NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099391

Metagenome / Metatranscriptome Family F099391

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099391
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 92 residues
Representative Sequence MGCFPLNDSEILIFGGDYGWISDCFTLNTKVGEIERMECSLKKPEEFFRAQPVRYNDKVFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW
Number of Associated Samples 94
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 52.43 %
% of genes near scaffold ends (potentially truncated) 21.36 %
% of genes from short scaffolds (< 2000 bps) 93.20 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.71

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.087 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(12.621 % of family members)
Environment Ontology (ENVO) Unclassified
(38.835 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(39.806 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 2.56%    β-sheet: 35.04%    Coil/Unstructured: 62.39%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.71
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.68.11.0: automated matchesd2vpja_2vpj0.7333
b.68.11.0: automated matchesd3ii7a_3ii70.72803
b.68.11.1: Kelch motifd1zgka11zgk0.7245
b.69.1.1: Galactose oxidase, central domaind6xlra26xlr0.72206
b.68.11.0: automated matchesd6hrla_6hrl0.72129


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF13415Kelch_3 17.48
PF01344Kelch_1 9.71
PF13418Kelch_4 7.77
PF13964Kelch_6 0.97



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001202|BBAY72_10096728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea889Open in IMG/M
3300001271|BBAY90_17926444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae789Open in IMG/M
3300002835|B570J40625_100278003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1718Open in IMG/M
3300003910|JGI26437J51864_10055055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium854Open in IMG/M
3300004097|Ga0055584_102357971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300004241|Ga0066604_10192083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae814Open in IMG/M
3300005069|Ga0071350_1016273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1816Open in IMG/M
3300005662|Ga0078894_10242308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1635Open in IMG/M
3300005662|Ga0078894_10247555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1616Open in IMG/M
3300005662|Ga0078894_10257438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1582Open in IMG/M
3300005838|Ga0008649_10271752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300005987|Ga0075158_10090795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1773Open in IMG/M
3300006109|Ga0007870_1063916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae713Open in IMG/M
3300006122|Ga0007837_1092757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea509Open in IMG/M
3300006355|Ga0075501_1307771All Organisms → Viruses → Predicted Viral1086Open in IMG/M
3300006394|Ga0075492_1001944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae4260Open in IMG/M
3300006415|Ga0099654_10269649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1669Open in IMG/M
3300006805|Ga0075464_10395506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum839Open in IMG/M
3300006875|Ga0075473_10391043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea562Open in IMG/M
3300007171|Ga0102977_1081485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1820Open in IMG/M
3300007513|Ga0105019_1067375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2062Open in IMG/M
3300007523|Ga0105052_10490514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae796Open in IMG/M
3300007544|Ga0102861_1053762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1048Open in IMG/M
3300007658|Ga0102898_1028537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1246Open in IMG/M
3300007722|Ga0105051_10232467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1404Open in IMG/M
3300007860|Ga0105735_1026350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1072Open in IMG/M
3300007860|Ga0105735_1052817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum804Open in IMG/M
3300008116|Ga0114350_1066512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1246Open in IMG/M
3300008117|Ga0114351_1135230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1380Open in IMG/M
3300008120|Ga0114355_1166911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum758Open in IMG/M
3300008262|Ga0114337_1073229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1686Open in IMG/M
3300008262|Ga0114337_1102779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1330Open in IMG/M
3300008264|Ga0114353_1378489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300008952|Ga0115651_1025713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum5124Open in IMG/M
3300009003|Ga0102813_1233586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300009159|Ga0114978_10211132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1222Open in IMG/M
3300009172|Ga0114995_10072435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1943Open in IMG/M
3300009436|Ga0115008_10593952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum797Open in IMG/M
3300009592|Ga0115101_1357335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1193Open in IMG/M
3300010296|Ga0129348_1151608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum802Open in IMG/M
3300010334|Ga0136644_10652747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea575Open in IMG/M
3300010392|Ga0118731_112790399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1121Open in IMG/M
3300010885|Ga0133913_10830844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2405Open in IMG/M
3300011009|Ga0129318_10157218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300012771|Ga0138270_1186241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea550Open in IMG/M
(restricted) 3300013131|Ga0172373_10139132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1746Open in IMG/M
3300017788|Ga0169931_10324551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1190Open in IMG/M
3300018770|Ga0193530_1078466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum623Open in IMG/M
3300018846|Ga0193253_1047139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1065Open in IMG/M
3300018968|Ga0192894_10111593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum844Open in IMG/M
3300018974|Ga0192873_10333245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300018974|Ga0192873_10386482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum568Open in IMG/M
3300018988|Ga0193275_10164805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum680Open in IMG/M
3300018996|Ga0192916_10075306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea993Open in IMG/M
3300019007|Ga0193196_10180750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum904Open in IMG/M
3300019017|Ga0193569_10366636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300019021|Ga0192982_10241956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea647Open in IMG/M
3300019048|Ga0192981_10158173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum895Open in IMG/M
3300019153|Ga0192975_10104637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1030Open in IMG/M
3300020204|Ga0194116_10561853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea522Open in IMG/M
3300020221|Ga0194127_10942921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea522Open in IMG/M
3300020546|Ga0208853_1055837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300020578|Ga0194129_10440145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea667Open in IMG/M
3300021336|Ga0210307_1360849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1861Open in IMG/M
3300021345|Ga0206688_10253828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300021376|Ga0194130_10114912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1723Open in IMG/M
3300021928|Ga0063134_1033620All Organisms → Viruses → Predicted Viral1355Open in IMG/M
3300024343|Ga0244777_10089514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1984Open in IMG/M
3300024343|Ga0244777_10208275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1252Open in IMG/M
3300024343|Ga0244777_10892798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300025645|Ga0208643_1025027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2036Open in IMG/M
3300025848|Ga0208005_1037984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1490Open in IMG/M
3300025848|Ga0208005_1107144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium873Open in IMG/M
3300027780|Ga0209502_10137462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1190Open in IMG/M
3300027781|Ga0209175_10049270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1792Open in IMG/M
3300027833|Ga0209092_10410573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum707Open in IMG/M
3300027885|Ga0209450_10109685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1847Open in IMG/M
3300029908|Ga0311341_10683057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae573Open in IMG/M
3300030550|Ga0247631_1165243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae545Open in IMG/M
3300030630|Ga0210282_10305701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae563Open in IMG/M
3300030699|Ga0307398_10820694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300030741|Ga0265459_12466177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae639Open in IMG/M
3300030788|Ga0073964_11042468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1543Open in IMG/M
3300030788|Ga0073964_11399738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1120Open in IMG/M
3300030948|Ga0073977_1409608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea758Open in IMG/M
3300031005|Ga0073974_1525785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1553Open in IMG/M
3300031036|Ga0073978_1027521All Organisms → Viruses → Predicted Viral1466Open in IMG/M
3300031113|Ga0138347_10444222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1554Open in IMG/M
3300031211|Ga0307974_1028085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae3035Open in IMG/M
3300031221|Ga0307948_1158889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae643Open in IMG/M
3300031231|Ga0170824_114481926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae775Open in IMG/M
3300031569|Ga0307489_10409935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum904Open in IMG/M
3300031638|Ga0302125_10032642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1821Open in IMG/M
3300031784|Ga0315899_10389611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1358Open in IMG/M
3300032517|Ga0314688_10641693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300032522|Ga0314677_10184813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1049Open in IMG/M
3300032711|Ga0314681_10660944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300032714|Ga0314686_10053334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1620Open in IMG/M
3300032726|Ga0314698_10051107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1560Open in IMG/M
3300032745|Ga0314704_10070226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1611Open in IMG/M
3300033984|Ga0334989_0061442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2071Open in IMG/M
3300034167|Ga0335017_0454558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum685Open in IMG/M
3300034355|Ga0335039_0097470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1709Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.62%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine12.62%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.80%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.80%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton5.83%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.85%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.91%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.91%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.94%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.94%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.94%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.94%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.94%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.94%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface1.94%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent1.94%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.97%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.97%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.97%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.97%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.97%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.97%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.97%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.97%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.97%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.97%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.97%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001202Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY72Host-AssociatedOpen in IMG/M
3300001271Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY90Host-AssociatedOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003910Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LWEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004241Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11EnvironmentalOpen in IMG/M
3300005069Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300006109Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08EnvironmentalOpen in IMG/M
3300006122Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07EnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007523Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03EnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007658Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3EnvironmentalOpen in IMG/M
3300007722Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300007860Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3umEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008264Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTREnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011009Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNAEnvironmentalOpen in IMG/M
3300012771Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300020204Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surfaceEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020546Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300030550Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030630Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031005Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031113Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031211Saline water microbial communities from Organic Lake, Antarctica - #784EnvironmentalOpen in IMG/M
3300031221Saline water microbial communities from Organic Lake, Antarctica - #280EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032726Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034167Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BBAY72_1009672813300001202Macroalgal SurfaceVAPRDTLGSFALSESEILIFGGDYGWISDVFTLNTKNQEIIKMDAPLKKPEDFFLHNIKFNDKIFSIGSLDKDVHVFSIKVKKWFMLEDGSLTGEITIINL*
BBAY90_1792644423300001271Macroalgal SurfaceQWSARDTLGSFALNESDILVFGGDYGWISDCFMIQTKTNEISKFDCSLKKPEDFFRSQPVKYNDKVFCVGHLDKDVHVYSIKAKKWFLLDKWFVEW*
B570J40625_10027800333300002835FreshwaterMGSFSLNDSEILIFGGDYGWISDCFQLNTKSGEIERVECSLRKPEDFFRSHPVRYNDKVFVVGCLDRDVHVFLPKAKKWFLLDKWYVDW*
JGI26437J51864_1005505513300003910Freshwater Lake SedimentMGCFPLNDSEILIFGGDYGWISDCFTLNTKVGEIERMDCSLKKPEEFFRAQPVRYNDKIFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW*
Ga0055584_10235797113300004097Pelagic MarineMWSPRDTIGSFALNDSEILIFGGDYGWISDCFTLNTKSGEIERMDCSLRKPEDFFRSHPVRYNDKVFVVGCLDKDVHVFLPKAKKWFLLDRWYIDW*
Ga0066604_1019208323300004241FreshwaterMDARDTLGSFALNDTEILIFGGDYGWISDCFVFNTKNNEIAKQDATLKKPEEFFRSNAVRYNDKVFVVGNLDKDVHVFSIKANKWFMMTSGLLTGDHMDEYY*
Ga0071350_101627343300005069FreshwaterVNRENNWSARDTMGCFPLNDSEILIFGGDYGWISDCFTLNTKVGEIERMDCSLKKPEEFFRAQPVRYNDKIFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW*
Ga0078894_1024230813300005662Freshwater LakeLINKDQQWSARDTVGSFALKDDSEILIFGGDYGWISDCFVFNAKTNEIVKHDATLKKPEEFFRSQPVRYNEKVFVVGNLDKDVHVFSVKAQKWFMLDKWFVDW*
Ga0078894_1024755513300005662Freshwater LakeLANKDNQWSSRDTMGSFTLNESEVLIFGGDQGWISDCFSFNTKSCEIERLECSLKKPEEFFKSSPVHYNDKVFVVGCLDKDVHVFTPKVKKWFLLEKWFVDW*
Ga0078894_1025743863300005662Freshwater LakeLIFGGDQGWISDCFSFNSKTNEIERQECPLKKPEEFFRCKPVHYNDKVFVVGCLDKDVHVYTPKAKKWFLLEKWFVDW*
Ga0008649_1027175223300005838MarineMWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNTKTNEIHRMNECSLKKPEEFFRAQPVKYNEKVFVVGCLDKDLHVFSIKAQKWFLLEKWYVDW*
Ga0075158_1009079553300005987Wastewater EffluentMHWTPRDTLGSFALSDSEILIFGGDYGWISDCFTFNVKSNEIHKCECTLKKPEEFFRSQAVKYNDKVFVIGNLDKDVHVYSLKAQKWFLLDKWFIEW*
Ga0007870_106391613300006109FreshwaterVGSFALRDDSEILIFGGDYGWISDCFVFNAKTNEIVKHDATLKKPEEFFRSQPVRYNEKVFVVGNLDKDVHVFSVKA*
Ga0007837_109275713300006122FreshwaterVGSFALRDDSEILIFGGDYGLISDCFVFNAKTNEIVKHDATLKKPEEFFRSQPVRYNEKVFVVGNLDKDVHVFSVKA*
Ga0075501_130777133300006355AqueousMLQVVNKDSMWSPRDTIGSFALNDSEILVFGGDYGWISDCFTLNTKSGEIERMDCSLRKPEDFFRSHPVRYNDKVFVVGCLDKDVHVFLPKAKKWFLLDRWFVDW*
Ga0075492_100194433300006394AqueousMGSFSLSDSEILIFGGDYGWISDSFCLNTKSGEIERLDCSLKKPEEFFHSKAVRYNDKIFTIGCLDKDVHVFLPKAKKWFLLDKWFVDW*
Ga0099654_1026964933300006415LakeMIQIVNKDSKWSPRDTMGSFSLNDSEILIFGGDYGWISDCFQLNTKSGEIERVECSLRKPEDFFRSHPVRYNDKVFVVGCLDRDVHVFLPKAKKWFLLDKWYVDW*
Ga0075464_1039550623300006805AqueousLIFGGDQGWISDCYCYNTKSNEIEKLDCSLKKPEEFYRANPVQYNDKVFVAGCLDHDVHVFTPKAKKWFLLEKWFVDW*
Ga0075473_1039104313300006875AqueousLIFGGDQGWISDCFSFNIKTNEIEKDECPLKKPEEFFRAKPVHYNNKVYVVGCLDKDVHVYAPKVNKWFLLEKWFVDW*
Ga0102977_108148513300007171Freshwater LakeMGCFPLNDSEILIFGGDYGWISDCFTLNTKVGEIERMDCSLKKPEEFFRSQPVRYNDKVFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW*
Ga0105019_106737523300007513MarineMWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNTKTNEIKRMGECSLKKPEEFFRSQPVRYNEKIFVVGCLDKDLHVFSIKAQKWFLLEKWYVDW*
Ga0105052_1049051413300007523FreshwaterMIFGGDYGWISDCFVFNTKTNEITKHESTLRKPEEFFRSQPVRYKDKVFVVGNLDKDVHVYSHKAQKWFMLDKWYVDW*
Ga0102861_105376223300007544EstuarineLNLINKDTQWTPRDTIGSFTLGDGEILIFGGDQGWISDCFSFNSKTNEIERQDCPLKKPEEFFRANPVHYNDKVFVVGCLDKDVHVYTPKVKKWFLLEKWFVDW*
Ga0102898_102853723300007658EstuarineVNRDNNWSARDTMGCFALNDSEILIFGGDYGWISDCFTLNTKIGEIERMDCSLKKPEEFFRAQPVRYNDKVFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW*
Ga0105051_1023246743300007722FreshwaterMIFGGDYGWISDCFVFNTKTNEITKHESTLRKPEEFFRSQPVRYNDKVFVVGNLDKDVHVYSHKAQKWFMLDKWYVDW*
Ga0105735_102635023300007860Estuary WaterLIFGGDQGWISDCYSFNPKINEIEKMDCSLKKPEEFFRSKAVFYNEKVYVVGCLDRDIHVYSPKVKKWFLLDKWFVDW*
Ga0105735_105281713300007860Estuary WaterMGSFTLNESEVLIFGGDQGWISDCFSFNTKSCEIERLECSLKKPEEFFKSSPVHYNDKVFVVGCLDKDVHVFTPKVKKWFLLEKWFVDW*
Ga0114350_106651213300008116Freshwater, PlanktonLSDSEILIFGGDQGWISDCFNFNPKSNEIERMDCTLKKPEEFFRAHPVHYNEKVFVVGCLDRDVHVFTPKAKKWFLLEKWFVNW*
Ga0114351_113523013300008117Freshwater, PlanktonMWSPRDTIGSFALNDSEILIFGGDYGWISDCFTLNTKSGEIERMECSLRKPEDFFRSHAVKYNDKVFVVGCLDKDVHVFLPKAKKWFLLDRWYIDW*
Ga0114355_116691113300008120Freshwater, PlanktonLIFGGDQGWISDCFNFNPKSNEIERMDCTLKKPEEFFRAHPVHYNEKVFVVGCLDRDVHVFTPKAKKWFLLEKWFVNW*
Ga0114337_107322953300008262Freshwater, PlanktonLIFGRDQGWISDCFSFNSKTNEIERQECPLKKPEEFFRCKPVHYNDKVFVVGCLDKDVHVYTPKAKKWFLLEKWFVDW*
Ga0114337_110277923300008262Freshwater, PlanktonWELLEIANKDNQWSARDTIGSFAISDSEMMIFGGDQGWISDCFKYSPKTNEIERLECSLKKPEEFFGAKPVHHNDKVYVVGCLDRDVHVYSGKQKKWFLLEKWFIDW*
Ga0114353_137848913300008264Freshwater, PlanktonVIFVNRENNWSARDTMGCFPLNDSEILIFGGDYGWISDCFTLNTKVGEIERMDCSLKKPEEFFRAQPVRYNDKIFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW*
Ga0115651_102571313300008952MarineMWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNTKTNEIKRMGECSLKKPEEFFRAQPVRYNEKIFVVGCLDKDLHVFSIKA*
Ga0102813_123358613300009003EstuarineMWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNTKTNEIHRMNECSLKKPEEFFRAQPVKYNEKVFVVGCLDKDLHVFSIKA*
Ga0114978_1021113223300009159Freshwater LakeLWSARDTIGSFALGDSEILIFGGDNGWISDCYSFNTKTNEIERQECSLKKPEDFFRSHSVKYNDKVFIVGCLDRDVHVFTPKKKKWFLLEKWFVDW*
Ga0114995_1007243523300009172MarineLIYGGDYGWISDCFNFNTKTNVITRMEQCSLKKPEEFFRSQPVKYNEKVFVVGCLDKDLHVFSTKAKKWFLLEKWYIEW*
Ga0115008_1059395223300009436MarineMWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNIKTNEIHRMNECSLKKPEEFFRSQPVKYNEKVFVTGCLDKDVHVFSIK
Ga0115101_135733533300009592MarineMWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNTKTNEIQRMGECSLKKPEEFFRAQPVRYNEKVFVVGCLDKDLHVFSIKA*
Ga0129348_115160823300010296Freshwater To Marine Saline GradientVNRENNWSARDTMGCFPLNDSEILIFGGDYGWISDCFTLNTKVGEIERMDCSLKKPEEFFRAQPVRYNDKVFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW*
Ga0136644_1065274713300010334Freshwater LakeMGSFTLNESEVLIFGGDQGWISDCYSFNTKSCEIERLECSLKKPEEFFKSSPVHYNDKVFVVGCLDKDVHVFTPKVKKWFLLEKWFVDW*
Ga0118731_11279039933300010392MarineVVVKDGGWSPRDTLGSFALNDSEILLFGGEYGWISDCYLLQTKNNNEVSKLDCTLKKPEEFYHSQPVKYNDKIFVVGGMDQDVHVYSIKARKWFLMDKWFIDW*
Ga0133913_1083084413300010885Freshwater LakeSNQKWELLQIVNREGHWTARDTMGSFTFNESEVLIFGGDQGWISDCFSFNTKTNEIERMECSLKKPEEFFKSCPVHYNDKVFVVGCLDKDVHVFTPKVKKWFLLDKWFVDW*
Ga0129318_1015721823300011009Freshwater To Marine Saline GradientMGSFTFNESEVLIFGGDQGWISDCFSFNTKTNEIERLECPLKKPEEFFKSSPVHYNDKVFVVGCLDKDVHVFTPKVKKWFLLEKWFVDW*
Ga0138270_118624123300012771Freshwater LakeMGSFTLNESEVLIFGGDQGWISDCYSFNTKSCEIERLECSLKKPEEFFKSSPVHYNDKVFVVGCLDKDVHVFTPKVKKWFLLEKWFVD
(restricted) Ga0172373_1013913243300013131FreshwaterVPLINKDQQWSARDTLGSFSLFDDSEIMIFGGDYGWISDCFVFNTKTNEITKHESTLRKPEEFFRSQPVRYNDKVFVVGNLDKDVHVYSHKAQKWFMLDKWYIDW*
Ga0169931_1032455123300017788FreshwaterMWSPRDTIGSFALNDSEILIFGRDYGWISDCFTLNTKSGEIERMECSLRKPEDFFRSHAVKYNDKVFVVGCLDKDVHVFLPKAKKWFLLDRWYIDW
Ga0193530_107846613300018770MarineMGCFPLNNEEIFIFGGDYGWISDCFTFNTKTNEIERNECSLKKPEEFFRAQPVEYNKKVFVVGCIDKDVHVYLPKAKKWFLLDKWYVDWXSHLFP
Ga0193253_104713913300018846MarineMWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNTKTNEIQRMGECSLKKPEEFFRAQPVRYNEKVFVVGCLDKDLHVFSIKA
Ga0192894_1011159313300018968MarineMWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNTKTNEIKRMGECSLKKPEEFFRAQPVRYNEKIFVVGCLDKDLHVFSIKA
Ga0192873_1033324513300018974MarineMGSFALNDSEILVFGGDYGWISDCFTLNTKSGEMERMECSLKKPEEFFRAQPVRYNDKIFVVGCLDKDVHVYQPKGRKWFLLDKWYVDW
Ga0192873_1038648213300018974MarineEKQKWEPVQIVNKDNLWSPRDTMGSFALNDSEILVFGGDYGWISDCFTLNTKSGEMERMECSLKKPEEFFRAQPVRYNDKIFVVGCLDKDVHVYQPKGRKWFLLDKWYVDW
Ga0193275_1016480513300018988MarineMWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNTKTNEIKRMGECSLKKPEEFFRAQPVRYNEKIFVVGCLDKDLHVFSIKAQKWFLLEKWYVDW
Ga0192916_1007530613300018996MarineMGCFPLNDSEILIFGGDYGWISDSFVLNTKVGEIERMECSLKKPEEFFRAQPVRYNDKIFIVGCIDKDVHVYFPKAKKWFLLDKWYVDW
Ga0193196_1018075013300019007MarineLDGFQELDKQRWEPVCFVNRDNNWSPRDTMGSFPLNDSQILIFGGDYGWISDCFVLDTKSGEIERTECSLKKPEEFYRCQPVRYNDKIFVVGCIDKDVHVYLPKANKWFLLDKWYVSW
Ga0193569_1036663613300019017MarineMGCFPLNDSEIMIFGGDYGWISDCFTLNAKVGEIERMECSLRKPEEFFRAQPVRYNDKVFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW
Ga0192982_1024195613300019021MarineMIFGGDQGWISDCFSFDSKSNEIERLDCSLKKPEEFSKSSPVIYNEKVFVVGCLDKDVHVFTPKARKWFLLEKWFV
Ga0192981_1015817323300019048MarineMWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNTKTNEIHRMNECSLKKPEEFFRSQPVKYNEKVFVTGCLDKDVHVFSIKAQKWFLLEKWYVDW
Ga0192975_1010463713300019153MarineMGCFPLNDSEILIFGGDYGWISDCFTLNTKIGEIERMECSLKKPEEFFRAQPVRYNDKVFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW
Ga0194116_1056185313300020204Freshwater LakeVGSFALGDSEILIFGGDNGWISDCYSFNTKTNEIERQESSLKKPEDFFRSHSVKYNDKVFIVGCLDRDVHVFTPKKKKWFLLEKWFVDW
Ga0194127_1094292113300020221Freshwater LakeARDTVGSFALGDSEILIFGGDNGWISDCYSFNTKTNEIERQESSLKKPEDFFRSHSVKYNDKVFIVGCLDKDVHVFTPKKKKWFLLEKWFVDW
Ga0208853_105583713300020546FreshwaterMGSFSLNDSEILIFGGDYGWISDCFQLNTKSGEIERVECSLRKPEDFFRSHPVRYNDKVFVVGCLDRDVHVFLPKAKKWFLLDKWYVDW
Ga0194129_1044014513300020578Freshwater LakeLIFGGDNGWISDCYSFNTKTNEIERQESSLKKPEDFFRSHSVKYNDKVFIVGCLDKDVHVFTPKKKKWFLLEKWFVDW
Ga0210307_136084923300021336EstuarineLNLINKDTQWTPRDTIGSFTLGDGEILIFGGDQGWISDCFSFNSKTNEIERQDCPLKKPEEFFRANPVHYNDKVFVVGCLDKDVHVYTPKVKKWFLLEKWFVDW
Ga0206688_1025382813300021345SeawaterMWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNTKTNEIQRMGECSLKKPEEFFRAQPVRYNEKVFVVGCLDKDLHVFSIKAQKWFLLEKWYVDW
Ga0194130_1011491213300021376Freshwater LakeMWSPRDTIGSFALNDSEILIFGGDYGWISDCFTLNTKSGEIERMECSLRKPEDFFRSHAVKYNDKVFVVGCLDKDVHVFLPKAKKWFLLDRWYIDW
Ga0063134_103362033300021928MarineMGSFPLNDSQILIFGGDYGWISDCFVLDTKSGEIERTECSLKKPEEFYRCQPVRYNDKIFVVGCIDKDVHVYLPKANKWFLLDK
Ga0244777_1008951423300024343EstuarineMGCFPLNDSEIMIFGGDYGWISDCFTFNTKVGEIERMECSLRKPEEFFRAQPVRYNDKIFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW
Ga0244777_1020827523300024343EstuarineMGCFALNDSEILIFGGDYGWISDCFTLNTKIGEIERMDCSLKKPEEFFRAQPVRYNDKVFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW
Ga0244777_1089279823300024343EstuarineLIFGGDQGWISDCFSFNSKTNEIERQECPLKKPEEFFRCKPVHYNDKVFVVGCLDKDVHVYTPKAKKWFLLEKWFVDW
Ga0208643_102502733300025645AqueousMGSFSLSDSEILIFGGDYGWISDSFCLNTKSGEIERLDCSLKKPEEFFHSKAVRYNDKIFTIGCLDKDVHVFLPKAKKWFLLDKWFVDW
Ga0208005_103798443300025848AqueousLLDLEKQKWEMLQVVNKDSMWSPRDTIGSFALNDSEILVFGGDYGWISDCFTLNTKSGEIERMDCSLRKPEDFFRSHPVRYNDKVFVVGCLDKDVHVFLPKAKKWFLLDRWFVDW
Ga0208005_110714413300025848AqueousMGCFPLNDSEILIFGGDYGWISDCFTLNTKVGEIERMDCSLKKPEEFFRAQPVRYNDKIFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW
Ga0209502_1013746233300027780MarineLIYGGDYGWISDCFNFNTKTNVITRMEQCSLKKPEEFFRSQPVKYNEKVFVVGCLDKDLHVFSTKAKKWFLLEKWYIEW
Ga0209175_1004927013300027781Wastewater EffluentMHWTPRDTLGSFALSDSEILIFGGDYGWISDCFTFNVKSNEIHKCECTLKKPEEFFRSQAVKYNDKVFVIGNLDKDVHVYSLKAQKWFLLDKWFIEW
Ga0209092_1041057323300027833MarineMWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNIKTNEIHRMNECSLKKPEEFFRSQPVKYNEKVFVTGCLDKDVHVFSIKAQKWFLLEKWYVDW
Ga0209450_1010968523300027885Freshwater Lake SedimentVNRENNWSARDTMGCFPLNDSEILIFGGDYGWISDCFTLNTKVGEIERMDCSLKKPEEFFRAQPVRYNDKIFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW
Ga0311341_1068305723300029908BogTARDTLGSFALNDTEILVFGGDYGWISDCFVFNTKNNEIAKQEATLKKPEEFFRSNAVRYNDKVFVVGNLDKDVHIFSLKANKWFMMDKWFVDW
Ga0247631_116524313300030550SoilLVNKDNTWSARDTLGSFALNESDILIFGGDYGWISDCFTLFTKSNEIVKMDCSLKKPEEFYKCQSVKFNDKVFCLGNLDKDVHVYSIKAKKWFLLDKWYIDW
Ga0210282_1030570113300030630SoilVIFGGDYGWISECFLLSTKTNEIVKMDGSLKKPEEFFKSQAVKYNDKVFVLGSLDKDVHVYSIKAKKWFLLDKWYIDW
Ga0307398_1082069413300030699MarineMWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNTKTNEIQRLPECSLKKPEEFFRSQPVRYNEKVFVVGCLDKDVHVYSVKASKWFLLEKW
Ga0265459_1246617713300030741SoilVAIENQKWEVVPSINKDGLWTPRDTLGCFALNDSELLIFGGDYGWISDVFTFNTKNNEIQKMECTLKKPEEFFHSQAVKYNDKVFCVGCLDKDVHVYSIKAKKWFLLDKWFVDW
Ga0073964_1104246843300030788MarineMQLVNKDGGWSARDTMGSFTHGDGEVLIFGGDQGWISDCFSFNSKTNEIERQDCPLKKPEEFFRANPVHYNDKVFVVGCLDRDVHVYTPKVKKWFLL
Ga0073964_1139973823300030788MarineMGSFPLNDSEILIFGGDYGWISDCFVLNTKQGQIERMECSLKKPEEFYRSQSVRYNEKIFTVGCIDKDVHVYAPKANKWFLLDKWYVNW
Ga0073977_140960813300030948MarineMQLVNKDGGWSARDTMGSFTHGDGEVLIFGGDQGWISDCFSFNSKTNEIERQDCPLKKPEEFFRANPVHYNDKVFVVGC
Ga0073974_152578543300031005MarineMQLVNKDGGWSARDTMGSFTHGDGEVLIFGGDQGWISDCFSFNSKTNEIERQDCPLKKPEEFFRANPVHYNDKVFVVGCLDRDVHVYTPKVKKWFLLEKW
Ga0073978_102752113300031036MarineMGSFALNDSEILIFGGDYGWISDCFVLNTKKGEIEKQECSLKKPEEFYRSQPMWYNDKFFVLGCIDKDVHVYAPKAKKWFLLDKWYVNW
Ga0138347_1044422243300031113MarineMGCFPLNDSEILIFGGDYGWISDCFTLNTKVGEIERMECSLKKPEEFFRAQPVRYNDKVFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW
Ga0307974_102808543300031211Saline WaterMIFGGDYGWISDCFTFSTKNNEIQKVDCALKKPEEFFRSQPVRYNDKVFVMGCLDKDVHVFSTKARKWFILDKWFVDW
Ga0307948_115888923300031221Saline WaterNDSEIMIFGGDYGWISDCFTFSTKNNEIQKVDCALKKPEEFFRSQPVRYNDKVFVMGCLDKDVHVFSTKARKWFILDKWFVDW
Ga0170824_11448192613300031231Forest SoilMWSARDTLGSFALNDSDILIFGGDYGWISDVFTFSTKTNEIVKMDCSLKKPEEFFHSQAVKYNDKVFCLGCLDKDVHVYSIKAKKWFLLDRWFIDWXLAFSINL
Ga0307489_1040993523300031569Sackhole BrineMGCFPLNDSEILIFGGDYGWISDCFTLNTKVGEIERMDCSLKKPEEFFRAQPVRYNDKVFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW
Ga0302125_1003264243300031638MarineMGCFPLNNEEIFIFGGDYGWISDCFTFNTKTNEIERNECSLKKPEEFFRAQPVEYNKKVFVVGCIDKDVHVYLPKAKKWFLLDKWYVDW
Ga0315899_1038961133300031784FreshwaterLINKDQQWSARDTVGSFALKDDSEILIFGGDYGWISDCFVFNAKTNEIVKHDATLKKPEEFFRSQPVRYNEKVFVVGNLDKDVHVFSVKGQKWFMLDKWFVDW
Ga0314688_1064169323300032517SeawaterVNKDNQWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNVKTNEIQRLGECSLKKPEEFFRSQPVRYNEKIFVVGCLDKDLHVFSVKAQKWFLLEKWYVDW
Ga0314677_1018481333300032522SeawaterVNKDNQWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNVKTNEIQRLGECSLKKPEEFFRSQPVRYNEKIFVVGCLDKDLHVFSVKAQKWFLLE
Ga0314681_1066094423300032711SeawaterVNKDNQWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNVKTNEIQRLGECSLKKPEEFFRSQPVRYNEKIFVVGCLDKDLHVFSVKAQK
Ga0314686_1005333423300032714SeawaterVNKDNQWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNVKTNEIQRLGECSLKKPEEFFRSQPVRYNEKIFVVGCLDKDLHVFSVKAQKWFL
Ga0314698_1005110713300032726SeawaterVNKDNQWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNVKTNEIQRLGECSLKKPEEFFRSQPVRYNEKIFVVGCLDKDLHVFSVK
Ga0314704_1007022613300032745SeawaterVNKDNQWSPRDTLGSFALNDSEILIFGGDYGWISDCFNFNVKTNEIQRLGECSLKKPEEFFRSQPVRYNEKIFVVGCLDKDLHVFSVKAQKWFLLEKWYVD
Ga0334989_0061442_1309_15783300033984FreshwaterMGSFTFSEKEILIFGGDQGWISDCFNFNTQTNEIERLECSLKKPEEFFRSSPVHYNDKVFVVGCLDRDVHVFTPKVRKWFLLEKWFVDW
Ga0335017_0454558_352_6213300034167FreshwaterMGSFTLNNSEVLIFGGDQGWISDCFSFNSVTFEIERLECALKKPEEFFRSNPVHYNDKVFVVGCLDKDVHVFTPKAKKWFLLEKWFVDW
Ga0335039_0097470_79_3873300034355FreshwaterLVNKDGLWSARDTIGSFALGDSEILIFGGDNGWISDCYSFNTKTNEIERQESSLKKPEDFFRSHSVKYNDKVFIVGCLDRDVHVFTPKKKKWFLLEKWFVDW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.