVNELKTKIYEKI* |
| SA_S1_NOR02_45mDRAFT_10058539 | 3300000133 | Marine | MRLTADILQELSMYVQVNYEDDWYLQEKVNELKEKLY |
| SA_S2_NOR18_50mDRAFT_10352213 | 3300000243 | Marine | MRLTADILQELSMYVQVNYEDDWYXQEKVNELKEKLYENDR* |
| OpTDRAFT_100152422 | 3300000928 | Freshwater And Marine | MKSTADILQELSMYANLNYEDDWYLKDKINELKTRIYESII* |
| BBAY75_100551072 | 3300001278 | Macroalgal Surface | MKLTADILQELSIYINLNYEDDWYLQEKVNELKTKIYEQ* |
| JGI20154J14316_100498239 | 3300001348 | Pelagic Marine | MKSTADILQELSMYANLNHEDDWYLKDKINELKTRIYEQTND* |
| JGI20160J14292_100447082 | 3300001349 | Pelagic Marine | MKNKADILQELSMYVQLNYKDDWYLQEKVNELKTKIYE* |
| JGI20157J14317_100723131 | 3300001352 | Pelagic Marine | MKSTADLLQELSMYANLNYEEDWYLKDKINELKTRIYEQT |
| JGI20157J14317_100782331 | 3300001352 | Pelagic Marine | LQELSMYANLNYEEDWYLKDKINELKTRIYEQTNS* |
| JGI24006J15134_101075694 | 3300001450 | Marine | MKLTADLLQELSMYINLNYEDDWYLQEKVNELKTRIYESK* |
| JGI24004J15324_100592194 | 3300001472 | Marine | MKLTADLLQELSMYINLNYEDDWYLQKKVNELKTRIYESK* |
| JGI26260J51721_10112175 | 3300003580 | Marine | MKLTADLLQELSMYINLNYGDDWYLQEKVNELKTRIYESR* |
| Ga0066605_102409043 | 3300004279 | Marine | MKLAADLLQELSMYINLNYEDDWYLQEKVNELKTRIYEQ* |
| Ga0066223_11465782 | 3300004461 | Marine | MRLTADILQELSMYVQVNYEDDWYLQEKVNELKEKLYENDR* |
| Ga0073579_15519913 | 3300005239 | Marine | MKLTADILQELSMYVQVNYEDDWYLQEKVNELKEKLYENDR* |
| Ga0074474_15038576 | 3300005824 | Sediment (Intertidal) | MKLTADILQELSMYIQVNYEDDWYLQEKVNELKEKLYEKDK* |
| Ga0074476_16197431 | 3300005825 | Sediment (Intertidal) | KLAADLLQELSMYINLNYEDDWYLQEKVNELKTRIYEQ* |
| Ga0074475_104683474 | 3300005828 | Sediment (Intertidal) | MKLTADLLQELSMYINLNYEDDWYLQEKVNELKTKIYEQ* |
| Ga0078893_145221159 | 3300005837 | Marine Surface Water | MKLTADILQELSIYINLNYEDDWYLQEKVNELKTRIYEQ* |
| Ga0070744_1000717312 | 3300006484 | Estuarine | MKITADILQELSMYVKLNYEDDWYLEKKVNELKDKLY |
| Ga0070744_100407044 | 3300006484 | Estuarine | MKLTADLLQELSMYINLNYEDDWYLQEKVNELKTRIYEQ* |
| Ga0098058_10959492 | 3300006750 | Marine | MKLTADILQELSMYINLNYEDDWYLQEKVNELKTRIYEQ* |
| Ga0098048_10613565 | 3300006752 | Marine | MKNKADILQELSMYVQLNYKDDWYLQEKVNELKTMIYESR* |
| Ga0098054_10653602 | 3300006789 | Marine | MKSTADILQELSMYANLNYEEDWYLKDKINELKTRIYEQTNS* |
| Ga0098054_11533422 | 3300006789 | Marine | MELMKLTADILQELSMYINLNYEDDWYLQEKVNELKTKIYEQ* |
| Ga0098055_13041973 | 3300006793 | Marine | MELMKLTADILQELSMYINLNYEDDWYLQEKVNELKTRIYEQ* |
| Ga0070748_101578810 | 3300006920 | Aqueous | MKLTADILQELSMYINLNYEDDWYLQEKVNELKTKIYEQ* |
| Ga0070748_10498724 | 3300006920 | Aqueous | MKSTADILQELSMYANLNYEDDWYLKDKINELKTRIYEQTNS* |
| Ga0075468_100123565 | 3300007229 | Aqueous | MKNKADILQELSMYVQLNYEDDWYLQEKVNELKTKIYE* |
| Ga0099847_10949153 | 3300007540 | Aqueous | MKLAADLLQELSMYINLHYEYDWYLQEKVDELKTKIYEQ* |
| Ga0102853_10090696 | 3300007543 | Estuarine | SMKLTADLLQELSMYINLNYEDDWYLQEKVNELKTRIYEQ* |
| Ga0098052_14038251 | 3300008050 | Marine | ADILQELSMYANLNYEEDWYLKDKINELKTRIYEQTNS* |
| Ga0114916_10294711 | 3300008221 | Deep Ocean | KLTADILQELSTYAQLNYEDDWYLIEKINELKNKIYKNE* |
| Ga0115371_102924632 | 3300008470 | Sediment | MKLTADILQELSMYVQVNYEDDWYLIEKINELKAKIYESN* |
| Ga0115371_107047024 | 3300008470 | Sediment | MKLTADILQELSMYVQVNYEDDWYLIEKVDELKEKIYK* |
| Ga0115371_107170263 | 3300008470 | Sediment | MKLTADILQELSMYVQVNYEDDWYLIEKINELKAKIYE* |
| Ga0103484_10105141 | 3300008919 | Bay Water | MKSTADILQELSMYANLNHEDDWYLKDKINELKTRI |
| Ga0115549_10161358 | 3300009074 | Pelagic Marine | MKLTADILQEISMYINLNYEDDWYLQEKVNELKTKIYEQ* |
| Ga0115550_10237658 | 3300009076 | Pelagic Marine | MKSTADLLQELSMYANLNYEEDWYLKDKINELKTRIYEQTNS* |
| Ga0115550_13066762 | 3300009076 | Pelagic Marine | MKLTADILQELSMYVQVNYEDDWYLQEKVNELKEKLYEKDK* |
| Ga0114994_101664763 | 3300009420 | Marine | MNQNPYNNMKLTADILQELSMYVQVNYEDDWYLQEKVNELKEKLYENDR* |
| Ga0115547_12805651 | 3300009426 | Pelagic Marine | MKLTADILQEISMYINLNYEDDWYLQEKVNELKTKIY |
| Ga0114915_10628894 | 3300009428 | Deep Ocean | MKLTADILQELSMYIQVNYEDDWYLIEKINELKTKIYENE* |
| Ga0115008_101124417 | 3300009436 | Marine | MKNTADILQELSMYVQVNYEDDWYLKEKVNELKTKIYEKI* |
| Ga0115008_110456821 | 3300009436 | Marine | MKNTADILQELSMYVQVNYEDDWYLIEKVNELKTKIYENN* |
| Ga0115565_101949505 | 3300009467 | Pelagic Marine | MKSTADILQELSMYANLNYEEDWYLKDKINELKTRIYEQT |
| Ga0115571_10205991 | 3300009495 | Pelagic Marine | LTADILQELSMYVQVNYEDDWYLQEKVNELKEKLYEKDK* |
| Ga0115570_101172386 | 3300009496 | Pelagic Marine | MKSTADILQELSMYANLNHEDDWYLKDKINELKTRIYEQTNN* |
| Ga0181397_11823951 | 3300017744 | Seawater | NIYMKSTADILQELSMYANLNYEDDWYLKDKINELKTRIYEQTNS |
| Ga0206125_100301943 | 3300020165 | Seawater | MKNTADIMQELSMYVQVNYEDDWYLIEKVNELKTKIYENN |
| Ga0206125_103029552 | 3300020165 | Seawater | MKLTADILQEISMYINLNYEDDWYLQEKVNELKTKIYEQ |
| Ga0206128_10116088 | 3300020166 | Seawater | MKSTADLLQELSMYANLNYEEDWYLKDKINELKTRIYEQTNS |
| Ga0206128_102406810 | 3300020166 | Seawater | MKSTADILQELSMYANLNYEDDWYLKDKINELKTRIYEQTNS |
| Ga0206128_12005332 | 3300020166 | Seawater | MKSTADILQELSMYANLNHEDDWYLKDKINELKTRIYEQTND |
| Ga0206124_100154519 | 3300020175 | Seawater | MKNKADILQELSMYVQLNYKDDWYLQEKVNELKTKIYE |
| Ga0206130_101567901 | 3300020187 | Seawater | ADILQELSMYANLNYEDDWYLKDKINELKTRIYEQTNS |
| Ga0206682_101631661 | 3300021185 | Seawater | AADILQELSMYANLNYEDDWYLKDKINELKTRIYESII |
| Ga0213863_100468596 | 3300021371 | Seawater | MKLTADILQELSMYINLNYEDDWYLQEKVNELKTRIYEQ |
| Ga0213863_100609527 | 3300021371 | Seawater | MKLTADLLQELSMYINLNYEDDWYLQEKVNELKNRIYEQ |
| Ga0196887_10467604 | 3300022178 | Aqueous | MKNTADILQELSMYVQVNYEDDWYLMEKVNELKTKIYEKI |
| Ga0224514_103540552 | 3300022217 | Sediment | MKLAADLLQELSMYINLNYEDDWYLQEKINELKTRIYEQ |
| (restricted) Ga0233409_102498723 | 3300022938 | Seawater | MKSTADILQELSMYTSLNYEDDWYLKDKINELKTRIYEQTNS |
| (restricted) Ga0233408_101629563 | 3300023089 | Seawater | MKSTADILQELSMYASLNYEDDWYLKDKINELKTRIYEQTNS |
| (restricted) Ga0233412_102859702 | 3300023210 | Seawater | MKLAADLLQELSMYINLNYEDDWYLQEKVNELKTRIYEQ |
| Ga0228694_1024335 | 3300023567 | Seawater | MKLTADLLQELSMYINLNYGDDWYLQEKVNELKTRIYEQ |
| Ga0228695_10064504 | 3300023699 | Seawater | MKLTADLLQELSMYIHLNYEDDWYLQEKVNELKTRIYEQ |
| Ga0228695_10230292 | 3300023699 | Seawater | MKSTADILQELSMYTNLNYEDDWYLKDKINELKTRIYEQTNS |
| Ga0228603_10058014 | 3300024183 | Seawater | MKLTAYLLQELSMYINLNYEDDWYLQEKVNELKTRIYEQ |
| Ga0228601_10052696 | 3300024223 | Seawater | MKLAADLLQELSMYINLNYEDDWYLQEKVNELKTRI |
| Ga0233399_11367732 | 3300024231 | Seawater | MKNKADILQELSMYVQLNYKDDWYLQEKVNELKTRIYESR |
| Ga0228655_10638821 | 3300024236 | Seawater | MKLTADILQELSMYINLNYEDDWYLQEKVNELKTRIY |
| (restricted) Ga0233444_101304952 | 3300024264 | Seawater | MKSTADILQELSMYANLNYEEDWYLKDKINELKTRIYEQTNS |
| Ga0228670_11231773 | 3300024319 | Seawater | MKTTADILQELSMYVKLNYEDDWYLEKKVNELKDKLYEQ |
| Ga0228631_10115052 | 3300024329 | Seawater | MKNKADILQELSMYVQLNYKDDWYLQEKVNELKTMIYESR |
| Ga0244777_1000045348 | 3300024343 | Estuarine | MKLTADILQELSMYIQVNYEDDWYLQEKVNELKEKLYEKDK |
| Ga0244777_105514673 | 3300024343 | Estuarine | SMKLTADLLQELSMYINLNYEDDWYLQEKVNELKTRIYEQ |
| Ga0244775_101430729 | 3300024346 | Estuarine | MKITADILQELSMYVKLNYEDDWYLEKKVNELKDKLYKQSK |
| Ga0233393_10856901 | 3300024413 | Seawater | ILQELSMYTNLNYEDDWYLKDKINELKTRIYEQTNS |
| (restricted) Ga0255046_105349902 | 3300024519 | Seawater | MKLTADLLQELSLYINLNYEDDWYLQEKVNELKTRIYEQ |
| Ga0208013_10228564 | 3300025103 | Marine | MELMKLTADILQELSMYINLNYEDDWYLQEKVNELKTKIYEQ |
| Ga0208299_11546354 | 3300025133 | Marine | DNSMKLTADILQELSMYINLNYEDDWYLQEKVNELKTRIYEQTNS |
| Ga0209336_100387423 | 3300025137 | Marine | MKLTADLLQELSMYINLNYEDDWYLQKKVNELKTRIYESK |
| Ga0209634_100227026 | 3300025138 | Marine | MKLTADLLQELSMYINLNYEDDWYLQEKVNELKTRIYESK |
| Ga0208032_100303712 | 3300025266 | Deep Ocean | MKLTADILQELSTYAQLNYEDDWYLIEKINELKNKIYKNE |
| Ga0208814_11145131 | 3300025276 | Deep Ocean | NLCTSITMKLTADILQELSTYAQLNYEDDWYLIEKINELKNKIYKNE |
| Ga0208814_11347632 | 3300025276 | Deep Ocean | MKLTADILQELSTYAQLNYEDDWYLIEKINELKTKIYENN |
| Ga0209557_10217254 | 3300025483 | Marine | MKLAADLLQEISMYINLNYEDDWYLQEKVNELKNKIYEQ |
| Ga0209557_11039702 | 3300025483 | Marine | MKLTADLLQELSMYINLNYGDDWYLQEKVNELKTRIYESR |
| Ga0208303_10743483 | 3300025543 | Aqueous | MKLTADILQELSMYINLNYEDDWYLQEKVNELKTKIYEQ |
| Ga0209271_101538082 | 3300027845 | Marine Sediment | MKLTADILQELSMYVQVNYEDDWYLMEKVNELKTKIYEKI |
| Ga0228634_10922991 | 3300028129 | Seawater | MKLTADLLQELSMYINLNYEDDWYLQEKVNELKTRIY |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |