Metagenome / Metatranscriptome Family F097858

Basic Information
Family ID	F097858
Family Type	Metagenome / Metatranscriptome
Number of Sequences	104
Average Sequence Length	36 residues
Representative Sequence	MSTRHEICAIERTAGNAGAAASLILGTLLLLIRP
Number of Associated Samples	92
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	77.67 %
% of genes near scaffold ends (potentially truncated)	16.35 %
% of genes from short scaffolds (< 2000 bps)	56.73 %
Associated GOLD sequencing projects	89
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.38

Most Common Taxonomy
Group	Bacteria (68.269 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (8.654 % of family members)
Environment Ontology (ENVO)	Unclassified (23.077 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (49.038 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 46.77% β-sheet: 0.00% Coil/Unstructured: 53.23%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF00682	HMGL-like	38.46
PF03976	PPK2	18.27
PF08502	LeuA_dimer	10.58
PF04191	PEMT	6.73
PF08543	Phos_pyr_kin	3.85
PF03480	DctP	2.88
PF00528	BPD_transp_1	1.92
PF09084	NMT1	0.96
PF05231	MASE1	0.96
PF04069	OpuAC	0.96
PF13379	NMT1_2	0.96
PF04290	DctQ	0.96
PF06808	DctM	0.96
PF03807	F420_oxidored	0.96
PF00005	ABC_tran	0.96
PF01745	IPT	0.96
PF13361	UvrD_C	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG2326	Polyphosphate kinase 2, PPK2 family	Energy production and conversion [C]	18.27
COG0119	Isopropylmalate/homocitrate/citramalate synthases	Amino acid transport and metabolism [E]	10.58
COG0351	Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase	Coenzyme transport and metabolism [H]	3.85
COG0524	Sugar or nucleoside kinase, ribokinase family	Carbohydrate transport and metabolism [G]	3.85
COG2240	Pyridoxal/pyridoxine/pyridoxamine kinase	Coenzyme transport and metabolism [H]	3.85
COG2870	ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase	Cell wall/membrane/envelope biogenesis [M]	3.85
COG0642	Signal transduction histidine kinase	Signal transduction mechanisms [T]	0.96
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.96
COG3447	Integral membrane sensor domain MASE1	Signal transduction mechanisms [T]	0.96
COG3851	Signal transduction histidine kinase UhpB, glucose-6-phosphate specific	Signal transduction mechanisms [T]	0.96
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.96

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	71.15 %
Unclassified	root	N/A	28.85 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	71.15 %
Unclassified	root	N/A	28.85 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	68.27 %
Unclassified	root	N/A	28.85 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	2.88 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	59.62 %
Unclassified	root	N/A	28.85 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	2.88 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	1.92 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	43.27 %
Unclassified	root	N/A	28.85 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.88 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2.88 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	33.65 %
Unclassified	root	N/A	28.85 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	2.88 %
Legionellales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.96 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	11.54 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	8.65 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.96 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.96 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	11.54 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Rhodovulum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	11.54 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.96 %
unclassified Rhodovulum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
genistoids sensu lato	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
core genistoids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
Genisteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
Lupinus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10.58 %
Lupinus albus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	2.88 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	1.92 %
bacterium HR31	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	1.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.92 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.96 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.96 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Dyella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000042\|ARSoilYngRDRAFT_c00939	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	2147	Open in IMG/M
3300000891\|JGI10214J12806_11367817	Not Available	544	Open in IMG/M
3300001213\|JGIcombinedJ13530_100931533	Not Available	764	Open in IMG/M
3300001423\|JGI20199J14953_1002572	Not Available	1760	Open in IMG/M
3300001430\|JGI24032J14994_100750	All Organisms → cellular organisms → Bacteria	1654	Open in IMG/M
3300001538\|A10PFW1_10942846	Not Available	675	Open in IMG/M
3300001867\|JGI12627J18819_10015847	All Organisms → cellular organisms → Bacteria	3028	Open in IMG/M
3300003998\|Ga0055472_10148408	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	695	Open in IMG/M
3300005529\|Ga0070741_10009779	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	18437	Open in IMG/M
3300005543\|Ga0070672_100000403	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	24982	Open in IMG/M
3300005563\|Ga0068855_100017362	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	8658	Open in IMG/M
3300005563\|Ga0068855_100035830	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5909	Open in IMG/M
3300005563\|Ga0068855_100196974	All Organisms → cellular organisms → Bacteria → Proteobacteria	2269	Open in IMG/M
3300005564\|Ga0070664_100083347	All Organisms → cellular organisms → Bacteria → Proteobacteria	2758	Open in IMG/M
3300005564\|Ga0070664_100217493	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1709	Open in IMG/M
3300005578\|Ga0068854_100377865	Not Available	1167	Open in IMG/M
3300005607\|Ga0070740_10001947	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	26131	Open in IMG/M
3300005713\|Ga0066905_100003569	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6160	Open in IMG/M
3300005713\|Ga0066905_100378528	All Organisms → cellular organisms → Bacteria → Proteobacteria	1141	Open in IMG/M
3300005764\|Ga0066903_100229152	All Organisms → cellular organisms → Bacteria → Proteobacteria	2830	Open in IMG/M
3300005764\|Ga0066903_100645317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1849	Open in IMG/M
3300005833\|Ga0074472_10280436	Not Available	1797	Open in IMG/M
3300005836\|Ga0074470_11802617	Not Available	1254	Open in IMG/M
3300005844\|Ga0068862_100305074	Not Available	1466	Open in IMG/M
3300005937\|Ga0081455_10000185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	78750	Open in IMG/M
3300005938\|Ga0066795_10112930	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	808	Open in IMG/M
3300005938\|Ga0066795_10117054	All Organisms → cellular organisms → Bacteria	794	Open in IMG/M
3300005947\|Ga0066794_10007402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3035	Open in IMG/M
3300005947\|Ga0066794_10064700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1087	Open in IMG/M
3300006055\|Ga0097691_1009302	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	4998	Open in IMG/M
3300006057\|Ga0075026_100023707	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2751	Open in IMG/M
3300006057\|Ga0075026_100361013	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	808	Open in IMG/M
3300006059\|Ga0075017_100051240	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2776	Open in IMG/M
3300006174\|Ga0075014_100107274	Not Available	1311	Open in IMG/M
3300006175\|Ga0070712_100206689	All Organisms → cellular organisms → Bacteria → Proteobacteria	1546	Open in IMG/M
3300006177\|Ga0075362_10556710	Not Available	590	Open in IMG/M
3300006358\|Ga0068871_100005825	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	8660	Open in IMG/M
3300006572\|Ga0074051_10004003	Not Available	673	Open in IMG/M
3300006619\|Ga0075529_1009154	Not Available	811	Open in IMG/M
3300006626\|Ga0101570_10528698	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	618	Open in IMG/M
3300006638\|Ga0075522_10194038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1029	Open in IMG/M
3300006638\|Ga0075522_10534321	Not Available	540	Open in IMG/M
3300006642\|Ga0075521_10013730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3181	Open in IMG/M
3300006755\|Ga0079222_11601644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	617	Open in IMG/M
3300006795\|Ga0075520_1159254	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	980	Open in IMG/M
3300006806\|Ga0079220_10146772	All Organisms → cellular organisms → Bacteria → Proteobacteria	1295	Open in IMG/M
3300006949\|Ga0075528_10027935	Not Available	1426	Open in IMG/M
3300009029\|Ga0066793_10179172	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	1235	Open in IMG/M
3300009031\|Ga0103682_10346481	All Organisms → cellular organisms → Bacteria	768	Open in IMG/M
3300009091\|Ga0102851_10339571	Not Available	1487	Open in IMG/M
3300009148\|Ga0105243_10039887	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3664	Open in IMG/M
3300009545\|Ga0105237_10060145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3801	Open in IMG/M
3300009551\|Ga0105238_11906244	Not Available	627	Open in IMG/M
3300010043\|Ga0126380_10031522	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	2685	Open in IMG/M
3300010043\|Ga0126380_10058169	All Organisms → cellular organisms → Bacteria → Proteobacteria	2128	Open in IMG/M
3300010043\|Ga0126380_10116901	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1638	Open in IMG/M
3300010359\|Ga0126376_12488163	Not Available	565	Open in IMG/M
3300010361\|Ga0126378_10125408	All Organisms → cellular organisms → Bacteria	2579	Open in IMG/M
3300010366\|Ga0126379_10032032	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	4122	Open in IMG/M
3300010373\|Ga0134128_10015841	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	8958	Open in IMG/M
3300010373\|Ga0134128_10057015	All Organisms → cellular organisms → Bacteria → Proteobacteria	4503	Open in IMG/M
3300010375\|Ga0105239_10006578	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	13462	Open in IMG/M
3300010396\|Ga0134126_10425252	All Organisms → cellular organisms → Bacteria → Proteobacteria	1540	Open in IMG/M
3300010398\|Ga0126383_10075078	All Organisms → cellular organisms → Bacteria → Proteobacteria	2926	Open in IMG/M
3300011119\|Ga0105246_10033664	All Organisms → cellular organisms → Bacteria → Proteobacteria	3408	Open in IMG/M
3300012212\|Ga0150985_101904863	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	719	Open in IMG/M
3300012469\|Ga0150984_101452221	Not Available	520	Open in IMG/M
3300012495\|Ga0157323_1021951	Not Available	615	Open in IMG/M
3300012899\|Ga0157299_10145909	Not Available	663	Open in IMG/M
3300012931\|Ga0153915_10156966	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	2470	Open in IMG/M
3300012958\|Ga0164299_10030212	All Organisms → cellular organisms → Bacteria → Proteobacteria	2346	Open in IMG/M
3300012961\|Ga0164302_10000016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	36358	Open in IMG/M
3300012971\|Ga0126369_10034764	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	4179	Open in IMG/M
3300012987\|Ga0164307_10025634	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3119	Open in IMG/M
3300014208\|Ga0172379_10025962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	5897	Open in IMG/M
3300014303\|Ga0075358_1019799	All Organisms → cellular organisms → Bacteria	954	Open in IMG/M
3300014325\|Ga0163163_10035379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4844	Open in IMG/M
3300014838\|Ga0182030_10007315	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	23066	Open in IMG/M
3300015063\|Ga0167649_100807	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	4444	Open in IMG/M
3300015190\|Ga0167651_1047066	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	910	Open in IMG/M
3300017650\|Ga0182736_1004613	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	8543	Open in IMG/M
3300017966\|Ga0187776_11040428	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella	604	Open in IMG/M
3300017994\|Ga0187822_10232454	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	627	Open in IMG/M
3300018064\|Ga0187773_10141082	Not Available	1234	Open in IMG/M
3300021074\|Ga0194044_10276314	Not Available	640	Open in IMG/M
3300021560\|Ga0126371_10002455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	15960	Open in IMG/M
3300025914\|Ga0207671_11349051	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31	554	Open in IMG/M
3300025949\|Ga0207667_10848675	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	908	Open in IMG/M
3300026464\|Ga0256814_1032361	Not Available	621	Open in IMG/M
3300026903\|Ga0207462_1001390	All Organisms → cellular organisms → Bacteria	935	Open in IMG/M
3300027645\|Ga0209117_1050235	Not Available	1237	Open in IMG/M
3300027706\|Ga0209581_1009308	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	6513	Open in IMG/M
3300027902\|Ga0209048_10118047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2018	Open in IMG/M
3300028889\|Ga0247827_10858455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	606	Open in IMG/M
3300029903\|Ga0247271_132526	Not Available	507	Open in IMG/M
3300031247\|Ga0265340_10401445	Not Available	605	Open in IMG/M
3300031711\|Ga0265314_10365408	Not Available	790	Open in IMG/M
3300031820\|Ga0307473_10238339	Not Available	1107	Open in IMG/M
3300031949\|Ga0214473_10220692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	2187	Open in IMG/M
3300032892\|Ga0335081_10039702	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	7484	Open in IMG/M
3300033004\|Ga0335084_10244810	Not Available	1859	Open in IMG/M
3300033489\|Ga0299912_10419583	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1093	Open in IMG/M
3300033808\|Ga0314867_174163	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	507	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	75.96%
Host-Associated	Host-Associated	24.04%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	59.62%
Plants	Host-Associated → Plants	24.04%
Aquatic	Environmental → Aquatic	16.35%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	59.62%
Rhizosphere	Host-Associated → Plants → Rhizosphere	12.50%
Rhizoplane	Host-Associated → Plants → Rhizoplane	8.65%
Freshwater	Environmental → Aquatic → Freshwater	7.69%
Sediment	Environmental → Aquatic → Sediment	6.73%
Roots	Host-Associated → Plants → Roots	2.88%
Marine	Environmental → Aquatic → Marine	1.92%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	41.35%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	11.54%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.69%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.73%
Loam	Environmental → Terrestrial → Soil → Loam	6.73%
Soil	Host-Associated → Plants → Rhizosphere → Soil	6.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.77%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	3.85%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.92%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.92%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.96%
Lake	Environmental → Aquatic → Freshwater → Lake	0.96%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.96%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.96%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.00%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	8.65%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.69%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	6.73%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	5.77%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	5.77%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.77%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.88%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.92%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	1.92%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	1.92%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.92%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.96%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.96%
Chlorinated	Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated	0.96%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.96%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.96%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.96%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.96%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.96%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.96%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.96%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	8.65%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	7.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.77%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	4.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	4.81%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	3.85%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.85%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.88%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	2.88%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	1.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.92%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.92%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	1.92%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.92%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.92%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.92%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	1.92%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.92%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.96%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	0.96%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.96%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.96%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	0.96%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.96%
Groundwater	Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater	0.96%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	0.96%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.96%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.96%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.96%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.96%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.96%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.96%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.96%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	0.96%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.96%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.96%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.96%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.96%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.96%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.96%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.96%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000042	Arabidopsis rhizosphere soil microbial communities from the University of North Carolina - sample from Arabidopsis soil young	Host-Associated	Open in IMG/M
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300001423	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012	Environmental	Open in IMG/M
3300001430	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5	Environmental	Open in IMG/M
3300001538	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina	Environmental	Open in IMG/M
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental	Open in IMG/M
3300003998	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005607	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005833	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005938	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191	Environmental	Open in IMG/M
3300005947	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006055	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012	Environmental	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006177	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006572	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006619	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-4B	Environmental	Open in IMG/M
3300006626	Soil microbial communities from the Leymus chinensis steppe, China - after adding 17.5 g N m- 2, yr-1	Environmental	Open in IMG/M
3300006638	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A	Environmental	Open in IMG/M
3300006642	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006795	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006949	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B	Environmental	Open in IMG/M
3300009029	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189	Environmental	Open in IMG/M
3300009031	Microbial communities from groundwater in Rifle, Colorado, USA - 3D_0.1um	Environmental	Open in IMG/M
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012495	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610	Host-Associated	Open in IMG/M
3300012899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300014208	Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Groundwater well OW334 metaG	Environmental	Open in IMG/M
3300014303	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D1	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014838	Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300015063	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3b, vegetated patch on medial moraine)	Environmental	Open in IMG/M
3300015190	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface)	Environmental	Open in IMG/M
3300017650	Enriched backyard soil microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C Kraft BY (version 2)	Environmental	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300021074	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-17m	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026464	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS5	Environmental	Open in IMG/M
3300026903	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A1-11 (SPAdes)	Environmental	Open in IMG/M
3300027645	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)	Environmental	Open in IMG/M
3300027706	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)	Environmental	Open in IMG/M
3300027902	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)	Environmental	Open in IMG/M
3300028889	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2	Environmental	Open in IMG/M
3300029903	Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703	Environmental	Open in IMG/M
3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Host-Associated	Open in IMG/M
3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Host-Associated	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033489	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214	Environmental	Open in IMG/M
3300033808	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.38
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.38
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F097858

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ARSoilYngRDRAFT_009392	3300000042	Arabidopsis Rhizosphere	MSTRHDIRAIKRTAGNAGAAASFILGTLLLLIRP*
JGI10214J12806_113678172	3300000891	Soil	MSTRHEICAIERTAENAGTAASLILGTLLLLIRP*
JGIcombinedJ13530_1009315331	3300001213	Wetland	MSTRHNICAIERTADNAGSAAVLILGTLLLLIRP*
JGI20199J14953_10025722	3300001423	Arctic Peat Soil	MSTRQTICAIERAAAKADPAATLILGTLLLLTRP*
JGI24032J14994_1007502	3300001430	Corn, Switchgrass And Miscanthus Rhizosphere	RTTMSTRYDISATERTAGNAGAAASLILGTLLLLIRP*
A10PFW1_109428463	3300001538	Permafrost	MSARQNICAIERAAGQDSHAGPVATLILGTLLLLI
JGI12627J18819_100158473	3300001867	Forest Soil	MSTRHDICAIERTAGNAGSAATLILGTLLLLISP*
Ga0055472_101484081	3300003998	Natural And Restored Wetlands	RRNEGDLRAMTTRRKISALARAASQAEPAATLILGSLLLLTRP*
Ga0070741_100097794	3300005529	Surface Soil	MKGDLDAMTTRYQVCAIERTAATAGAAATLILGSLLLLTRP*
Ga0070672_10000040322	3300005543	Miscanthus Rhizosphere	MSTRYDISATERTAGNAGAAASLILGTLLLLIRP*
Ga0068855_1000173622	3300005563	Corn Rhizosphere	MSTRQTICAIERTAPRAGAAASLILGSLLLLICP*
Ga0068855_1000358302	3300005563	Corn Rhizosphere	MSTRHDSCAIERTAPRAGAAASLILGSLLLLICP*
Ga0068855_1001969742	3300005563	Corn Rhizosphere	MSTRHDICAIERTAPKAGAAATLILGSLLLLISP*
Ga0070664_1000833473	3300005564	Corn Rhizosphere	MSTRHDIRAIERTAGNAGAAASLILGTLLLLIRP*
Ga0070664_1002174932	3300005564	Corn Rhizosphere	MSTRHDIRAIKRTADNADTAASLILGTLLLLIRP*
Ga0068854_1003778652	3300005578	Corn Rhizosphere	MSTRHDIRAVERTAGNAGAAASLILGTLLLLIRP*
Ga0070740_1000194720	3300005607	Surface Soil	MKGDLDAMTTRYQVCAIERTAAMAGAAATLILGSLLLLTRP*
Ga0066905_1000035695	3300005713	Tropical Forest Soil	MSTRWNIRAIGRTARRAGSTASLIQGTLLLLIRP*
Ga0066905_1003785282	3300005713	Tropical Forest Soil	MSARHEICAIERTAGDAGAAASLILGTLLLLIRP*
Ga0066903_1002291523	3300005764	Tropical Forest Soil	MSTRQSFCATKRTAAHAGSAASLILGTLLLLIRP*
Ga0066903_1006453172	3300005764	Tropical Forest Soil	MSTRQIICANEWTAEHAGSAASLILATLLLLIRP*
Ga0074472_102804362	3300005833	Sediment (Intertidal)	MSTRQTICAIERAAAKADPAATLILGTLLLLIRP*
Ga0074470_118026173	3300005836	Sediment (Intertidal)	MTTRNHIGAIERAAATAAPAATLILGSLLLLIRP*
Ga0068862_1003050742	3300005844	Switchgrass Rhizosphere	MSTRQIICATERTAGHAGSAASLILGTLLLLIRP*
Ga0081455_1000018523	3300005937	Tabebuia Heterophylla Rhizosphere	MSARHEICAIERTAVDAGAAASLILGTLLLLIRP*
Ga0066795_101129302	3300005938	Soil	MSARQNICAIERAAGKAEPAATLILGTLLLLIRP*
Ga0066795_101170541	3300005938	Soil	MPTRQTICAIERAAGTAEPAATLILGTLLLLIRP*
Ga0066794_100074025	3300005947	Soil	MSARQNICAIERAAGTAEPAATLILGTLLLLIRP*
Ga0066794_100647002	3300005947	Soil	MSARQTICAIERAAGTAEPAATLILGTLLLLIRP*
Ga0075028_1006519012	3300006050	Watersheds	MSTRQTICAIERTAGNAGSAAALILGSLLLLSAPEGRLG
Ga0097691_10093024	3300006055	Arctic Peat Soil	MSTRQTICAIERAAGTAEPAATLILGTLLLLIRP*
Ga0075026_1000237074	3300006057	Watersheds	MSTRRNIRAIGRTAGYAGSAGSLILGTLLLLIRP*
Ga0075026_1003610132	3300006057	Watersheds	MSTRQTICAIERTAGNAGSAAALILGSLLLLIRP*
Ga0075017_1000512404	3300006059	Watersheds	MTTRNATSALDRTAATAGSAATFILGSLLLLIRP*
Ga0075014_1001072741	3300006174	Watersheds	MSARQNICAIERAAAKAEPAATLILGTLLLLIRP*
Ga0070712_1002066892	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MSTLQTICAIERTAPRAGAAASLILGTLLLLIRP*
Ga0075362_105567102	3300006177	Populus Endosphere	MSTRHDISATERTAGNAGAAASLILGTLLLLIRP*
Ga0068871_1000058254	3300006358	Miscanthus Rhizosphere	MSTRQIICATERTAGHAASAASLIPGTLLLLIRP*
Ga0074051_100040031	3300006572	Soil	MSTRHEICAIERTAGNAGAAASLILGTLLLLIRP*
Ga0075529_10091542	3300006619	Arctic Peat Soil	MSARQDICAIERAAGKAEPAATLILGTLLLLIRP*
Ga0101570_105286981	3300006626	Soil	MSTRHDICAIERTAATAGSAATLILGSLLLLISP*
Ga0075522_101940382	3300006638	Arctic Peat Soil	MSTRQTICAIGRAAGQAEPVASLILGSLLLLIRP*
Ga0075522_105343212	3300006638	Arctic Peat Soil	MSTRHDICAIERTAATAGAAASLILGSLLLLISP*
Ga0075521_100137302	3300006642	Arctic Peat Soil	MSARHKSSAIERAAGQAEPAATLILGTLLLLIRP*
Ga0079222_116016442	3300006755	Agricultural Soil	MKQTMSARLQICAIEPAAKAVPAAALILGSLLLLSRP*
Ga0075520_11592542	3300006795	Arctic Peat Soil	MSARQNICAIERAADTAEPAATLILGTLLLLIRP*
Ga0079220_101467722	3300006806	Agricultural Soil	MSALQTNCAIERAAGETGAAASLILGTLLLLIRP*
Ga0075528_100279352	3300006949	Arctic Peat Soil	MSTRQTICAIERAAGRAEPAATLILGTLLLLIRP*
Ga0066793_101791722	3300009029	Prmafrost Soil	MPSRQTICAIEQAAGTAEPAATLILGTLLLLIRP*
Ga0103682_103464812	3300009031	Groundwater	MSTRQTICAIERTAKQVGAAATLILGTLLLLIRP*
Ga0102851_103395711	3300009091	Freshwater Wetlands	MSARQNICAIERAATKAEPAAILILGTLLLLIRP*
Ga0105243_100398875	3300009148	Miscanthus Rhizosphere	MSTRQIICATERTAGHAGAAASLILGTLLLLIRP*
Ga0105237_100601454	3300009545	Corn Rhizosphere	MSTRYDISATERTAGNAGAAASLILGSLLLLIRP*
Ga0105238_119062442	3300009551	Corn Rhizosphere	MSTLQTNCAIEPAAAKAMPAATLILGTLLLLIRP*
Ga0126380_100315221	3300010043	Tropical Forest Soil	MSTRPNFCAIERTVGSAGSATSLILGTLLLLIRP*
Ga0126380_100581694	3300010043	Tropical Forest Soil	MSTRRNIRAIGRTAANAGSAASLILGTLLLLIRP*
Ga0126380_101169011	3300010043	Tropical Forest Soil	MAMSTRQTICATEWTAGYAGSAESLILGTLLLLIRP*
Ga0126376_124881632	3300010359	Tropical Forest Soil	MTTRYNIRAIGRAAGKADPAATLILGTLLLLIRP*
Ga0126378_101254083	3300010361	Tropical Forest Soil	TMSTRHEIRAIEQTASNAGAAASLILGTLLLLIRP*
Ga0126379_100320326	3300010366	Tropical Forest Soil	MSTRRNIRAIGRTAGYAGSAASLILGTLLLLIRP*
Ga0134128_100158416	3300010373	Terrestrial Soil	MSMLQIDCAIERTAGNAGTAASLILGTLLLLIRP*
Ga0134128_100570154	3300010373	Terrestrial Soil	MSTRQTICATERTAGHAASAASLILGTLLLLIRP*
Ga0105239_100065781	3300010375	Corn Rhizosphere	MFTRYDISATERTAGNAGAAASLILGTLLLLIRP*
Ga0134126_104252522	3300010396	Terrestrial Soil	MSTRRDISATERTAGNAGAAASLILGTLLLLIRP*
Ga0126383_100750782	3300010398	Tropical Forest Soil	MTTRQDIRAIGRAAGKADPAATLILGTLLLLIRP*
Ga0105246_100336645	3300011119	Miscanthus Rhizosphere	MSTRQIICATERTAGHAASAASLIQGTLLLLIRP*
Ga0150985_1019048633	3300012212	Avena Fatua Rhizosphere	MKADEMTTRLQICAIDRTAKAASAAALILGSLLLLTRP*
Ga0150984_1014522211	3300012469	Avena Fatua Rhizosphere	RGMKADEMTTRLQICAIDRTAKAASAATLILGSLLLLMRP*
Ga0157323_10219511	3300012495	Arabidopsis Rhizosphere	TDEMREHSMSTRRNIRAIGRTAGYAGSAASLILGTLLLLIRP*
Ga0157299_101459092	3300012899	Soil	MSTRHDIRAIKRTADNAGTAASLILGTLLLLIRP*
Ga0153915_101569664	3300012931	Freshwater Wetlands	MSARHKSSAIERAAGSAEPAATLILGTLLLLIRP*
Ga0164299_100302123	3300012958	Soil	MSTRQSICAIERTAGRAGSVATLILGSLLLLIRP*
Ga0164302_1000001644	3300012961	Soil	MSTRYDISATERTAGNAGAADSLILGTLLLLIRP*
Ga0126369_100347641	3300012971	Tropical Forest Soil	MSTRQSFCATKRTAVHAGSAASLILGTLLLLIRP*
Ga0164307_100256342	3300012987	Soil	MSTRQIICATERTAGHAASAASLILGTLLLLIRP*
Ga0172379_100259627	3300014208	Groundwater	MPTRQTNCAIERAATKAGPVASLILGTLLLLTRP*
Ga0075358_10197992	3300014303	Natural And Restored Wetlands	FLPMSTLQTNCAIEPVATKAMPAATLILGTLLLLIRP*
Ga0163163_100353792	3300014325	Switchgrass Rhizosphere	MSTRHDIRAIKRTADNADTAASLILGTLLLLMRP*
Ga0182030_100073157	3300014838	Bog	MSTRQTICAIGPAAIRPLPVASLILGTLLLLIRP*
Ga0167649_1008071	3300015063	Glacier Forefield Soil	MSARQTICAIERTAAMAGSDAFLILGSLLLLIRP*
Ga0167651_10470662	3300015190	Glacier Forefield Soil	MSTRQTICAIGRAAAKADPVASLILGTLLLLIRP*
Ga0182736_10046133	3300017650	Soil	MSTQQTTCAIERAAATSVAPAPAANLILGTLLLLIRP
Ga0187776_110404281	3300017966	Tropical Peatland	MMGRAMSALQTNCAIERTAGYAGAAASLILGTLLLLIRP
Ga0187822_102324541	3300017994	Freshwater Sediment	MKGRAMSALQTNCAIERAAGETGAAASLILGTLLLLIRP
Ga0187773_101410821	3300018064	Tropical Peatland	EGYSKAMSTRPNICAIERTAGHADSVASLILGLLLLIRP
Ga0194044_102763141	3300021074	Anoxic Zone Freshwater	MSTLQTICTIEPAAARSMALAGPAATLILGTLLLL
Ga0126371_100024559	3300021560	Tropical Forest Soil	MAMSTRQTICATEWTAGYAGSAESLILGTLLLLIRP
Ga0207671_113490512	3300025914	Corn Rhizosphere	QESMSALQTNCAIERKAGNAGAAASLILGTLLLLIRP
Ga0207667_108486751	3300025949	Corn Rhizosphere	MKGDLRAMTTRHQICAIERTAAKFHGLAGSAATLILGSLLLL
Ga0256814_10323611	3300026464	Sediment	PGTMSTRYDIRVLKQTADNAGTAASLILGMLLLLIRP
Ga0207462_10013901	3300026903	Soil	TMSTRYDISATERTAGNAGAAASLILGTLLLLIRP
Ga0209117_10502351	3300027645	Forest Soil	MSTRQINCAIGRAAGQDSQAGLAATLILGTLLLLIRP
Ga0209581_10093085	3300027706	Surface Soil	MKGDLDAMTTRYQVCAIERTAAMAGAAATLILGSLLLLTRP
Ga0209048_101180472	3300027902	Freshwater Lake Sediment	MSTRQTNCAIARAAGQDSQAGLAATLILGTLLLLLLIRP
Ga0247827_108584552	3300028889	Soil	QRTTMSTRYDISATERTAGNAGAAASLILGTLLLLIRP
Ga0247271_1325262	3300029903	Soil	AMSTRQTICAIGPAAAGPAPVVSVILGTLLLLIRP
Ga0265340_104014452	3300031247	Rhizosphere	MSMLQTNCTIERAAAKSMALAEPAATSILGTLLLLIRP
Ga0265314_103654081	3300031711	Rhizosphere	MSMLQTNCTIERAAAKSMALADAAATPILGTLLLLTRP
Ga0307473_102383391	3300031820	Hardwood Forest Soil	LKAMSTRTNICAIERTAGHAGAAATLILGSLLLLIRP
Ga0214473_102206922	3300031949	Soil	MSARHTICAIEPAAAKFNLVADPAATLILGTLLLLIRP
Ga0335081_100397024	3300032892	Soil	MTTRQDIRAIERTAAKFHGLAGSAATLILGSLLLLICP
Ga0335084_102448101	3300033004	Soil	DEGHSKAMSTRQTICAIERTAGYAGSAAALILGSLLLLIRP
Ga0299912_104195832	3300033489	Soil	MSARHIIRAIEPAAAKADGIGTPMATLILGTLLLLIRP
Ga0314867_174163_339_470	3300033808	Peatland	VNYEGDLKAMTTRRDICAIERTATTAGAAASLVLGSLLLLIRP

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign