NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100674

Metagenome / Metatranscriptome Family F100674

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100674
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 51 residues
Representative Sequence ATVVPPRPCGVYTRHWLPAARFRGPGRYTLTLRATDKSGLTSLPARRTFSHG
Number of Associated Samples 89
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 96.08 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.314 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.686 % of family members)
Environment Ontology (ENVO) Unclassified
(32.353 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(52.941 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 3.75%    β-sheet: 20.00%    Coil/Unstructured: 76.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF00270DEAD 3.92
PF14023DUF4239 2.94
PF13412HTH_24 1.96
PF00571CBS 1.96
PF00440TetR_N 1.96
PF03459TOBE 1.96
PF01883FeS_assembly_P 1.96
PF00106adh_short 0.98
PF00196GerE 0.98
PF06841Phage_T4_gp19 0.98
PF04101Glyco_tran_28_C 0.98
PF00583Acetyltransf_1 0.98
PF10400Vir_act_alpha_C 0.98
PF01569PAP2 0.98
PF13439Glyco_transf_4 0.98
PF00903Glyoxalase 0.98
PF00578AhpC-TSA 0.98
PF04542Sigma70_r2 0.98
PF13466STAS_2 0.98
PF02371Transposase_20 0.98
PF08669GCV_T_C 0.98
PF05199GMC_oxred_C 0.98
PF03640Lipoprotein_15 0.98
PF13528Glyco_trans_1_3 0.98
PF00570HRDC 0.98
PF02310B12-binding 0.98
PF14329DUF4386 0.98
PF12840HTH_20 0.98
PF13365Trypsin_2 0.98
PF03793PASTA 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.98
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.98
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.98
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.98
COG3547TransposaseMobilome: prophages, transposons [X] 0.98
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 0.98
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.31 %
UnclassifiedrootN/A15.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459006|GBPF9FW01BUOGWAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
2170459009|GA8DASG01BNNT4All Organisms → cellular organisms → Bacteria → Terrabacteria group544Open in IMG/M
3300001537|A2065W1_10783736Not Available534Open in IMG/M
3300002568|C688J35102_118145156Not Available533Open in IMG/M
3300004081|Ga0063454_100425765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium900Open in IMG/M
3300004157|Ga0062590_102243951Not Available573Open in IMG/M
3300004463|Ga0063356_105233964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300004480|Ga0062592_100731645All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300004643|Ga0062591_100322420Not Available1230Open in IMG/M
3300004643|Ga0062591_100508343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1037Open in IMG/M
3300004803|Ga0058862_12847040Not Available506Open in IMG/M
3300005176|Ga0066679_10068492All Organisms → cellular organisms → Bacteria2092Open in IMG/M
3300005181|Ga0066678_10398294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria913Open in IMG/M
3300005329|Ga0070683_101021312All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300005332|Ga0066388_105266123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria656Open in IMG/M
3300005338|Ga0068868_101077547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300005339|Ga0070660_100030621All Organisms → cellular organisms → Bacteria4037Open in IMG/M
3300005435|Ga0070714_100399967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1298Open in IMG/M
3300005441|Ga0070700_101704024Not Available541Open in IMG/M
3300005445|Ga0070708_101875376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300005535|Ga0070684_100235271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1673Open in IMG/M
3300005535|Ga0070684_100554432All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300005537|Ga0070730_10995577Not Available523Open in IMG/M
3300005547|Ga0070693_100411241All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300005574|Ga0066694_10474486All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300005981|Ga0081538_10282894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium615Open in IMG/M
3300006804|Ga0079221_11599052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300009012|Ga0066710_102561131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium735Open in IMG/M
3300009098|Ga0105245_10122437All Organisms → cellular organisms → Bacteria2431Open in IMG/M
3300009098|Ga0105245_11341871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium765Open in IMG/M
3300009098|Ga0105245_11879352All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300009148|Ga0105243_13111604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300009174|Ga0105241_11016908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300009174|Ga0105241_11169882All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300009174|Ga0105241_12346096Not Available532Open in IMG/M
3300009551|Ga0105238_10589544Not Available1119Open in IMG/M
3300010326|Ga0134065_10444677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300011271|Ga0137393_11156534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium657Open in IMG/M
3300012011|Ga0120152_1165345Not Available576Open in IMG/M
3300012187|Ga0136622_10288721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300012205|Ga0137362_10921310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium746Open in IMG/M
3300012207|Ga0137381_11656988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300012210|Ga0137378_11382893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300012211|Ga0137377_10266478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1644Open in IMG/M
3300012350|Ga0137372_10941942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300012351|Ga0137386_10794561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium680Open in IMG/M
3300012356|Ga0137371_11145558All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300012360|Ga0137375_10604370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium913Open in IMG/M
3300012362|Ga0137361_11289051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides islandensis655Open in IMG/M
3300012469|Ga0150984_121382146Not Available603Open in IMG/M
3300012532|Ga0137373_10697153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium757Open in IMG/M
3300012684|Ga0136614_10154078All Organisms → cellular organisms → Bacteria1741Open in IMG/M
3300012903|Ga0157289_10355439All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300012911|Ga0157301_10341440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M
3300012916|Ga0157310_10021920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1664Open in IMG/M
3300012951|Ga0164300_10121780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1180Open in IMG/M
3300012951|Ga0164300_11154058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300012958|Ga0164299_11521515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300012960|Ga0164301_11792161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300012976|Ga0134076_10521048Not Available545Open in IMG/M
3300012984|Ga0164309_11681258All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300012989|Ga0164305_10491016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium964Open in IMG/M
3300013045|Ga0154016_140184Not Available552Open in IMG/M
3300013296|Ga0157374_10282418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1639Open in IMG/M
3300013307|Ga0157372_12417540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300013765|Ga0120172_1019863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1977Open in IMG/M
3300013768|Ga0120155_1215562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300013772|Ga0120158_10278454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria821Open in IMG/M
3300014056|Ga0120125_1093365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300014325|Ga0163163_10683588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1090Open in IMG/M
3300014325|Ga0163163_11600292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria712Open in IMG/M
3300014827|Ga0120171_1110303Not Available680Open in IMG/M
3300015371|Ga0132258_11963964All Organisms → cellular organisms → Bacteria1472Open in IMG/M
3300015372|Ga0132256_100521710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1299Open in IMG/M
3300015372|Ga0132256_101757716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300015372|Ga0132256_103060175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300017656|Ga0134112_10521869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300017792|Ga0163161_10977781Not Available721Open in IMG/M
3300018078|Ga0184612_10239263All Organisms → cellular organisms → Bacteria → Terrabacteria group939Open in IMG/M
3300018429|Ga0190272_12652039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300018469|Ga0190270_13124042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300018476|Ga0190274_10026003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3927Open in IMG/M
3300018476|Ga0190274_11073140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium883Open in IMG/M
3300019263|Ga0184647_1030944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium770Open in IMG/M
3300019888|Ga0193751_1044923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1943Open in IMG/M
3300021968|Ga0193698_1022489All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300024283|Ga0247670_1048806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria763Open in IMG/M
3300025927|Ga0207687_10926495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia746Open in IMG/M
3300025927|Ga0207687_11124257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300025929|Ga0207664_10404637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1214Open in IMG/M
3300025929|Ga0207664_11566070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria581Open in IMG/M
3300025934|Ga0207686_11079336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium654Open in IMG/M
3300025937|Ga0207669_11825895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300028577|Ga0265318_10150690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium853Open in IMG/M
3300028800|Ga0265338_10922433Not Available594Open in IMG/M
3300028828|Ga0307312_10504057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium799Open in IMG/M
3300030336|Ga0247826_11707674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300031231|Ga0170824_102519887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium737Open in IMG/M
3300031235|Ga0265330_10083446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1375Open in IMG/M
3300031753|Ga0307477_10801045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium626Open in IMG/M
3300031938|Ga0308175_100582739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1201Open in IMG/M
3300032001|Ga0306922_11947162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.69%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.78%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost6.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere6.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.94%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.94%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere2.94%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.96%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.96%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.96%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.98%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.98%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.98%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459006Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cmEnvironmentalOpen in IMG/M
2170459009Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cmEnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012187Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06)EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013045Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300013768Permafrost microbial communities from Nunavut, Canada - A35_65cm_0MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014827Permafrost microbial communities from Nunavut, Canada - A3_80cm_18MEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300021968Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
L01_002385402170459006Grass SoilTLVPPRPCGVYARHWLPVARFRGPGRYTITLRATDKSGLTSLPARRTFSHG
F47_066147702170459009Grass SoilAYTRHWIPAARFRGPGRYTITLRATDKSGLTSLPARRTFSHG
A2065W1_1078373613300001537PermafrostTTLVPPRPCGVYTRHWTPSSRFRRTGSYGYTRARDKSRLASLPAKRTFTHG*
C688J35102_11814515623300002568SoilRLAPQPCGVYTRNWVPAPRFRGHGRYTITLRATDKSGSTSVPVKRTFFR*
Ga0063454_10042576513300004081SoilTESKAGRGTFTHRFSTLVPPQSCGVYTRSWVPAPKFRGHGRYTITLRARDTSGQTSLAARRSFSR*
Ga0062590_10224395113300004157SoilVYTRNWLPATRFRGPGKYTVTLRARDKSGLTSLPARRTFNR*
Ga0063356_10523396413300004463Arabidopsis Thaliana RhizosphereVPPRPCGVYTRHWLPATRFRGHGRYTVTLRATDKSGLTSLPAKRTFTR*
Ga0062592_10073164513300004480SoilRFATRVPPRPCGAYTRSWLTPPSFRGPGRYTITLRARDTSGRLSAPASRTFRRH*
Ga0062591_10032242013300004643SoilAPRPCGVYTRNWLPATRFRGPGKYTVTLRARDKSGLTSLPARRTFNR*
Ga0062591_10050834313300004643SoilFSTLTPPRPCGVYTRNWLPAQRFRGPGRYTVTLSARDKSGRTSLPARKTFTLR*
Ga0058862_1284704013300004803Host-AssociatedVYTRHWTPAARFRGPGRYTLTLRARDKSGLTSLPAHRSFSRG*
Ga0066679_1006849253300005176SoilVYTRHWLPALRFRGPGRFTIALRAIDKSGLSSTTARRTFSHG*
Ga0066678_1039829413300005181SoilVYTRHWTPVARFRGPGRYTVTLRARDKSGLTSLPARRSFSHG*
Ga0070683_10102131213300005329Corn RhizosphereAAPRPCGVYTRHWTPAARFQGPGRYTVTLKARDKSGFTSLAAHRTFSHG*
Ga0066388_10526612313300005332Tropical Forest SoilVRSFTRRFSTLVPPRPCGVYTRSWLPAPRFRGDGRYTITLRARDKSGLTSRPARRTFVLSV*
Ga0068868_10107754713300005338Miscanthus RhizosphereRRFTTLVAPKPCGVYTRHWTPVARFRGPGRYTVTLKARDKSGLTSLPAKRTFSR*
Ga0070660_10003062113300005339Corn RhizosphereATLVPPRPCGVYTRHWLPVARFRGPGTYTLTLRATDKSGLTSLPARRTFSHG*
Ga0070714_10039996713300005435Agricultural SoilTRRFATLVPPRPCGVYTRHWVPVARFRGPGRYTLTLSATDKSGLTSLPARRTFSHG*
Ga0070700_10170402413300005441Corn, Switchgrass And Miscanthus RhizospherePSYTRRFSTLVAPQPCGVYTRNWVPAPRFRGNGRYTITLKARDKSGSTSAAVHRTLFR*
Ga0070708_10187537613300005445Corn, Switchgrass And Miscanthus RhizosphereTRRFTTLAPPRPCGVYTRHWTPAARFRGPGSFTVTLSARDMSGLTSAASHRTFSHG*
Ga0070684_10023527133300005535Corn RhizosphereSYSRSFATLVPPRPCGVYTRHWLPVARFRGPGTYTLTLRATDKSGLTSLPARRTFSHG*
Ga0070684_10055443223300005535Corn RhizosphereTLVPPRPCGVYTRHWLPVTRFRGPGRYTLTLRATDKSGLTSLPARRSFSHG*
Ga0070730_1099557723300005537Surface SoilPAARFRGPGRYTLTLRTTDKSGLTSLPARRTFSHG*
Ga0070693_10041124113300005547Corn, Switchgrass And Miscanthus RhizosphereVYTRHWIPLARFRGPGRYTLTLRARDKSGLTSLPARRSFSRG*
Ga0066694_1047448613300005574SoilHWLPAARFRGPGRYTITLRATDKSGLTSLPARRTFSHG*
Ga0081538_1028289413300005981Tabebuia Heterophylla RhizosphereRFATRVPPRPCGAYTRSWLPAQRFRGPGRYTFTLRARDASGRTSAPARRTYRR*
Ga0079221_1159905213300006804Agricultural SoilPCGVYTRHWLPAARFRGPGRFTITLRARDKSGLTSLPARRTFNHG*
Ga0066710_10256113123300009012Grasslands SoilPGRLSYTRRFSTLIPPRPCGVYTRHWTPAPRFRGPGRYTITLRARDKSGLTSLPARRTFIRH
Ga0105245_1012243743300009098Miscanthus RhizosphereLIAPKPCGVYTRHWIPLARFRGPGRYTLTLRARDKSGLTSLPARRSFSRG*
Ga0105245_1134187113300009098Miscanthus RhizosphereGVYTRHWTPVARFRGHGRYTVSLKARDKSGLTSATAKRTFSR*
Ga0105245_1187935223300009098Miscanthus RhizosphereYTRRFSTLVAPQPCGVYTRNWVPAPRFRGGGRYTITLKARDKSGSTSAAVHRTLFR*
Ga0105243_1311160413300009148Miscanthus RhizosphereRPGRLSYTRRFSTLVAPKPCGVYTRNWMPAQRFRGSGKYTLVLRARDKSGLTSTMAQSTFVR*
Ga0105241_1101690823300009174Corn RhizosphereRFTTLIAPKPCGVYTRHWIPLARFRGPGRYTLTLRARDKSGLTSLPARRSFSRG*
Ga0105241_1116988223300009174Corn RhizosphereSYTRRFTTLAAPRPCGVYTRHWTPAARFQGPGRYTVTLKARDKSGFTSLAAHRTFSHG*
Ga0105241_1234609613300009174Corn RhizosphereLVAPQPCGVYTRNWVPAPRFRGHGRYTITLKARDKSGSTSAAVHRTFFR*
Ga0105238_1058954423300009551Corn RhizospherePCGVYTRHWLPVARFRGPGRYTVTLRATDKSGLTSLPARRTFTHG*
Ga0134065_1044467723300010326Grasslands SoilKLSYTRRFTTLVPPRPCGVYTRHWLPASRFRGPGRFTITLRARDKSGLTSLPVRRSFTHG
Ga0137393_1115653423300011271Vadose Zone SoilSRPGKLPYTRHFATLVPPRPCGVYSRHWIPVARFRGPGRYTLTLRATDKSGLTSLPARRTFSHG*
Ga0120152_116534513300012011PermafrostPPRPFTPLAPPRPGVFSPRHWTPAARFRGPGKYSYTLRARDKSGLTSLPAKRTFTHG*
Ga0136622_1028872113300012187Polar Desert SandLSYTRRFTTLSPPRPCGVYTRHWLPAARFRGPGRYTVTLRARDKSGLTSLPARRTFNR*
Ga0137362_1092131033300012205Vadose Zone SoilGKLSYTRHFATLVPPRPCGAYTRHWLQLARFRGPGRYTVTLRATDKSGLTSLPARRTFSHG*
Ga0137381_1165698813300012207Vadose Zone SoilTRHWLPVARFRGPGRYTLTLRATDKSGLTSLPARRTFSHG*
Ga0137378_1138289323300012210Vadose Zone SoilSYTRHFATLVPPRPCGVYTRHWLPVARFRGPGPYTLTLRATDKSGLTSLPARRTFTHG*
Ga0137377_1026647813300012211Vadose Zone SoilWLPVARFRGPGRYTLTLRATDKSGLTSLPARRTFSHG*
Ga0137372_1094194223300012350Vadose Zone SoilFATLVPPQPCGVYTRHWLPATRFRGPGRFTITIRARAKSGLTSLPARRSFSHG*
Ga0137386_1079456133300012351Vadose Zone SoilVLSHARRFTTLVAPKPCGVYTRHWIPAARFRGPGRYTLTLRATDKSGLTSLPARRTFSHG
Ga0137371_1114555833300012356Vadose Zone SoilVYTRHWLPVARFRGPGRYTLTLRARDKSGFTSLPARRSFSRG*
Ga0137375_1060437013300012360Vadose Zone SoilPCGVYARHWTPVARFRGPGSYTLTLRARDKSGLTSLPARRTFSHG*
Ga0137361_1128905123300012362Vadose Zone SoilRNFATLVPPRPCGVYTRHWLPAARFRGPGRYTVTLRATDKSGLTSLPARRTFSHG*
Ga0150984_12138214613300012469Avena Fatua RhizosphereTRHWTPVARFRGHGTYTVTLKARDKSGLTSIPAKRTFSR*
Ga0137373_1069715323300012532Vadose Zone SoilGVYSRHWLPVARFRGPGRYTLTLRAADKSGLISLPARRTFSHG*
Ga0136614_1015407833300012684Polar Desert SandYTRNWLPVLRFRGPGRYTVTLRARDTSGLTSAAASRTFNR*
Ga0157289_1035543913300012903SoilSRPNRASYTRRFSTLTPPRPCGVYTRNWLPAQRFRGPGRYTVTLSARDKSGRTSLPARKTFTLR*
Ga0157301_1034144023300012911SoilRRFSTIIPPQPCGVYTRNWVPSLRFRHGRYTVTLRARDKSALTSLPAKKTFFRR*
Ga0157310_1002192013300012916SoilSYTRRFTTLVAPKPCGVYTRHWTPVARFRGPGRYTVTLKARDKSGLTSLPAKRTFSR*
Ga0164300_1012178013300012951SoilTTLAAPRPCGVYTRHWTPAARFRGPGRYTVTLKARDKSGFTSLAAHRTFSHG*
Ga0164300_1115405823300012951SoilVATRVPPRPCGAYTRSWLPAKRFRGAGRYTIALQARDSDGLTSSVVRRTFRRA*
Ga0164299_1152151513300012958SoilTLVAPKPCGVYTRNWMPAPRFRGSGKYTLVLRARDKSGLTSTMAQSTFVR*
Ga0164301_1179216133300012960SoilGRLSYTRRFSTLVAPKPCGVYTRNWMPAPRFRGSGKYTLVLRARDKSGLTSSMVRSTFVR
Ga0134076_1052104813300012976Grasslands SoilTRRFATLVPPRPCGVYTRHWLQLARFRGPGRYTVTLRATDKSGLTSLPARRTFSHG*
Ga0164309_1168125823300012984SoilRGFATLVPPRPCGVYTRHWLPVARFRGPGSYTLTLRATDKSGLTSLPARRTFSHG*
Ga0164305_1049101613300012989SoilRPCGVYTRHWTPAARFRGPGRFTVTLKARDKSGLTSLPARRTFSRG*
Ga0154016_14018423300013045Corn, Switchgrass And Miscanthus RhizosphereLVAPKPCGVYTRHWTPAARFRGPGRYTLTLRARDKSGLTSLPAHRSFSRG*
Ga0157374_1028241833300013296Miscanthus RhizosphereGKLSYTRRFTTLAAPRPCGVYTRHWTPATRFRGPGSFTVTLSARDMSGLTSATSHRTFSHG*
Ga0157372_1241754023300013307Corn RhizosphereWTPAARFQGPGRYTVTLKARDKSGFTSLAAHRTFSHG*
Ga0120172_101986313300013765PermafrostTLVAPRPCGVYTRHWIPVARFRGPGRFSVTLKARDKSGLTSLPARRSFTRG*
Ga0120155_121556213300013768PermafrostHWLPVARFRGPGRYTLTLRATDKSGLTSLPARRTFSHG*
Ga0120158_1027845413300013772PermafrostCGVYTRHWLPVARFRGPGRYTFTLWATDKSGFTSLPARRTFSHG*
Ga0120125_109336533300014056PermafrostVYTRHWTPVARFRSPGRFTVTLKARDKSGFTSLPASRSFSRG*
Ga0163163_1068358833300014325Switchgrass RhizosphereSYTRRFTTLVAPKPCGVYTRHWTPVARFQGHGTYTVTLKARDKSGLTSLPAKRTFSR*
Ga0163163_1160029223300014325Switchgrass RhizosphereTLAAPRPCGVYTRYWTPVSRFRGHGRYTVTLKARDTSGFTSAAARRTFSR*
Ga0120171_111030323300014827PermafrostPCGAYTRHWLQLARFRGPGRYTLTLRATDKSGLTSLPARRTFSHG*
Ga0132258_1196396413300015371Arabidopsis RhizosphereFSTLVAPRPCGVYSRHWRLVQRFRGPGRVIVTLKARDKSGDTSAAARRSFSRG*
Ga0132256_10052171023300015372Arabidopsis RhizosphereRFSTLIPPRPCGVYTRNWLPAQRFRGPGRYTITLRARDVSGRTSLPATRTFRH*
Ga0132256_10175771613300015372Arabidopsis RhizospherePKPCGVYTRHWTPVARFRGHGTYTVTLKARDKSGLTSLPAKRTFSR*
Ga0132256_10306017523300015372Arabidopsis RhizosphereSYTRRFSTLIPPRPCGVYTRNWLPAERFRGPGRYTVTLRARDKSGLTSLPARRSFSR*
Ga0134112_1052186923300017656Grasslands SoilVYTRHWTPVPRFQGHGRYTVTLKARDKSGFTSLPAKRSFSR
Ga0163161_1097778113300017792Switchgrass RhizosphereWTPVARFQGHGTYTVTLKARDKSGLTSLPAKRTFSR
Ga0184612_1023926313300018078Groundwater SedimentSRPNRLSYTRRFTTLTPPRPCGVYTRHWLPALRFRGPGRYTVTLRARDKSGLTSLPARRTFNR
Ga0190272_1265203913300018429SoilTLTPPRPCGVYTRNWLPALRFRGPGRYTVTLRARDKSGLTSLPARRTFNR
Ga0190270_1312404213300018469SoilRRFTTLVPPRPCGVYTRNWLPVLRFRGPGRYTVTLRARDTSGLTSAAASRTFIRR
Ga0190274_1002600313300018476SoilRRFTTLVAPKPCGVYTRHWTPVARFRGPGRYTVTLKARDKSGLTSLPAKRTFSR
Ga0190274_1107314013300018476SoilTRRFTTLVAPKPCCVYTRHWTPVARFRGHGTYTVTLKARDKSGLTSLPAKRTFSR
Ga0184647_103094413300019263Groundwater SedimentPKPCGVYTRHWTPVARFRGHGRYTVTLKARDKSGLTSLPAKRTFSR
Ga0193751_104492353300019888SoilATVVPPRPCGVYTRHWLPAARFRGPGRYTLTLRATDKSGLTSLPARRTFSHG
Ga0193698_102248913300021968SoilLAAPRPCGVYTRHWTPAARFRGPGRFTVTLKARDKSGFTSLASHRTFSHG
Ga0247670_104880613300024283SoilWIPAARFRGPGRYTITLRATDKSGLTSLPARRTFSHG
Ga0207687_1092649523300025927Miscanthus RhizosphereRHWTPVSRFRGHGRYTVTLKARDTSGFTSAAARRTFSR
Ga0207687_1112425713300025927Miscanthus RhizosphereTRRFSTLAAPNPCGVYTRHWTPVARFRGHGRYTVSLKARDKSGLTSATAKRTFSR
Ga0207664_1040463723300025929Agricultural SoilTRRFATLVPPRPCGVYTRHWVPVARFRGPGRYTLTLSATDKSGLTSLPARRTFSHG
Ga0207664_1156607013300025929Agricultural SoilVAVPFERFTTLAAPRPCGVYTRHWTPAARFQGPGRYTVTLQARDRQGARSPARSRTLTHR
Ga0207686_1107933613300025934Miscanthus RhizosphereTDTRPGRLSYTRRFSTLVAPKPCGVYTRNWMPAPRFRGSGKYTLVLRARDKSGLTSTMAQSTFVR
Ga0207669_1182589523300025937Miscanthus RhizosphereRLSYTRRFSTLVAPKPCGVYTRNWMPAPRFRGSGKYTLVLRARDKSGLTSTMAQSTFVR
Ga0265318_1015069013300028577RhizosphereTRHWLPVARFRGPGRYTLTLRATDKSGLTSLPARRTSTHG
Ga0265338_1092243323300028800RhizosphereASYTRHFATFVPPRPCGVYARHWLPVARFRGSGTYTLTLRATDKSGLTSPLVRRTSTHG
Ga0307312_1050405713300028828SoilTRRFATLVPPRPCGVYARHWLPVARFRGPGRYTLTLRAADKSGLVSLPARRTFSHG
Ga0247826_1170767413300030336SoilCGVYTRSWLPAPRFRGGGRYTITLRARDKSGLTSAPARRTFVLSV
Ga0170824_10251988723300031231Forest SoilYARHWLPVARFRGPGRFIVTLRAADKSGLVSLPARRSFSHG
Ga0265330_1008344613300031235RhizosphereTLVPPRPCGVYTRHWLPVARFRGPGRYTLTLRATDKSGLTSLPARRTSTHG
Ga0307477_1080104523300031753Hardwood Forest SoilPGKASYSRNFATLAPPQPCGVYARHWVPAARFRGAGRYTVTLTATDKSGLTSVPARRSFSRG
Ga0308175_10058273933300031938SoilATLVPPRACGVYTRHWLPVTRFRGPGRYTLTLKATEKSGLTSLPPRRTFSHG
Ga0306922_1194716223300032001SoilRRFTTLVPPRPCGVYTRHWIPATRFRGPGRYTLTLRARDKSGSTSLPARRTFSHGA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.