NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099325

Metagenome / Metatranscriptome Family F099325

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099325
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 49 residues
Representative Sequence MWKRLRHALWRLWRWSRKSPAERRAAKARARFWAEMREGQREAEAHSRP
Number of Associated Samples 77
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 69.90 %
% of genes near scaffold ends (potentially truncated) 21.36 %
% of genes from short scaffolds (< 2000 bps) 79.61 %
Associated GOLD sequencing projects 69
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (63.107 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands
(13.592 % of family members)
Environment Ontology (ENVO) Unclassified
(31.068 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(28.155 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 58.44%    β-sheet: 0.00%    Coil/Unstructured: 41.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF13560HTH_31 4.85
PF04041Glyco_hydro_130 3.88
PF00118Cpn60_TCP1 2.91
PF06974WS_DGAT_C 2.91
PF00072Response_reg 1.94
PF13439Glyco_transf_4 1.94
PF02896PEP-utilizers_C 1.94
PF02518HATPase_c 1.94
PF00196GerE 0.97
PF01145Band_7 0.97
PF00534Glycos_transf_1 0.97
PF04055Radical_SAM 0.97
PF07859Abhydrolase_3 0.97
PF12833HTH_18 0.97
PF10091Glycoamylase 0.97
PF05013FGase 0.97
PF00076RRM_1 0.97
PF00166Cpn10 0.97
PF02800Gp_dh_C 0.97
PF13520AA_permease_2 0.97
PF08937DUF1863 0.97
PF02639DUF188 0.97
PF03006HlyIII 0.97
PF01182Glucosamine_iso 0.97
PF02597ThiS 0.97
PF01370Epimerase 0.97
PF13419HAD_2 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG2152Predicted glycosyl hydrolase, GH43/DUF377 familyCarbohydrate transport and metabolism [G] 3.88
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 2.91
COG0057Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenaseCarbohydrate transport and metabolism [G] 0.97
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.97
COG03636-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminaseCarbohydrate transport and metabolism [G] 0.97
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.97
COG1272Predicted membrane channel-forming protein YqfA, hemolysin III familyIntracellular trafficking, secretion, and vesicular transport [U] 0.97
COG1671Uncharacterized conserved protein YaiI, UPF0178 familyFunction unknown [S] 0.97
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 0.97
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 0.97
COG3741N-formylglutamate amidohydrolaseAmino acid transport and metabolism [E] 0.97
COG3931Predicted N-formylglutamate amidohydrolaseAmino acid transport and metabolism [E] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms63.11 %
UnclassifiedrootN/A36.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_104970021Not Available531Open in IMG/M
3300000550|F24TB_12103283All Organisms → cellular organisms → Bacteria → Proteobacteria594Open in IMG/M
3300003988|Ga0055475_10001191All Organisms → cellular organisms → Bacteria → Proteobacteria5309Open in IMG/M
3300003988|Ga0055475_10253002Not Available561Open in IMG/M
3300003989|Ga0055473_10002388All Organisms → cellular organisms → Bacteria4002Open in IMG/M
3300003989|Ga0055473_10309336Not Available522Open in IMG/M
3300004000|Ga0055458_10298545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Phyllobacterium → Phyllobacterium trifolii508Open in IMG/M
3300004004|Ga0055451_10001533All Organisms → cellular organisms → Bacteria → Proteobacteria9320Open in IMG/M
3300004028|Ga0055447_10099438All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300004028|Ga0055447_10245156All Organisms → cellular organisms → Bacteria → Proteobacteria592Open in IMG/M
3300004643|Ga0062591_101311988All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300004643|Ga0062591_102971348Not Available503Open in IMG/M
3300005172|Ga0066683_10901974Not Available506Open in IMG/M
3300005214|Ga0069002_10181100All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300005295|Ga0065707_10500365All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300005445|Ga0070708_101915640Not Available549Open in IMG/M
3300005471|Ga0070698_102041441Not Available527Open in IMG/M
3300005518|Ga0070699_101709303Not Available576Open in IMG/M
3300005590|Ga0070727_10225146All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300005600|Ga0070726_10309726All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium797Open in IMG/M
3300005601|Ga0070722_10207729All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium809Open in IMG/M
3300005612|Ga0070723_10334881Not Available721Open in IMG/M
3300005825|Ga0074476_1194574All Organisms → cellular organisms → Bacteria → Proteobacteria692Open in IMG/M
3300005828|Ga0074475_10181533All Organisms → cellular organisms → Bacteria → Proteobacteria2377Open in IMG/M
3300005830|Ga0074473_10077555Not Available1408Open in IMG/M
3300005830|Ga0074473_10760691All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300005832|Ga0074469_10338418All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium688Open in IMG/M
3300005832|Ga0074469_10395270All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales5067Open in IMG/M
3300005836|Ga0074470_11136096All Organisms → cellular organisms → Bacteria1223Open in IMG/M
3300005844|Ga0068862_101967555Not Available595Open in IMG/M
3300006467|Ga0099972_10379552Not Available528Open in IMG/M
3300006467|Ga0099972_11925266Not Available536Open in IMG/M
3300006467|Ga0099972_12127738Not Available685Open in IMG/M
3300006845|Ga0075421_100685204All Organisms → cellular organisms → Bacteria → Proteobacteria1193Open in IMG/M
3300006845|Ga0075421_102788814Not Available503Open in IMG/M
3300006847|Ga0075431_101872396All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300006876|Ga0079217_11376443Not Available550Open in IMG/M
3300007004|Ga0079218_10134799All Organisms → cellular organisms → Bacteria1772Open in IMG/M
3300009053|Ga0105095_10034137All Organisms → cellular organisms → Bacteria2739Open in IMG/M
3300009506|Ga0118657_10002027All Organisms → cellular organisms → Bacteria → Proteobacteria33833Open in IMG/M
3300009506|Ga0118657_10008107All Organisms → cellular organisms → Bacteria16902Open in IMG/M
3300009506|Ga0118657_10021624All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria10137Open in IMG/M
3300009506|Ga0118657_10203573All Organisms → cellular organisms → Bacteria2752Open in IMG/M
3300010392|Ga0118731_102461022All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium630Open in IMG/M
3300010392|Ga0118731_103530639All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300010392|Ga0118731_104193185All Organisms → cellular organisms → Bacteria3739Open in IMG/M
3300010392|Ga0118731_104588093All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1924Open in IMG/M
3300010399|Ga0134127_12748381Not Available572Open in IMG/M
3300010413|Ga0136851_10085530All Organisms → cellular organisms → Bacteria → Proteobacteria3355Open in IMG/M
3300010430|Ga0118733_100295892All Organisms → cellular organisms → Bacteria → Proteobacteria3202Open in IMG/M
3300010430|Ga0118733_100410503All Organisms → cellular organisms → Bacteria2684Open in IMG/M
3300010430|Ga0118733_101558957All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1317Open in IMG/M
3300010430|Ga0118733_101812833All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300010430|Ga0118733_104466929All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1746Open in IMG/M
3300010430|Ga0118733_106135106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium629Open in IMG/M
3300010430|Ga0118733_108783304All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300011262|Ga0151668_1103353Not Available648Open in IMG/M
3300012284|Ga0116696_1076706Not Available626Open in IMG/M
3300012284|Ga0116696_1093004Not Available588Open in IMG/M
3300012923|Ga0137359_11371452Not Available595Open in IMG/M
3300013101|Ga0164313_10611400All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium902Open in IMG/M
3300015374|Ga0132255_104094992Not Available619Open in IMG/M
3300017657|Ga0134074_1398371Not Available511Open in IMG/M
3300017963|Ga0180437_10489796All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium908Open in IMG/M
3300018052|Ga0184638_1227927Not Available649Open in IMG/M
3300018466|Ga0190268_10831471Not Available705Open in IMG/M
3300020063|Ga0180118_1268595Not Available1179Open in IMG/M
3300020063|Ga0180118_1387134All Organisms → cellular organisms → Bacteria → Proteobacteria546Open in IMG/M
3300022214|Ga0224505_10187972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium792Open in IMG/M
3300022220|Ga0224513_10098655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1114Open in IMG/M
3300022306|Ga0224509_10143418All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300022306|Ga0224509_10299417Not Available584Open in IMG/M
3300022389|Ga0210318_1065145All Organisms → cellular organisms → Bacteria → Proteobacteria686Open in IMG/M
3300022413|Ga0224508_10302016All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1024Open in IMG/M
(restricted) 3300024519|Ga0255046_10220573Not Available867Open in IMG/M
(restricted) 3300024519|Ga0255046_10341049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria705Open in IMG/M
3300025799|Ga0210122_1006078All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3503Open in IMG/M
3300025814|Ga0210101_1096056Not Available779Open in IMG/M
3300025883|Ga0209456_10080740All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1447Open in IMG/M
3300025957|Ga0210089_1041507Not Available582Open in IMG/M
3300025971|Ga0210102_1000802All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria7636Open in IMG/M
3300025983|Ga0210106_1033638Not Available823Open in IMG/M
3300026118|Ga0207675_102164434Not Available572Open in IMG/M
3300027723|Ga0209703_1146135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria890Open in IMG/M
3300027814|Ga0209742_10019521All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2249Open in IMG/M
3300027820|Ga0209578_10148541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1137Open in IMG/M
3300027820|Ga0209578_10205042All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium938Open in IMG/M
(restricted) 3300027865|Ga0255052_10306190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium776Open in IMG/M
(restricted) 3300027872|Ga0255058_10024847All Organisms → cellular organisms → Bacteria2933Open in IMG/M
3300027886|Ga0209486_10097653All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae1554Open in IMG/M
3300027917|Ga0209536_101384783All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300027978|Ga0209165_10088751Not Available1090Open in IMG/M
(restricted) 3300027997|Ga0255057_10448285Not Available626Open in IMG/M
3300028380|Ga0268265_11768784Not Available624Open in IMG/M
3300028592|Ga0247822_11127160Not Available652Open in IMG/M
3300030619|Ga0268386_10643363Not Available701Open in IMG/M
3300030620|Ga0302046_10180830All Organisms → cellular organisms → Bacteria1733Open in IMG/M
3300031368|Ga0307429_1004033All Organisms → cellular organisms → Bacteria5805Open in IMG/M
3300031965|Ga0326597_10045072All Organisms → cellular organisms → Bacteria → Proteobacteria5546Open in IMG/M
3300032251|Ga0316198_10613674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium588Open in IMG/M
3300033429|Ga0316193_11626139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300033433|Ga0326726_11287145Not Available711Open in IMG/M
3300033489|Ga0299912_10025440All Organisms → cellular organisms → Bacteria → Proteobacteria5120Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment13.59%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands13.59%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine6.80%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)6.80%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment4.85%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.88%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.91%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.91%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.94%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.94%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment1.94%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment1.94%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.94%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.94%
Beach SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Beach Sand1.94%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.97%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.97%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.97%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.97%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.97%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.97%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.97%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300003988Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2EnvironmentalOpen in IMG/M
3300003989Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2EnvironmentalOpen in IMG/M
3300004000Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004004Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2EnvironmentalOpen in IMG/M
3300004028Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005214Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005600Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1EnvironmentalOpen in IMG/M
3300005601Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1EnvironmentalOpen in IMG/M
3300005612Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2EnvironmentalOpen in IMG/M
3300005825Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBBEnvironmentalOpen in IMG/M
3300005828Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBIEnvironmentalOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300005832Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBBEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010413Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011262Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, totalEnvironmentalOpen in IMG/M
3300012284Beach sand microbial communities from Municipal Pensacola Beach, Florida - OS-S2EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300013101Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cmEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300020063Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022220Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21EnvironmentalOpen in IMG/M
3300022306Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022389Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.24 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022413Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21EnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300025799Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025814Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025883Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes)EnvironmentalOpen in IMG/M
3300025957Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025971Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025983Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027723Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027814Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027820Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027865 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21EnvironmentalOpen in IMG/M
3300027872 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300027978Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027997 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031368Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032251Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxicEnvironmentalOpen in IMG/M
3300033429Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033489Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10497002123300000364SoilMWKAFREMLVRLWQWSQKSAADRRLAKARARFWADVREGEREAEARLRP*
F24TB_1210328313300000550SoilMWKDLRQVLVRLWQWSQKGAAQRRVAKARARFWAGVREGEREAEARSRP*
Ga0055475_1000119123300003988Natural And Restored WetlandsMRDALFRFWRWSQKSPAERRAAKARARFWVEMREGQLEAEAHSRP*
Ga0055475_1025300223300003988Natural And Restored WetlandsVWKRLRLALSRLWRRSQTGPGERQVARERARFWAEMREGQREAKARARP*
Ga0055473_1000238833300003989Natural And Restored WetlandsMWRDVRRVLARLWRWSQKGRAERRAAETRARFWADAREGQLEAEARSRS*
Ga0055473_1030933613300003989Natural And Restored WetlandsMWKRMRDALFRFWRWSQKSPAERRAAKARARFWVEVREGQLEAKAHSRP*
Ga0055458_1029854523300004000Natural And Restored WetlandsWNELRRLVERLWHRSQRKAAERRAARARARFWAELHEGQREAEIRSRP*
Ga0055451_1000153323300004004Natural And Restored WetlandsVRRVLARLWRWSQKGRAERRAAETRARFWADAREGQLEAEARSRS*
Ga0055447_1009943813300004028Natural And Restored WetlandsMWKRLRHALWRIWQRSQRGPGERRADKARARFWAEVREGQREAEAHSRP*
Ga0055447_1024515623300004028Natural And Restored WetlandsMWKRLHQALRRLWRRSQQGPDERQAARARARFWAEVREGQQEAEARSHP*
Ga0062591_10131198823300004643SoilMWNDLREVLVRLWHWSQKSAAERRAAKVRARFWADVRAGEREAEAHSRSG*
Ga0062591_10297134823300004643SoilDDLRDVIVRFYRWFQQSAAERRRIKERARFWAGVREGEREAEARTRS*
Ga0066683_1090197413300005172SoilMWKRLRHVLWRLVRWSQRARDERRVAETRARFWAEVREGEREAEALSVLKPNHP*
Ga0069002_1018110023300005214Natural And Restored WetlandsMWKRLRHALWRLWQRSRRGPGERREAKARARFWAEVREGQREAEARSRP*
Ga0065707_1050036513300005295Switchgrass RhizosphereRRLMRWSQRGRDERRVAETRARFWAEVREGEREAEARSRS*
Ga0070708_10191564013300005445Corn, Switchgrass And Miscanthus RhizosphereMWKRVRHVLWRLMRWSQRGREERRVAETRARFWAEVHEGEREAEARSRS*
Ga0070698_10204144113300005471Corn, Switchgrass And Miscanthus RhizosphereMWRRVRHALWRLVRWSQRGRDERRVAETRARFWAEVHEGEREAEARSRS*
Ga0070699_10170930323300005518Corn, Switchgrass And Miscanthus RhizosphereMWKYFRELLVRLWQWSQKSAAERRVAKARARFWAGVREGEREAEAHSRP*
Ga0070727_1022514623300005590Marine SedimentMWERLRHALWRLWRRSQTGPDERQAAKARARFWAEMREGQREAEARSRP*
Ga0070726_1030972633300005600Marine SedimentMWKRLCDAPFRFWRWSQKSPAERRAAKARARFWVEMREGQREAEAHSRP*
Ga0070722_1020772913300005601Marine SedimentMWKRMCDALFRFWRWSQKSPAERRAAKARARFWIELREGQREAEAHLRP*
Ga0070723_1033488123300005612Marine SedimentMWRRLHDAFRRLWRRSRRARDEGRLADDRARFWAEVRQGQREAEANSRP*
Ga0074476_119457423300005825Sediment (Intertidal)MWKRLRHALLRLWGWSHKGPAERRAARERARFWAEMREGQREAKAHSRS*
Ga0074475_1018153343300005828Sediment (Intertidal)MSETGPGIWDRLRRALERLRSQSQESAQDRRAALARARFWAEVREGEREAEAMSRP*
Ga0074473_1007755513300005830Sediment (Intertidal)MLEALRRAVERLWQWSQKTPAERRVAKARARFWAEVREGEREAEGR
Ga0074473_1076069123300005830Sediment (Intertidal)MWKRLKHALRRLWRRSQSGADERRVAEERARFWAEVREGQREAEARSRP*
Ga0074469_1033841823300005832Sediment (Intertidal)MWERLRDALCRFWRWSQKSPAERRAAKVRARFWVEVREGQREAEAHSRP*
Ga0074469_1039527023300005832Sediment (Intertidal)MWKRLRHALWRLWRWSRKGPAERRAARVRARFWAEMREGQREAEARSRP*
Ga0074470_1113609623300005836Sediment (Intertidal)MWKRLRRALWRLWQQSQTGRVERQTARERARFWAELREGQREAKAHSRP*
Ga0068862_10196755523300005844Switchgrass RhizosphereMTAEGLSTMWNDLREVLVRLWHWSQKSAAERRAAKVRARFWADVRAGEREAEAHSRSG*
Ga0099972_1037955233300006467MarineMWKRLRHALWRLWQWSQRGPGERRAAKARARFWAEVRDGQREAEAHSRS*
Ga0099972_1192526623300006467MarineMWKRLRHLLWRLWRRSQRSPGERRAAEARARFWAEVREGQREAEAHSRP*
Ga0099972_1212773823300006467MarineMWRRLNDALRRLWRRSQRVRAEGRVADDRARFWAEVRQGQREAEANSRL*
Ga0075421_10068520423300006845Populus RhizosphereVWNRLRHALWRAWRRAQRGADQRRTAEARARFWAEVREGEREAEADSRR*
Ga0075421_10278881423300006845Populus RhizosphereMWKDLREVLVRLWQWSQKSAADRRLAKARARFWAGVREGEREAEAARLRP*
Ga0075431_10187239613300006847Populus RhizosphereTWRVLLRTSMLKYLREVLVRLWQWSQKSAAERRVAKERARFWAGVREGEREAESHSRP*
Ga0079217_1137644323300006876Agricultural SoilMWNDLREAFVRLRDWAQRGASERRVAKERARFWAGVREGEREAETHSRRERATP*
Ga0079218_1013479923300007004Agricultural SoilMWNDLREALVRLRDWAQRGVSERRVAKERARFWAGVREGEREAETHSRRERATP*
Ga0105095_1003413753300009053Freshwater SedimentMWERLRHALERLWRRLQSGRRERRTAAARARFWSEVREGQREADADSSP*
Ga0118657_1000202753300009506Mangrove SedimentMWKRLRYALWRLWRRSQRSPGERQAAKARARFWAEVREGQREAEAHSRS*
Ga0118657_1000810763300009506Mangrove SedimentMWKRLCQALWRLWQQSQGGAEERRTAKARARYWAEVREGEREARAHSRS*
Ga0118657_10021624103300009506Mangrove SedimentMWKRLRSALLRFWQRSQEGSQERHAAKARARYWAEVREGEREAKIHSRP*
Ga0118657_1020357343300009506Mangrove SedimentMWKRLRHALRRLLRRSQRSRAELQVAEARARFWAEVREGQREAEARSHP*
Ga0118731_10246102223300010392MarineMWKRLRYALSRLWRRSQSDPGERRVAKARARFWAEVREGQREAEARSRS*
Ga0118731_10353063923300010392MarineMWKRLRQALWRFWQRSQSSPGERRAAKARARFWAEVREGQREAEAHSRS*
Ga0118731_10419318553300010392MarineMLSHRPWGRTSMWKGLRQALARLWRWSQASHAERREAKARARFWAEAREGQREAEAKSRP
Ga0118731_10458809313300010392MarineMWKRICDALFRFWRWSQKSPAERRAAKARARFWIELHEGQREAETHSHP*
Ga0134127_1274838123300010399Terrestrial SoilMWNDLREVLVRLWHWSQKSAAERRAAKARARFWADVRAGEREAEAHSRSGRVTP*
Ga0136851_1008553023300010413Mangrove SedimentMWKRLRQVLARLWRWSRKSPAERRAARTRARFWAEVREGQREAEARSRP*
Ga0118733_10029589263300010430Marine SedimentMLARLWQSPQKSSAEQRAAAVRARFWAEVREGQREAKARSRP*
Ga0118733_10041050323300010430Marine SedimentMWKDLRRLLTRLWRWSQKGPAERRVTRERARFWAEVREGEREAESSSRP*
Ga0118733_10155895713300010430Marine SedimentMWRGLRRALARLGRWAQKGAVERRAARKRARFWAEVREGQRE
Ga0118733_10181283333300010430Marine SedimentMWKRLQNALRRLWRRSQGGRAEGRVADDRARFWAEVRRGQREAESNSRP*
Ga0118733_10446692923300010430Marine SedimentMDMWKRLRDALWRLWERSQRSPGERREAKARARFWAEVREGQ
Ga0118733_10613510613300010430Marine SedimentMWKRLRHALWRLWRWPQKGPAERRAAKARARFWAEMREGQREAEAHSRP*
Ga0118733_10878330423300010430Marine SedimentMWKGLLQMLARLWQSSQKGSAEQRAAAMRARFWAEVREGQREAETRS
Ga0151668_110335323300011262MarineKRLRYALSRRWRRSQSDPGERRVAKARARFWAEVREGQREAEARSRP*
Ga0116696_107670623300012284Beach SandMWERLRDALRRLWRRSQRGHDERRAAEARARFWAEVRRGQREAEANSGN*
Ga0116696_109300423300012284Beach SandMWKRLHHALRRLWNLSQRGRAEGRMANDRARFWAEVRRGQREAEAN
Ga0137359_1137145213300012923Vadose Zone SoilMWKRLRHVLWRLVRWSQRARDERRVAETRARFWAEVREGERE
Ga0164313_1061140013300013101Marine SedimentMWERICDALSRFWRWSQKSPAERRTDKARARFWHELREGQREAEADSRP*
Ga0132255_10409499223300015374Arabidopsis RhizosphereMWNDLREVLVRLWQWSRKSAAERRAANARGRFWAGVREGEREAEARPRP*
Ga0134074_139837113300017657Grasslands SoilMWKRLRHVLWRLVRWSQRARDERRVAETRARFWAEVREGER
Ga0180437_1048979613300017963Hypersaline Lake SedimentMKRRASMWKLLRYALWRLWRWSRKSPAERRAARTRARFWAEVREGQRE
Ga0184638_122792723300018052Groundwater SedimentMWKYLREVLVRLWQWSQKSAAERRVAKARARFWAGVREGEREAEAHSRP
Ga0190268_1083147123300018466SoilMTRGMWRDLREVLVRLWQWSRRSANERRVAKARARFWAGVREGERE
Ga0180118_126859523300020063Groundwater SedimentMLKYLRQVLVRLWQWSRQGAAERRVATARARFWAGVREGEREAEARSRP
Ga0180118_138713423300020063Groundwater SedimentLGTSMWKYFREVLVRLWQWSQKSAAERRVAKARARFWADVREGEREAEAHSRP
Ga0224505_1018797223300022214SedimentLGRALWRLWRWSQSGPEERREARARARFWAEVREGQREAKAHSRP
Ga0224513_1009865523300022220SedimentMWKRLRHALWRLWRWSRKSPAERRAAKARARFWAEMREGQREAEAHSRP
Ga0224509_1014341833300022306SedimentRWSQKSPAERRTDKARARFWHELREGQREAEADSRP
Ga0224509_1029941713300022306SedimentMWKRMRHALLRLWRRSQTDPGERRVAEARARFWAEVREGQREAESRSRP
Ga0210318_106514513300022389EstuarineMSETGPGIWDRLRRALERLRSQSQESAQDRRAALARARFWAEVREGEREAEAMSRP
Ga0224508_1030201623300022413SedimentMWRRLHDALRRLWRRSRRARDEGRLTEDRARFWAEVRQGEREAEDNSRP
(restricted) Ga0255046_1022057333300024519SeawaterMYDALFRFWRWSQKSPAERRAAKARARFWVEMREGQREAETHSRP
(restricted) Ga0255046_1034104923300024519SeawaterMCDALFRFWRWSQKSPAERREAKARARFWVEVREGQREAKDHTRP
Ga0210122_100607833300025799Natural And Restored WetlandsMKRRPRRLRWGTDMRKRMRDALFRFWRWSQKSPAERRAAKARARFWVEMREGQLEAEAHSRP
Ga0210101_109605613300025814Natural And Restored WetlandsMRDALFRFWRWSQKSPAERRAAKARARFWVEMREGQLEAEAHSRP
Ga0209456_1008074023300025883Pelagic MarineMWKRLRHALWSLWQRSQSDPDEHRAAEARARFWAEVREGEREAEARSRP
Ga0210089_104150723300025957Natural And Restored WetlandsMWNRLRHALEELWRRSRKGARERRTAEARARFWAEMREGERQAEARCARMDP
Ga0210102_100080233300025971Natural And Restored WetlandsMRDALLRLWRWSQKSPAERRAAKARARFWVEVREGQLEAEAHSRP
Ga0210106_103363813300025983Natural And Restored WetlandsMRDALLRFWRWSQKSPAERRAAKARARFWLELREGQREAEVHSRP
Ga0207675_10216443423300026118Switchgrass RhizosphereMWNDLREVLVRLWHWSQKSAAERRAAKVRARFWADVRAGEREAEAHSRSG
Ga0209703_114613523300027723Freshwater SedimentMWERLRHALERLWRRLQSGRRERRTAAARARFWSEVREGQREADADSSP
Ga0209742_1001952113300027814Marine SedimentMWKRLRYALSRLWRRSQSDPGERRVAKERARFWAEVREGQREAEARSRS
Ga0209578_1014854113300027820Marine SedimentPASASAMWGTDMWKRLRHALWRLWRRSQRSPGERRVAKERARFWAEVREGQREAEAHSRP
Ga0209578_1020504223300027820Marine SedimentMWERLRHALWRLWRRSQTGPDERQAAKARARFWAEMREGQREAEARSRP
(restricted) Ga0255052_1030619023300027865SeawaterMWTRLRHALSRFWQWSQKGPAERRVEKARARFWAEAREGQREAEARSRP
(restricted) Ga0255058_1002484723300027872SeawaterMWKRLEHVLGRLWRWSQMSPAERRAARVRARFWADMRAGQREAEARSRP
Ga0209486_1009765323300027886Agricultural SoilEQIIQTWREQRNTMWNDLREALVRLRDWAQRGVSERRVAKERARFWAGVREGEREAETHSRRERATP
Ga0209536_10138478313300027917Marine SedimentMWKRLEDALRRLWRWAKKSPAERRAARVRARFWADLRAGQREAEARSRP
Ga0209165_1008875133300027978Marine SedimentMWKRMCDALFRFWRWSQKSPAERRAAKARARFWIELREGQREAEAHLRP
(restricted) Ga0255057_1044828523300027997SeawaterMWEGLRQALARLWKRSQKGRAEARAVEARARFWAELREGQREAEAHSRP
Ga0268265_1176878423300028380Switchgrass RhizosphereMTAEGLSTMWNDLREVLVRLWHWSQKSAAERRAAKVRARFWADVRAGEREAEAHSRSG
Ga0247822_1112716033300028592SoilLGVWSRLRNALSSLWRWSRSVRDERRSTKARALFWSEVREGEREAEANADPDRVR
Ga0268386_1064336323300030619SoilMWNDLREVLVRLWQWSQKSAAERRVGKARARFWADVREGEREAEARSRL
Ga0302046_1018083043300030620SoilMYTKQWKRLREALSWLWRWSQRGRNERRVVKARARFWAEVHEGEREAEARLHP
Ga0307429_100403323300031368Salt MarshMWRGLRHGLWRLWRRSQKGREERRTLKARARFWAEVREGQREAAARTGR
Ga0326597_1004507233300031965SoilMWKHLRQALWRLWRSPQRGVGERRAAKARARFWAEVRKGQREAEAHSRP
Ga0316198_1061367423300032251SedimentMWERLRRALRRVWRRSQRGPGECREAEARARFWAEVRDGEREAEAQSRP
Ga0316193_1162613913300033429SedimentMWKRLRHALRSLWRRSQSDPGERGVAEARARFWAEVHEGEREAEARSRP
Ga0326726_1128714513300033433Peat SoilMRIRHSLVVIWRRLKQGGDERRTADARARFWADVREGEREAEARSRP
Ga0299912_1002544053300033489SoilMWKRLRHVLWRLWQRSKRGPGERRAAKARARFWDEVREGQREAEAHSRP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.