Metagenome Family F100440

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F100440
Family Type	Metagenome
Number of Sequences	102
Average Sequence Length	37 residues
Representative Sequence	MNLYDKIMALYPELTTQDFLTVITLQNDSDGKGDYIA
Number of Associated Samples	81
Number of Associated Scaffolds	102

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	98.04 %
% of genes near scaffold ends (potentially truncated)	99.02 %
% of genes from short scaffolds (< 2000 bps)	93.14 %
Associated GOLD sequencing projects	78
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (66.667 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (20.588 % of family members)
Environment Ontology (ENVO)	Unclassified (62.745 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (67.647 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 21.54% β-sheet: 9.23% Coil/Unstructured: 69.23%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.54
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 102 Family Scaffolds
PF00386	C1q	8.82
PF13884	Peptidase_S74	1.96
PF16778	Phage_tail_APC	0.98
PF07460	NUMOD3	0.98
PF16075	DUF4815	0.98
PF13392	HNH_3	0.98
PF09636	XkdW	0.98
PF07120	DUF1376	0.98

COG ID	Name	Functional Category	% Frequency in 102 Family Scaffolds
COG3756	Uncharacterized conserved protein YdaU, DUF1376 family	Function unknown [S]	0.98

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	78.43 %
Unclassified	root	N/A	21.57 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	75.49 %
Unclassified	root	N/A	21.57 %
cellular organisms	root	All Organisms → cellular organisms	2.94 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	66.67 %
Unclassified	root	N/A	21.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.86 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	2.94 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	66.67 %
Unclassified	root	N/A	21.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.86 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.98 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	66.67 %
Unclassified	root	N/A	21.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.86 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.98 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	66.67 %
Unclassified	root	N/A	21.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.86 %
Verrucomicrobiae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae	0.98 %

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	65.69 %
Unclassified	root	N/A	21.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.86 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.98 %
Verrucomicrobiales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales	0.98 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	65.69 %
Unclassified	root	N/A	21.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.86 %
Podoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae	0.98 %
Verrucomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae	0.98 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	65.69 %
Unclassified	root	N/A	21.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.86 %
unclassified Verrucomicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae	0.98 %
Podoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae	0.98 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	65.69 %
Unclassified	root	N/A	21.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.86 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.98 %
Podoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae	0.98 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000949\|BBAY94_10183570	Not Available	564	Open in IMG/M
3300002091\|JGI24028J26656_1012429	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	987	Open in IMG/M
3300002835\|B570J40625_101076323	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	681	Open in IMG/M
3300002835\|B570J40625_101201115	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	635	Open in IMG/M
3300002835\|B570J40625_101451803	Not Available	564	Open in IMG/M
3300005239\|Ga0073579_1141159	Not Available	513	Open in IMG/M
3300005580\|Ga0049083_10287333	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	551	Open in IMG/M
3300005581\|Ga0049081_10259297	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	608	Open in IMG/M
3300005581\|Ga0049081_10311161	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	541	Open in IMG/M
3300005582\|Ga0049080_10175300	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	713	Open in IMG/M
3300005582\|Ga0049080_10228416	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	611	Open in IMG/M
3300005582\|Ga0049080_10237616	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	597	Open in IMG/M
3300005805\|Ga0079957_1235654	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	859	Open in IMG/M
3300006104\|Ga0007882_10284176	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	537	Open in IMG/M
3300006106\|Ga0007833_1084717	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	565	Open in IMG/M
3300006119\|Ga0007866_1041438	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	889	Open in IMG/M
3300006123\|Ga0007852_1011038	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2167	Open in IMG/M
3300006123\|Ga0007852_1122755	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	566	Open in IMG/M
3300007363\|Ga0075458_10105271	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	878	Open in IMG/M
3300007542\|Ga0099846_1008583	All Organisms → Viruses → Predicted Viral	4082	Open in IMG/M
3300008114\|Ga0114347_1141604	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	873	Open in IMG/M
3300008120\|Ga0114355_1104866	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1102	Open in IMG/M
3300008120\|Ga0114355_1136309	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	896	Open in IMG/M
3300008266\|Ga0114363_1207691	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	594	Open in IMG/M
3300008267\|Ga0114364_1061817	All Organisms → Viruses → Predicted Viral	1294	Open in IMG/M
3300008450\|Ga0114880_1054818	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1670	Open in IMG/M
3300009068\|Ga0114973_10629054	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	549	Open in IMG/M
3300009155\|Ga0114968_10157008	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1346	Open in IMG/M
3300009155\|Ga0114968_10491215	Not Available	660	Open in IMG/M
3300009161\|Ga0114966_10425478	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	772	Open in IMG/M
3300009164\|Ga0114975_10003401	All Organisms → Viruses	10618	Open in IMG/M
3300009165\|Ga0105102_10225694	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae	945	Open in IMG/M
3300009172\|Ga0114995_10275887	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	927	Open in IMG/M
3300009180\|Ga0114979_10654565	Not Available	597	Open in IMG/M
3300009785\|Ga0115001_10626239	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	656	Open in IMG/M
3300010354\|Ga0129333_10284329	All Organisms → Viruses → Predicted Viral	1483	Open in IMG/M
3300010356\|Ga0116237_10689294	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	877	Open in IMG/M
3300010368\|Ga0129324_10433739	Not Available	505	Open in IMG/M
3300010370\|Ga0129336_10197423	All Organisms → Viruses → Predicted Viral	1146	Open in IMG/M
3300011010\|Ga0139557_1065795	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	608	Open in IMG/M
3300013010\|Ga0129327_10495322	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	661	Open in IMG/M
3300013094\|Ga0164297_10302784	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	610	Open in IMG/M
3300013286\|Ga0136641_1192767	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	541	Open in IMG/M
3300013372\|Ga0177922_10620119	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	648	Open in IMG/M
3300013372\|Ga0177922_11265021	Not Available	546	Open in IMG/M
3300015050\|Ga0181338_1041132	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	687	Open in IMG/M
3300017722\|Ga0181347_1061206	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1121	Open in IMG/M
3300017736\|Ga0181365_1089132	Not Available	752	Open in IMG/M
3300017736\|Ga0181365_1106816	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	676	Open in IMG/M
3300017754\|Ga0181344_1206225	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	550	Open in IMG/M
3300017761\|Ga0181356_1165157	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	677	Open in IMG/M
3300017761\|Ga0181356_1199524	Not Available	593	Open in IMG/M
3300017774\|Ga0181358_1181049	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	701	Open in IMG/M
3300017777\|Ga0181357_1287824	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	561	Open in IMG/M
3300017778\|Ga0181349_1157861	All Organisms → Viruses	810	Open in IMG/M
3300017778\|Ga0181349_1221981	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	644	Open in IMG/M
3300017778\|Ga0181349_1249689	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	593	Open in IMG/M
3300017784\|Ga0181348_1242896	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	626	Open in IMG/M
3300017784\|Ga0181348_1299677	Not Available	539	Open in IMG/M
3300018410\|Ga0181561_10106374	All Organisms → Viruses → Predicted Viral	1520	Open in IMG/M
3300019784\|Ga0181359_1008746	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	3509	Open in IMG/M
3300019784\|Ga0181359_1188685	Not Available	674	Open in IMG/M
3300019784\|Ga0181359_1230663	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	575	Open in IMG/M
3300020048\|Ga0207193_1559809	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	759	Open in IMG/M
3300020048\|Ga0207193_1812793	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	581	Open in IMG/M
3300020205\|Ga0211731_11479911	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	991	Open in IMG/M
3300020683\|Ga0214234_102131	All Organisms → cellular organisms → Bacteria	2518	Open in IMG/M
3300020735\|Ga0214219_1061264	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	534	Open in IMG/M
3300021136\|Ga0214167_1040247	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1005	Open in IMG/M
3300021960\|Ga0222715_10495368	Not Available	649	Open in IMG/M
3300021961\|Ga0222714_10246022	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1006	Open in IMG/M
3300022190\|Ga0181354_1164144	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	686	Open in IMG/M
3300022200\|Ga0196901_1032172	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2041	Open in IMG/M
3300022200\|Ga0196901_1061489	Not Available	1378	Open in IMG/M
3300022925\|Ga0255773_10294280	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	667	Open in IMG/M
3300023184\|Ga0214919_10693216	Not Available	579	Open in IMG/M
3300024346\|Ga0244775_11487593	Not Available	518	Open in IMG/M
3300025385\|Ga0207956_1042376	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	573	Open in IMG/M
3300025426\|Ga0208739_1048898	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	689	Open in IMG/M
3300025598\|Ga0208379_1043090	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1196	Open in IMG/M
3300025778\|Ga0208388_1051364	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	584	Open in IMG/M
3300025778\|Ga0208388_1053764	Not Available	567	Open in IMG/M
3300025880\|Ga0209534_10421099	Not Available	571	Open in IMG/M
3300026130\|Ga0209961_1063579	Not Available	687	Open in IMG/M
3300027138\|Ga0255064_1067188	Not Available	558	Open in IMG/M
3300027594\|Ga0255120_1078311	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	573	Open in IMG/M
3300027732\|Ga0209442_1262068	Not Available	613	Open in IMG/M
3300027734\|Ga0209087_1127149	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1048	Open in IMG/M
3300027764\|Ga0209134_10028777	All Organisms → Viruses → Predicted Viral	1792	Open in IMG/M
3300027798\|Ga0209353_10126276	All Organisms → Viruses → Predicted Viral	1149	Open in IMG/M
3300027896\|Ga0209777_10966479	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	585	Open in IMG/M
3300027896\|Ga0209777_11145893	Not Available	523	Open in IMG/M
3300031885\|Ga0315285_10745103	Not Available	623	Open in IMG/M
3300031885\|Ga0315285_10977906	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	509	Open in IMG/M
3300032561\|Ga0316222_1169466	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	796	Open in IMG/M
3300033996\|Ga0334979_0468948	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	686	Open in IMG/M
3300034012\|Ga0334986_0212728	All Organisms → cellular organisms → Bacteria	1073	Open in IMG/M
3300034061\|Ga0334987_0183218	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1493	Open in IMG/M
3300034062\|Ga0334995_0654438	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	600	Open in IMG/M
3300034104\|Ga0335031_0000547	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	29156	Open in IMG/M
3300034118\|Ga0335053_0822433	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	511	Open in IMG/M
3300034284\|Ga0335013_0696333	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	580	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	98.04%
Host-Associated	Host-Associated	0.98%
Engineered	Engineered	0.98%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.04%
Algae	Host-Associated → Algae	0.98%
Wastewater	Engineered → Wastewater	0.98%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	80.39%
Marine	Environmental → Aquatic → Marine	16.67%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	0.98%
Green Algae	Host-Associated → Algae → Green Algae	0.98%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.98%

Habitat	Taxonomy	Distribution
Lentic	Environmental → Aquatic → Freshwater → Lentic	46.08%
Lake	Environmental → Aquatic → Freshwater → Lake	30.39%
Coastal	Environmental → Aquatic → Marine → Coastal	7.84%
Oceanic	Environmental → Aquatic → Marine → Oceanic	2.94%
Unclassified	Environmental → Aquatic → Marine → Unclassified	2.94%
River	Environmental → Aquatic → Freshwater → River	1.96%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.96%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.98%
Ice	Environmental → Aquatic → Freshwater → Ice	0.98%
Neritic Zone	Environmental → Aquatic → Marine → Neritic Zone	0.98%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	0.98%
Ectosymbionts	Host-Associated → Algae → Green Algae → Ectosymbionts	0.98%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.98%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	37.25%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	26.47%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	7.84%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	3.92%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	3.92%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	2.94%
Unclassified	Environmental → Aquatic → Marine → Oceanic → Unclassified	2.94%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	2.94%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	1.96%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	1.96%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	1.96%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.98%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.98%
Unclassified	Environmental → Aquatic → Marine → Neritic Zone → Unclassified	0.98%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	0.98%
Unclassified	Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified	0.98%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.98%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	20.59%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	9.80%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	8.82%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	6.86%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	5.88%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	4.90%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater	3.92%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	3.92%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	3.92%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	3.92%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	2.94%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	1.96%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	1.96%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	1.96%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	1.96%
Marine	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine	1.96%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	1.96%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	1.96%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.98%
Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic	0.98%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.98%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.98%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater	0.98%
Marine	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine	0.98%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	0.98%
Pelagic Marine	Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine	0.98%
Water	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water	0.98%
Macroalgal Surface	Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface	0.98%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.98%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000949	Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94	Host-Associated	Open in IMG/M
3300002091	Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300005239	Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006104	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1	Environmental	Open in IMG/M
3300006106	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07	Environmental	Open in IMG/M
3300006119	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07	Environmental	Open in IMG/M
3300006123	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08	Environmental	Open in IMG/M
3300007363	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA	Environmental	Open in IMG/M
3300007542	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG	Environmental	Open in IMG/M
3300008114	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA	Environmental	Open in IMG/M
3300008120	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008267	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR	Environmental	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009172	Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009785	Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010356	AD_USDEca	Engineered	Open in IMG/M
3300010368	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA	Environmental	Open in IMG/M
3300010370	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA	Environmental	Open in IMG/M
3300011010	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice	Environmental	Open in IMG/M
3300013010	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA	Environmental	Open in IMG/M
3300013094	Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG	Environmental	Open in IMG/M
3300013286	Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300015050	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300018410	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020683	Freshwater microbial communities from Trout Bog Lake, WI - 08JUL2008 hypolimnion	Environmental	Open in IMG/M
3300020735	Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion	Environmental	Open in IMG/M
3300021136	Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnion	Environmental	Open in IMG/M
3300021960	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022200	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)	Environmental	Open in IMG/M
3300022925	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300025385	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07 (SPAdes)	Environmental	Open in IMG/M
3300025426	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes)	Environmental	Open in IMG/M
3300025598	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes)	Environmental	Open in IMG/M
3300025778	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes)	Environmental	Open in IMG/M
3300025880	Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)	Environmental	Open in IMG/M
3300026130	Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes)	Environmental	Open in IMG/M
3300027138	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h	Environmental	Open in IMG/M
3300027594	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h	Environmental	Open in IMG/M
3300027732	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)	Environmental	Open in IMG/M
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027764	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027896	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)	Environmental	Open in IMG/M
3300031885	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36	Environmental	Open in IMG/M
3300032561	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034012	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027	Environmental	Open in IMG/M
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034118	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165	Environmental	Open in IMG/M
3300034284	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
BBAY94_101835702	3300000949	Macroalgal Surface	MMNLYEKIKAIYPELTDRDFMTVITLQNDSDGKGDY
JGI24028J26656_10124291	3300002091	Lentic	MLYSKIMALYPSLTQQDFLTVVTLQNDSDGKGDYIAKWEHPT
B570J40625_1010763232	3300002835	Freshwater	MNLFQKIMALYPSLTPQDFNINGTIVLRNDSDGNGDYIKSW
B570J40625_1012011151	3300002835	Freshwater	MSLYEKIIALYPELKDYNFAFGDIRLQNDSDGKGDYIAKWEHT
B570J40625_1014518031	3300002835	Freshwater	MLYDKIMALYPSLTQQDFMTVITLQNDSDGKGDYIAKWEH
Ga0073579_11411592	3300005239	Marine	MSLYDKIIALYPELADYDFAMGDITLQNDSDGKGDYIAKW
Ga0049083_102873332	3300005580	Freshwater Lentic	MNLYDKIMALYPSLTQQDFLTVIRLQNDSDGKGDYI
Ga0049081_102592972	3300005581	Freshwater Lentic	MNLYEKIIDLYPELANFDFASGVITLQNDLDEKGDYIAK
Ga0049081_103111612	3300005581	Freshwater Lentic	MTLYDKIMALYPALTQQDFLTTITLQNDSDGRGDYI
Ga0049080_101753001	3300005582	Freshwater Lentic	MTLYEKIKSIYPQLTDNDFLTTIRLQNDSDGKGDYI
Ga0049080_102284162	3300005582	Freshwater Lentic	MTLYEKIKTIYPELQDADFLDTIRLQNDSDGKGDYIAFW
Ga0049080_102376161	3300005582	Freshwater Lentic	MTLYDKIKTLYTELTDHDFMTVITLQNDSDGKGDYIAK
Ga0079957_12356541	3300005805	Lake	MTLSQKIKSIYPELTDRDFTTVITLQNDSDGNVGIF*
Ga0007882_102841762	3300006104	Freshwater	MTLYDKIKSIYPSLENNDFVTVITLQNDSNGAGDYIK
Ga0007833_10847171	3300006106	Freshwater	MLYEKIIALYPSLTQQDFLTVITLQNDSNGAGDYI
Ga0007866_10414383	3300006119	Freshwater	MTLYDKIKAIYPNLEDKDFMTVITLQNNSDGKGDY
Ga0007852_10110386	3300006123	Freshwater	MYEKLIKLYPELATFDFASRLIVIQNDSDGKGDYIAKWE
Ga0007852_11227552	3300006123	Freshwater	MYEKLIKLYPELANFDFAGGVITLQNDSNGAGDYIKA
Ga0075458_101052712	3300007363	Aqueous	MMTLYDKIKALYPELQDADFMDTIRLQNDSDGRGDYI
Ga0099846_10085834	3300007542	Aqueous	MNLYDKIMALYPELTTQDFLTVITLQNDSDGKGDYIA
Ga0114347_11416043	3300008114	Freshwater, Plankton	MTLYEKIKTIYPQLTDNDFFTVIILQNDSDGRGDYIAK
Ga0114355_11048661	3300008120	Freshwater, Plankton	MTLYDKIKSIYPQLTDNDFMTVIRLQNDSDGRGDYIAKW
Ga0114355_11363091	3300008120	Freshwater, Plankton	MTLYEKIKQLYPELTDNDFLTVITLQNDSDGRGDYIA
Ga0114363_12076911	3300008266	Freshwater, Plankton	MMTLYEKIKQLYPSLTDKDFMTVITLQNDSDGKGD
Ga0114364_10618171	3300008267	Freshwater, Plankton	MMTLPEKIKSLYPSLEDKDFMTTILLQNDSDGKGD
Ga0114880_10548185	3300008450	Freshwater Lake	MLYEKIISIYPELANFDFASGVITLQNDSDGKGDYIAKWEH
Ga0114973_106290542	3300009068	Freshwater Lake	MLYDKIKTLYPELTDHDFMTVITLQNDSDGKGDYIAKW
Ga0114968_101570081	3300009155	Freshwater Lake	MLYEKIMAIYPQLEPQDFLTVITLQNDSDGKDDYIAK
Ga0114968_104912151	3300009155	Freshwater Lake	MTLYDKIISIYPVLATYDFAMGAITLQDNSDGQGPYIAKWE
Ga0114966_104254782	3300009161	Freshwater Lake	MNLYEKVMAIYPQLENKDFMTFITLQNDSNGKGDYI
Ga0114975_100034011	3300009164	Freshwater Lake	MTLYEKIISLYPELATYDFAFGAITLQNDSDGKGDYI
Ga0105102_102256941	3300009165	Freshwater Sediment	MYEKIINLYPSLTDKDFTTVITLQNDGDGDYIAKWEHP
Ga0114995_102758871	3300009172	Marine	MTLYEKVMALHPELIDRDFLTVITLQNDSDDRGDYIAA
Ga0114979_106545652	3300009180	Freshwater Lake	MLYDKIIAIYPELANFDFAKGVITLQNDGNGDYIAK
Ga0115001_106262392	3300009785	Marine	MLYDKIMGLYPELTQQDFLYVIILQNDSDGKGDYI
Ga0129333_102843294	3300010354	Freshwater To Marine Saline Gradient	MTLYDKIIALYPELQPQDFMTVIALQNDSDGRGDYI
Ga0116237_106892943	3300010356	Anaerobic Digestor Sludge	MLYDKIMALYPELTQQDFLTVITLQNDSDGKGDYIAK
Ga0129324_104337391	3300010368	Freshwater To Marine Saline Gradient	MTLYDKIKALYPELTNSDFMTTIRLQNDSDGKGDYIA
Ga0129336_101974231	3300010370	Freshwater To Marine Saline Gradient	MLYEKIIALYPELSTFDFASGVITLQNDSDGKGDYI
Ga0139557_10657951	3300011010	Freshwater	MMTLYDKIKTLYPELTERDFTTVITLQNDSDGKGDYIAK
Ga0129327_104953222	3300013010	Freshwater To Marine Saline Gradient	MTLYEKIIALYPELADYNFADGDIRLQNDSDGRGDYIK
Ga0164297_103027841	3300013094	Freshwater	MLYNKIMAIYPSLTFEDFITFITLQNDSDGKGDYI
Ga0136641_11927672	3300013286	Freshwater	MMLYDKIKSIYPQLTDKDFMTVICLQNDSDGKGDYIA
Ga0177922_106201191	3300013372	Freshwater	MMTLPEKIKQLYPSLTQQDFLTVITLQNDSDGKGDYIAKW
Ga0177922_112650211	3300013372	Freshwater	MLYDKIIAIHPSLTDKDFMTVITLQNDSDGKGDYI
Ga0181338_10411322	3300015050	Freshwater Lake	MTLYEKIKALYPQLTERDFYTVIQLQNDSDGKGDYIAL
Ga0181347_10612061	3300017722	Freshwater Lake	MNLYEKIMALYPSLKGEDFGGPFATIRLQNDLDGKGDYIAKWEH
Ga0181365_10891322	3300017736	Freshwater Lake	MNLYEKIMALYPSLKGEDFGGPFATIRLQNDLDGKGDYIAKWE
Ga0181365_11068161	3300017736	Freshwater Lake	MMTLYDKIKTLYPELTERDFTTVITLQNDSDGKGF
Ga0181344_12062252	3300017754	Freshwater Lake	MTLYEKIIAIYPNLVDKDFMTVIALQNDSDGRGDYIA
Ga0181356_11651572	3300017761	Freshwater Lake	MNLYEKIIDLYPELANFDFASGVITLQNDLDEKGDYIAKWE
Ga0181356_11995242	3300017761	Freshwater Lake	MTLPEKIKALYPQLTDKDFVTVIRLQNDSDGKGDYIA
Ga0181358_11810492	3300017774	Freshwater Lake	MNLYEKIKAIYPSLEDKDFWNVIALQDNLDGKGAFI
Ga0181357_12878242	3300017777	Freshwater Lake	MTLYEKIKSIYPSLTDSDFMTAIQLQNDSDGKGDY
Ga0181349_11578611	3300017778	Freshwater Lake	MTLYQKIISLYPELATYDFAFGAITLQNDSDGKGDY
Ga0181349_12219811	3300017778	Freshwater Lake	MTLYDKIMALYPALTQQDFTTTIRLQNDSDGKGDY
Ga0181349_12496891	3300017778	Freshwater Lake	MTLPEKIMALYPSLTQQDFLTVIRLQNDSDGRGDYIAK
Ga0181348_12428962	3300017784	Freshwater Lake	MTLYEKIRALYPSLTQQDFLTVVRIQNNSDGKGDFIKE
Ga0181348_12996772	3300017784	Freshwater Lake	MLYDKIIIIYPQLTDVDFITTIRLQNDSDGKGDYIAKWEH
Ga0181561_101063744	3300018410	Salt Marsh	MTLYEKIKAIYPELQDADFLTVIRLQNDSDGCGDYIA
Ga0181359_10087461	3300019784	Freshwater Lake	MTLHDKIKTLYPELTDGDFVNIIRLQNDSDERGDYIAKWEHPTL
Ga0181359_11886851	3300019784	Freshwater Lake	MTLPEKIKALYPTLTERDFYTVITLQNDSDGKGDYIAKW
Ga0181359_12306632	3300019784	Freshwater Lake	MTLYDKIKTLYTELTDHDFMTVITLQNDSDGKGDYIAKFSFPSS
Ga0207193_15598092	3300020048	Freshwater Lake Sediment	MLYGQVMTLYPELTDRDFITVIRLQNDSDGKGDYIAKWEHPT
Ga0207193_18127931	3300020048	Freshwater Lake Sediment	MTLYEKIMALYPELTSRDFMSTIRLQNDSDGKGDY
Ga0211731_114799113	3300020205	Freshwater	MYEKIMALYPSLQPQDFLTVIRLQNDSDGKGDYIAKWE
Ga0214234_1021311	3300020683	Freshwater	MALYPSLTQQDFSTVITLQNDSDGKGDYIAKWEHPT
Ga0214219_10612642	3300020735	Freshwater	MLYDKIMALYPSLTQQDFLTVITLQNDSDGKGDYIAKW
Ga0214167_10402473	3300021136	Freshwater	MLYDKIKTIYPSLEDKDFMTVITLQNDSDNRGDYI
Ga0222715_104953681	3300021960	Estuarine Water	MSLYEKIIALYPELTDYDFYTVITLQNDSDGNGDYIAKW
Ga0222714_102460223	3300021961	Estuarine Water	MNIYDKIMALYPSLTQQDFLTVITLQNDSDGKGDY
Ga0181354_11641442	3300022190	Freshwater Lake	MSLYEKIIAIHPSLANIDFTTVIRLQDNSDGKGAYIAKWEHPT
Ga0196901_10321721	3300022200	Aqueous	MTLYEKILSIYPELTDFDFASGVITLQNDSDGRGDYIK
Ga0196901_10614891	3300022200	Aqueous	MLYDKIMALYPSLTQQDFLTVITLQNDSDGKGDYIAKWEH
Ga0255773_102942802	3300022925	Salt Marsh	MMTLYEKIKEIYPELTNDDFIDNITLRNDSDGKGDYIAK
Ga0214919_106932162	3300023184	Freshwater	MTLHQKIISLYPVLATYDFATGDIRLQNNSDGKGEYIA
Ga0244775_114875931	3300024346	Estuarine	MILYEKIIKIYPELIGYDFAIKDIMLKNDSDGKGDY
Ga0207956_10423761	3300025385	Freshwater	MLYEKIIALYPSLTQQDFLTVITLQNDSNGAGDYIK
Ga0208739_10488982	3300025426	Freshwater	MALYDQIKATYPQLTEKDFMTVIRLQNDSDGKGDYIKS
Ga0208379_10430904	3300025598	Freshwater	MALYDQIKAIYPQLTDNDFLTTIRLQNDSDGKGDYIAKW
Ga0208388_10513642	3300025778	Freshwater	MTLYEKIMALYPSLIDIDFLTTIRLQNDSDGRGDYIAS
Ga0208388_10537642	3300025778	Freshwater	MLYDKIMALYPSLTQQDFLTVITLQNDSDGKGDYI
Ga0209534_104210992	3300025880	Pelagic Marine	MSLYKKIIALYPELADYDFAMGDITLQNDSNGKGDY
Ga0209961_10635792	3300026130	Water	MSLYEKIIAIYPELSDYDFAMGDITLQNDSDGKGDYIAKWE
Ga0255064_10671882	3300027138	Freshwater	MTMTLYDKIIAIYPELADQQQAFMDGTITLQNDSDGKGDYI
Ga0255120_10783112	3300027594	Freshwater	MFLSKKIKTIYPELQDLDFLATICLQNDSDGKGDY
Ga0209442_12620682	3300027732	Freshwater Lake	MTLYDKIISLYPELATYDFAFGAITLQNDSDGKGD
Ga0209087_11271493	3300027734	Freshwater Lake	MMTLYDKIKILYPQLTDHDFMTVITLQNDSDGKGDY
Ga0209134_100287771	3300027764	Freshwater Lake	MLYEQVMALYPELTQQDFMTTIRLQNDSDGKGDYIAK
Ga0209353_101262764	3300027798	Freshwater Lake	MTLYDKITTLYPELTDVDFMFVITLQNDSDGKGDYI
Ga0209777_109664792	3300027896	Freshwater Lake Sediment	MTLYEKIIKIYPELTEFDFVTVITLQNDSDGKGDYI
Ga0209777_111458931	3300027896	Freshwater Lake Sediment	MTLYDKIIAIYPDLQPEDFFTVIRLQNDSDGNGDYIK
Ga0315285_107451031	3300031885	Sediment	MNLYEKIIAIYPELTQDDFMTSIRLQNDSDGQGDY
Ga0315285_109779061	3300031885	Sediment	MLYEKIKSIYPQLEDKDFLTTIRLQNDSDGKGDYIAKWG
Ga0316222_11694661	3300032561	Freshwater	MTLYEKIISIYPSLTQQDFLTVITLQNDSDGKGDYIA
Ga0334979_0468948_3_113	3300033996	Freshwater	MTLYDKIKALYPELQDADFMDTIRLQNDSDGKGDYIK
Ga0334986_0212728_969_1073	3300034012	Freshwater	MMSLYDKIKALYPELTDRDFLTVIMLQNDSDGRGD
Ga0334987_0183218_1375_1491	3300034061	Freshwater	MMTLYEKIKALYPELQDADFLATIRLQNDSDGKGDYIAK
Ga0334995_0654438_3_122	3300034062	Freshwater	MLYDKIKALYPELTDNDFLTVITLQNDSDGKGDYIAKWEH
Ga0335031_0000547_29039_29155	3300034104	Freshwater	MMTLYEKIKQLYPSLTDKDFWTVITLQNDSDGKGDYIAK
Ga0335053_0822433_407_511	3300034118	Freshwater	MLSEKIKQLYPSLTQEDFITVIILQNNSDGKGDYI
Ga0335013_0696333_2_112	3300034284	Freshwater	MLYDKIKQLYPELTNNDFLTTIRLQNDSDGKGDYIAK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F100440

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences