NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099818

Metagenome / Metatranscriptome Family F099818

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099818
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 45 residues
Representative Sequence MLVERRGQVIAVEIGPTGYAGRSPTVQRKAAAFVRWHEPDDARVS
Number of Associated Samples 101
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 49.02 %
% of genes near scaffold ends (potentially truncated) 88.35 %
% of genes from short scaffolds (< 2000 bps) 90.29 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.204 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(12.621 % of family members)
Environment Ontology (ENVO) Unclassified
(14.563 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.660 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.36%    β-sheet: 0.00%    Coil/Unstructured: 61.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF02371Transposase_20 4.85
PF08388GIIM 3.88
PF04392ABC_sub_bind 2.91
PF13458Peripla_BP_6 0.97
PF00149Metallophos 0.97
PF06736TMEM175 0.97
PF00107ADH_zinc_N 0.97
PF03480DctP 0.97
PF07992Pyr_redox_2 0.97
PF05050Methyltransf_21 0.97
PF00589Phage_integrase 0.97
PF13808DDE_Tnp_1_assoc 0.97
PF00004AAA 0.97
PF00990GGDEF 0.97
PF00574CLP_protease 0.97
PF13683rve_3 0.97
PF13649Methyltransf_25 0.97
PF00069Pkinase 0.97
PF13531SBP_bac_11 0.97
PF09955DUF2189 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 4.85
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.88
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.91
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.94
COG0740ATP-dependent protease ClpP, protease subunitPosttranslational modification, protein turnover, chaperones [O] 1.94
COG1030Membrane-bound serine protease NfeD, ClpP classPosttranslational modification, protein turnover, chaperones [O] 0.97
COG3548Uncharacterized membrane proteinFunction unknown [S] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.20 %
UnclassifiedrootN/A6.80 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725001|GPWNP_F5MPXY301A29L9All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei518Open in IMG/M
2170459006|GBPF9FW01AT01KAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales500Open in IMG/M
2189573005|GZGK9D402HO52BAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49534Open in IMG/M
3300001141|JGI12638J13249_102757All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria626Open in IMG/M
3300001143|JGI12687J13287_101273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria746Open in IMG/M
3300001204|JGI12652J13314_100904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria771Open in IMG/M
3300001394|JGI20191J14862_1024676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1002Open in IMG/M
3300001867|JGI12627J18819_10301019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria646Open in IMG/M
3300001867|JGI12627J18819_10310843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria635Open in IMG/M
3300002568|C688J35102_119293147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria668Open in IMG/M
3300002910|JGI25615J43890_1046847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria708Open in IMG/M
3300003704|Ga0008088_102340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49611Open in IMG/M
3300003710|Ga0008089_101152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49570Open in IMG/M
3300004471|Ga0068965_1318379All Organisms → cellular organisms → Bacteria → Proteobacteria580Open in IMG/M
3300004593|Ga0068946_1000080All Organisms → cellular organisms → Bacteria → Proteobacteria709Open in IMG/M
3300004615|Ga0068926_1407327All Organisms → cellular organisms → Bacteria → Proteobacteria585Open in IMG/M
3300004964|Ga0072331_1164619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria595Open in IMG/M
3300005186|Ga0066676_10049048All Organisms → cellular organisms → Bacteria2391Open in IMG/M
3300005332|Ga0066388_101345817All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300005434|Ga0070709_10344577All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300005468|Ga0070707_101095223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales762Open in IMG/M
3300005786|Ga0078433_112564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei621Open in IMG/M
3300005938|Ga0066795_10216545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales568Open in IMG/M
3300006172|Ga0075018_10016849All Organisms → cellular organisms → Bacteria2784Open in IMG/M
3300006354|Ga0075021_10727232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49638Open in IMG/M
3300006572|Ga0074051_11390332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria594Open in IMG/M
3300006640|Ga0075527_10050660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C491120Open in IMG/M
3300006852|Ga0075433_10928832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei759Open in IMG/M
3300006864|Ga0066797_1040463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1642Open in IMG/M
3300007255|Ga0099791_10009958All Organisms → cellular organisms → Bacteria3961Open in IMG/M
3300007258|Ga0099793_10471922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49622Open in IMG/M
3300009030|Ga0114950_11140068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49608Open in IMG/M
3300009143|Ga0099792_10103060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C491502Open in IMG/M
3300009524|Ga0116225_1299493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49718Open in IMG/M
3300009528|Ga0114920_10919482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria599Open in IMG/M
3300009529|Ga0114919_10593697Not Available759Open in IMG/M
3300010159|Ga0099796_10020191Not Available2032Open in IMG/M
3300010234|Ga0136261_1086631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49674Open in IMG/M
3300010379|Ga0136449_100590813All Organisms → cellular organisms → Bacteria1896Open in IMG/M
3300010379|Ga0136449_104473353All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300010859|Ga0126352_1077943All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales581Open in IMG/M
3300011080|Ga0138568_1025450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria563Open in IMG/M
3300011107|Ga0151490_1054675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49515Open in IMG/M
3300011118|Ga0114922_10051687All Organisms → cellular organisms → Bacteria3587Open in IMG/M
3300011270|Ga0137391_10655914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49875Open in IMG/M
3300012096|Ga0137389_11130353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei671Open in IMG/M
3300012156|Ga0153920_1075171All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales623Open in IMG/M
3300012202|Ga0137363_11709634Not Available522Open in IMG/M
3300012205|Ga0137362_10248399All Organisms → cellular organisms → Bacteria1537Open in IMG/M
3300012354|Ga0137366_10258901All Organisms → cellular organisms → Bacteria → Proteobacteria1288Open in IMG/M
3300012356|Ga0137371_10567878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales873Open in IMG/M
3300012361|Ga0137360_11023315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49713Open in IMG/M
3300012404|Ga0134024_1233008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49628Open in IMG/M
3300012406|Ga0134053_1271601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300012925|Ga0137419_10854744Not Available747Open in IMG/M
3300012989|Ga0164305_11142986Not Available671Open in IMG/M
3300013080|Ga0153913_1285506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49588Open in IMG/M
3300014152|Ga0181533_1343411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300014493|Ga0182016_10013291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7803Open in IMG/M
3300014501|Ga0182024_11671111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49719Open in IMG/M
3300016294|Ga0182041_11878727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales556Open in IMG/M
3300017925|Ga0187856_1114522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1053Open in IMG/M
3300019263|Ga0184647_1117913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49618Open in IMG/M
3300019284|Ga0187797_1717519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1544Open in IMG/M
3300021082|Ga0210380_10408723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei621Open in IMG/M
3300022220|Ga0224513_10437906Not Available530Open in IMG/M
3300022413|Ga0224508_10642118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales653Open in IMG/M
3300023101|Ga0224557_1005423All Organisms → cellular organisms → Bacteria8932Open in IMG/M
3300024433|Ga0209986_10055482All Organisms → cellular organisms → Bacteria2320Open in IMG/M
3300025906|Ga0207699_10275590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1167Open in IMG/M
3300026088|Ga0207641_12067153All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300026352|Ga0210107_1069673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49565Open in IMG/M
3300026514|Ga0257168_1114594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei600Open in IMG/M
3300026551|Ga0209648_10103566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2327Open in IMG/M
3300026817|Ga0207775_117663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49537Open in IMG/M
3300027043|Ga0207800_1055598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49524Open in IMG/M
3300027502|Ga0209622_1059184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria696Open in IMG/M
3300027758|Ga0209379_10263595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49583Open in IMG/M
3300027846|Ga0209180_10572490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii627Open in IMG/M
(restricted) 3300027872|Ga0255058_10567087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49555Open in IMG/M
(restricted) 3300027997|Ga0255057_10100798All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1396Open in IMG/M
3300031226|Ga0307497_10110770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1085Open in IMG/M
3300031505|Ga0308150_1036369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49567Open in IMG/M
3300031544|Ga0318534_10534619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria668Open in IMG/M
3300031546|Ga0318538_10424774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria719Open in IMG/M
3300031668|Ga0318542_10659672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales546Open in IMG/M
3300031719|Ga0306917_11129950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium609Open in IMG/M
3300031777|Ga0318543_10514765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales536Open in IMG/M
3300031894|Ga0318522_10349028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales560Open in IMG/M
3300031912|Ga0306921_11498081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium737Open in IMG/M
3300031942|Ga0310916_11122497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria652Open in IMG/M
3300031946|Ga0310910_11455659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300031962|Ga0307479_10938287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49836Open in IMG/M
3300032076|Ga0306924_11984095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria600Open in IMG/M
3300032132|Ga0315336_1260312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49603Open in IMG/M
3300032160|Ga0311301_11342627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria899Open in IMG/M
3300032173|Ga0315268_11929308All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300032272|Ga0316189_10833609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria700Open in IMG/M
3300034065|Ga0334827_210190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium580Open in IMG/M
3300034643|Ga0370545_084457All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum669Open in IMG/M
3300034659|Ga0314780_137011All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300034661|Ga0314782_135605All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium591Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.62%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.74%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.83%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.91%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.94%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.94%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater1.94%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.94%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.94%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.94%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil1.94%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.97%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.97%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.97%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.97%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.97%
SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Sediment0.97%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.97%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.97%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.97%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.97%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.97%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.97%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.97%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.97%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.97%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.97%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.97%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.97%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.97%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725001Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
2170459006Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cmEnvironmentalOpen in IMG/M
2189573005Grass soil microbial communities from Rothamsted Park, UK - FG3 (Nitrogen)EnvironmentalOpen in IMG/M
3300001141Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2EnvironmentalOpen in IMG/M
3300001143Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1EnvironmentalOpen in IMG/M
3300001204Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3EnvironmentalOpen in IMG/M
3300001394Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002910Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cmEnvironmentalOpen in IMG/M
3300003704Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003710Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004471Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004593Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 34 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004615Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004964Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005786Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IEnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006640Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11BEnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009030Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009528Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaGEnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010234Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011080Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012156Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ004 MetaGHost-AssociatedOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012404Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012406Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013080Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300022220Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21EnvironmentalOpen in IMG/M
3300022413Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300024433Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026352Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026817Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 17 (SPAdes)EnvironmentalOpen in IMG/M
3300027043Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027758Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027872 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9EnvironmentalOpen in IMG/M
3300027997 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031505Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_139 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032132Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #5EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M
3300034643Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GPWNP_015728102067725001SoilMPVERRERAIAIGSGSTGNGRNPDVQWKAAGFVRWHEPDDARVSSPDL
L01_082101902170459006Grass SoilGSGVMPAERRERAIAVELGSIGHTGRNPNVQRKAAAFARWHEPDDARVSSPDL
FG3_101085102189573005Grass SoilMPVERRGWVIALEIGSTGNGRNPDIQWKAAAFVRWHEPDDARVSSPD
JGI12638J13249_10275733300001141Forest SoilMPVERRGQAIAIWLGSTGVGSNRHQEEPDVQWKAAAFVRWHEPDDARVSSP
JGI12687J13287_10127333300001143Forest SoilMPVERRGQAIAIWLGSTGAGSNRHQEEPDVQWKAAAFVRWHEPDDARVSSPDL*EARGEIPRAYSA
JGI12652J13314_10090413300001204Forest SoilMPVERRGQAIAIWLGSTGAGSNRHQEEPDVQWKAAAFVRWHEPDDARVSSPDL*EAXGEIPRAYSA
JGI20191J14862_102467613300001394Arctic Peat SoilSGVMPVERRGRVIAVESGQLGQTGRSPTFQRKTAALVRWHEPDDARVSSPDL*
JGI12627J18819_1030101923300001867Forest SoilVERRERVIAICIGSTGNGRNPVYKWKAAAFVRWHEPDDARVSSP
JGI12627J18819_1031084333300001867Forest SoilMPVERRGQAIAIWLGSTGVGSNRHQEEPDVQWKAAAFVRWHEPDDARVSSPD
C688J35102_11929314713300002568SoilMPVERRGQAIAIWLGSTGVGSNRHQEEPDVQWKAAAFVRRHEPDDARVSSPDL*
JGI25615J43890_104684723300002910Grasslands SoilMPVERRGQAIAIWLGSTGVGSNRHQEEPDVQWKAAAFVRWHEPDDARVSSPDL*
Ga0008088_10234023300003704Tropical Rainforest SoilMPMERRGWVIVVERGPTGSTGRSPQFQRKAAAFVRWHEPDDARVSRPESVRGS
Ga0008089_10115223300003710Tropical Rainforest SoilMPMERRGWVIVVERGPTGSTGRSPQFQRKAAAFVRWHEPDDA
Ga0068965_131837913300004471Peatlands SoilMPVERRGRVIAVELGPTGLYPGRSPKFRRKAAAFVRWHEPDDARVSSP
Ga0068946_100008033300004593Peatlands SoilMPVERRGRVIAVERGPTGLYPGRSPKFRQKAAAFVRWHEPDDARVS
Ga0068926_140732733300004615Peatlands SoilMPVERRGRVIAVELGPTGLYPGRSPKFRRKAAAFVRWHEPDDAR
Ga0072331_116461933300004964Peatlands SoilMPVEQRGQVIAVELGPTGHAGRSPKVQREAAAFVRWHEPDDARVSSP
Ga0066676_1004904813300005186SoilMPVEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDDARVS
Ga0066388_10134581713300005332Tropical Forest SoilGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDDARVSRPDL*
Ga0070709_1034457713300005434Corn, Switchgrass And Miscanthus RhizosphereMPVERSEQVIAVEIGSTGNGRSPIFKWKAAAFKRWHEPDDARVSSPESVRDSG*
Ga0070707_10109522323300005468Corn, Switchgrass And Miscanthus RhizosphereMPVERRGQAIAIWLGSTGVGSNRHQEEPDVQWKAAAFARWHEPDDARVSSPDL*
Ga0078433_11256413300005786SedimentEGSVMGLERRVQVIAVELGPTGHAGRSPMVQRKAAAFV*
Ga0066795_1021654523300005938SoilMPVERRGRVIAVELGQLGQTGRSPTFQRKAAALVRWHEPDDARVSSP
Ga0075018_1001684913300006172WatershedsVMPVERRGWVIAFEIGSTGNEEPDIQWKAAAFVRWHEPDDARVSSPDL*
Ga0075021_1072723233300006354WatershedsRSGVMPVEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDDARVSRPDL*
Ga0074051_1139033213300006572SoilVERREQAIAVELGSTGSTGRNPNLRRKAAAFVRWHEPD
Ga0075527_1005066013300006640Arctic Peat SoilRGRVIAVESGQLGQTGRSPTFQRKAAALVRWHEPDDARVSSPDL*
Ga0075433_1092883213300006852Populus RhizosphereVMPVERREQAIAIWIGVNRQREDPDIQWKAAAFVRWHEPDDARVSRPDL*
Ga0066797_104046333300006864SoilMGWVIAVELGQLGQTGRSPTFQRKAAALVRWHEPDDARVSSPDL*
Ga0099791_1000995853300007255Vadose Zone SoilMPVEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWREPDDARVSRPDL*
Ga0099793_1047192213300007258Vadose Zone SoilMPVEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDDARVSSPESVR
Ga0114950_1114006813300009030Deep SubsurfaceSDEASVMLVERRGRVIVVERGPTGYAGRSPMVQRKAAAFVRWHEPDDARVSCPDL*
Ga0099792_1010306013300009143Vadose Zone SoilMPVEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDDARVSRPDL*
Ga0116225_129949313300009524Peatlands SoilMLAERRGQVIAVELGPTGYAGRSPKVQRKAAAFERWHEPDDARVSSP
Ga0114920_1091948213300009528Deep SubsurfaceMELERRGQVIVIGLGPTGYAGRSPLVQWKAAAFVRWHEPYDARVS
Ga0114919_1059369713300009529Deep SubsurfaceMGLERRGRVIVAGLGPTGHAGRSPLVQWKAAAFVR
Ga0099796_1002019133300010159Vadose Zone SoilMLVERRGRVIAVELGPTGGTGRSPKVQRKAAAFARWHEPDDA
Ga0136261_108663123300010234FreshwaterMELERRGRVIAVGLGPTGYAGRSPLVQRKAVAFVRWHEPDDARA
Ga0136449_10059081323300010379Peatlands SoilVMPVEQRGRVIAVELGPTGSNQEELEIQRKAAAFVR*
Ga0136449_10447335323300010379Peatlands SoilMPVEQRGRVIAVELGPTGSNQEEPELQRKAAAFVR*
Ga0126352_107794313300010859Boreal Forest SoilMPVERREQVIAVSSGQPDHTGRSPNVQGKAAAFMRWHEPDDARVS
Ga0138568_102545023300011080Peatlands SoilVERRGQVIAVELGPTGLYPGRSPNVQRKAAAFVRWHEP
Ga0151490_105467513300011107SoilGVMLVERRGRVIAVELGPTGGARRSPKVQRKAAAFARWHEPDDARVSSPDL*
Ga0114922_1005168733300011118Deep SubsurfaceMELERRGQVIVVGLGPTGHAGRSPPAQRKAAAFVRW
Ga0137391_1065591413300011270Vadose Zone SoilRGRVIAVELGPTGGAGRSPKVQRKAAAFARWHEPDDARVSSPDL*
Ga0137389_1113035323300012096Vadose Zone SoilGQVIAVEHGPTGLNREEPEVQRKAAAFALWHEPDDARVSRPDL*
Ga0153920_107517113300012156Attine Ant Fungus GardensVERRERVIAIYIGSTGNGRNPVYKWKAAAFVRWHEPDDARVSSPDL*
Ga0137363_1170963413300012202Vadose Zone SoilMPVERRGWVIAVELGPTGGARRSPKVQRKAAAFARW
Ga0137362_1024839913300012205Vadose Zone SoilMPVERRGWVIAVELGPTGGARRSPKVQRKAAAFARWHEPDDARVSSPDL
Ga0137366_1025890113300012354Vadose Zone SoilGVMLVERRGRVIAVELGPTGGAGRSPKVQRKAAAFAR*
Ga0137371_1056787823300012356Vadose Zone SoilERVTAIWLGSTGNGREPDVQWRAAAFTRWHEPDDARVSSPDL*
Ga0137360_1102331523300012361Vadose Zone SoilPVERRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDDERVSRPDL*
Ga0134024_123300813300012404Grasslands SoilMLVERRGRVIAVELGPTGGAGRSPKVQRKAAAFVR
Ga0134053_127160113300012406Grasslands SoilVERRGRVIAVELGPTGGAGRSPKVQRKAAAFARWH
Ga0137419_1085474413300012925Vadose Zone SoilMLVERRGRVIAVELGPTGGTGRSPKVQRKAAAFARWHEPD
Ga0164305_1114298623300012989SoilMLVERRGRVIAVELGPTGGAGRSPKVQRKAAAFARWHE
Ga0153913_128550613300013080Freshwater WetlandsMGLERRGRVIAVEPEPTGACRDEPVVQRKAAAFVRWHEPYDARVSR
Ga0181533_134341113300014152BogMPVERRGRVIAVESGQLGQTGRSPTLQRKAAAFVRWH
Ga0182016_1001329183300014493BogMLVERRGQVIAVEIGPTGHAGRGPTVQRKAAAFVRWHEPDDARVSSPVL*
Ga0182024_1167111113300014501PermafrostMLAERRGQVIAVELGPTGYAGRSPKVQRKAAAFERWHEPDDARVSS
Ga0182041_1187872713300016294SoilMPVERREQVIAVRAGQPDHTGRSPNVQRKAAAFMRWHEPDD
Ga0187856_111452223300017925PeatlandMLVERRGQVIAVEIGPTGYAGRSPTVQRKAAAFVRWHEPDDARVS
Ga0184647_111791323300019263Groundwater SedimentVERREQAIAIWLGSTGYGRNPVFNGKAAAFVRWHEPDDARVSSP
Ga0187797_171751913300019284PeatlandPVERREQAIAVELGSTGSTGRNPNLRRKAAAFVRWHEPDDARVSSPDL
Ga0210380_1040872313300021082Groundwater SedimentVERREQAIAIWLGSTGYGRNPVFNGKAAAFVRWHEPDDARVSS
Ga0224513_1043790613300022220SedimentMGLERRGRVIVAGLGPTGHAGRSPLVQWKAAAFVRWQEPDDA
Ga0224508_1064211813300022413SedimentMLVERRGRVIAVERGPTGYAGRSPIVRQKAAAFVRWHEPDDVRVSSPDLWAAGG
Ga0224557_100542383300023101SoilMLVERRGQVIAVEIGPTGHAGRGPTVQRKAAAFVRWHEPDDARVSSPVL
Ga0209986_1005548213300024433Deep SubsurfaceMGLERRGRVIVAGLGPTGHAGRSPLVQWKAAAFVRSQE
Ga0207699_1027559023300025906Corn, Switchgrass And Miscanthus RhizosphereMPVERSEQVIAVEIGSTGNGRSPIFKWKAAAFKRWHEPDDARVSSPESVRDSG
Ga0207641_1206715313300026088Switchgrass RhizosphereMLVERRGRVIAVELGPTGGARRSPKVQRKAAAFVRWHEPDDARVSS
Ga0210107_106967313300026352Natural And Restored WetlandsMGLERRGRVIVTGLGPTGHAGRSPLVQWKAAAFVRWQEPDDARVSSPDVRPAKAGM
Ga0257168_111459413300026514SoilVEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDEARVSRPDV
Ga0209648_1010356613300026551Grasslands SoilMPVEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDDARVSRPDL
Ga0207775_11766313300026817Tropical Forest SoilVERREQAIAVELGSTGSTGRNPNLRRKAAAFVRWHEPDDARVSSP
Ga0207800_105559823300027043Tropical Forest SoilVERREQAIAVELGSTGSTGRNPNLRRKAAAFVRWHEPDDARVSSPD
Ga0209622_105918413300027502Forest SoilMPVERRGQAIAIWLGSTGAGSNRHQEEPDVQWKAAAFVRWHEPDDARVSSP
Ga0209379_1026359513300027758Marine SedimentMGLERRGRVIAVELGPTGHAGRSPLVQRKAAAFVR
Ga0209180_1057249023300027846Vadose Zone SoilVEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDD
(restricted) Ga0255058_1056708713300027872SeawaterMELERRGQVIVIGLGPTGYAGRSPLVQWKAAAFVRWHEPYDARVSRTVLRG
(restricted) Ga0255057_1010079813300027997SeawaterVLERRGQVIAVELGPTGYAGRSPLVQRKAAAFMRWHEPDDAR
Ga0307497_1011077023300031226SoilEAGVMLVERRGRVIAVELGPTGGARRSPKVQRKAAAFARWHEPDDARVSSPDL
Ga0308150_103636923300031505SoilLERRGRVIAVELGPTGGAGRSPKVQRKAAAFARWHEPDDA
Ga0318534_1053461913300031544SoilMPVEQREQVIAASAGQPDHTGRSPNVQRKAAAFMRWHEPDDARVSRPD
Ga0318538_1042477423300031546SoilMPVEQREQVIAASSGQPDHTGRSPNVQRKAAAFMRWHEPDDARVSRP
Ga0318542_1065967213300031668SoilVEQREQVIAASAGQPDHTGRSPNVQRKAAAFMRWHEPDDAR
Ga0306917_1112995013300031719SoilMPAERRERAIAVELGSTGHTGRNPNVQRKAAAFMRWHEPDD
Ga0318543_1051476513300031777SoilMPVEQREQVIAASSGQPDHTGRSPNVQRKAAAFMRWHEPD
Ga0318522_1034902813300031894SoilMPVERREQVIAASSGQPDHTGRSPNVQRKAAAFMRWHE
Ga0306921_1149808113300031912SoilEIGSTGNGRNPIFNWKAAAFARWHEPDDARVSSPDL
Ga0310916_1112249713300031942SoilVERRERAIAICWVNRQREEPDVQWKAAGFVRWHEPDDARVSSPVVCPAK
Ga0310910_1145565913300031946SoilVERREQVIAVRAGQPDHTGRSPHVQRKVAAFMRWHEP
Ga0307479_1093828723300031962Hardwood Forest SoilVERRERVIAICIGSTGNGRNPVYKWKAAAFVRWHEPDDARV
Ga0310911_1062514013300032035SoilVERREQVIAVRAGQPDHTGRSPHVQRKAAAFMRWHEPDDARVSRPVVCPGKASMF
Ga0306924_1198409513300032076SoilMPVEQREQVIAASSGQPDHTGRSPNVQRKAAAFMRWHE
Ga0315336_126031213300032132SeawaterMELERRGRVIAVERGSTGHAGRNPMVRRKAAAFVRWHEPDDARVSSP
Ga0311301_1134262713300032160Peatlands SoilMPVEQRGRVIAVELGPTGSNQEEPELQRKAAAFVR
Ga0315268_1192930823300032173SedimentIAVELGPTGGARRSPKVQRKAAAFARWHEPDDARVSSPDL
Ga0316189_1083360913300032272Worm BurrowMELERRGRVIVVELGPTGHAGRSPPAQRKAAAFVRWHEPYDARV
Ga0334827_210190_439_5793300034065SoilMLVERRGQVIAVEIGPTGHAGRGPTVQRKAAAFVRWHEPDDARVSSP
Ga0370545_084457_3_1073300034643SoilMLVERWGRVTAVEHGSTGFGQEEPEAQRKAAAFAR
Ga0314780_137011_1_1353300034659SoilMERRERAIAIWLGSTGDGRNPMFKRKAAAFVRWHEPDDARVSSPD
Ga0314782_135605_3_1343300034661SoilMERRERAIAIWLGSTGDGRNPMFKRKAAAFVRWHEPDDARVSSP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.