Basic Information | |
---|---|
Family ID | F097844 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 44 residues |
Representative Sequence | MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 69.23 % |
% of genes near scaffold ends (potentially truncated) | 41.35 % |
% of genes from short scaffolds (< 2000 bps) | 88.46 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (54.808 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (19.231 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.038 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.846 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 80.00% β-sheet: 0.00% Coil/Unstructured: 20.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF07369 | DUF1488 | 9.62 |
PF04392 | ABC_sub_bind | 3.85 |
PF05598 | DUF772 | 2.88 |
PF06718 | DUF1203 | 1.92 |
PF00561 | Abhydrolase_1 | 1.92 |
PF13561 | adh_short_C2 | 0.96 |
PF01546 | Peptidase_M20 | 0.96 |
PF16653 | Sacchrp_dh_C | 0.96 |
PF00135 | COesterase | 0.96 |
PF07045 | DUF1330 | 0.96 |
PF02826 | 2-Hacid_dh_C | 0.96 |
PF00211 | Guanylate_cyc | 0.96 |
PF12706 | Lactamase_B_2 | 0.96 |
PF00248 | Aldo_ket_red | 0.96 |
PF13683 | rve_3 | 0.96 |
PF08734 | GYD | 0.96 |
PF02308 | MgtC | 0.96 |
PF02834 | LigT_PEase | 0.96 |
PF03466 | LysR_substrate | 0.96 |
PF13185 | GAF_2 | 0.96 |
PF04314 | PCuAC | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.85 |
COG1285 | Magnesium uptake protein YhiD/SapB, involved in acid resistance | Inorganic ion transport and metabolism [P] | 0.96 |
COG1514 | RNA 2',3'-cyclic phosphodiesterase (2'-5' RNA ligase) | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.96 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.96 |
COG2847 | Copper(I)-binding protein | Inorganic ion transport and metabolism [P] | 0.96 |
COG3174 | Membrane component of predicted Mg2+ transport system, contains DUF4010 domain | Inorganic ion transport and metabolism [P] | 0.96 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.96 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 55.77 % |
Unclassified | root | N/A | 44.23 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918025|NODE_281067_length_959_cov_17.157455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1009 | Open in IMG/M |
2166559005|cont_contig81377 | Not Available | 680 | Open in IMG/M |
2170459005|F1BAP7Q02I0TM9 | Not Available | 518 | Open in IMG/M |
2170459010|GIO7OMY02GM18Y | Not Available | 503 | Open in IMG/M |
2228664021|ICCgaii200_c0613660 | Not Available | 554 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_11105351 | Not Available | 596 | Open in IMG/M |
3300000675|JGI12335J11872_100318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 923 | Open in IMG/M |
3300000687|JGI12487J11892_100189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1197 | Open in IMG/M |
3300000690|JGI12582J11924_101325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
3300000787|JGI11643J11755_11793624 | Not Available | 895 | Open in IMG/M |
3300000890|JGI11643J12802_11512759 | Not Available | 1286 | Open in IMG/M |
3300000890|JGI11643J12802_11641577 | Not Available | 509 | Open in IMG/M |
3300001383|JGI20194J14741_1014609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 691 | Open in IMG/M |
3300003911|JGI25405J52794_10140376 | Not Available | 549 | Open in IMG/M |
3300005093|Ga0062594_100377301 | Not Available | 1131 | Open in IMG/M |
3300005332|Ga0066388_105326835 | Not Available | 652 | Open in IMG/M |
3300005437|Ga0070710_10916943 | Not Available | 633 | Open in IMG/M |
3300005439|Ga0070711_101293202 | Not Available | 633 | Open in IMG/M |
3300005713|Ga0066905_102313910 | Not Available | 502 | Open in IMG/M |
3300005764|Ga0066903_100411709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2232 | Open in IMG/M |
3300005764|Ga0066903_100933683 | Not Available | 1575 | Open in IMG/M |
3300005937|Ga0081455_10611277 | Not Available | 709 | Open in IMG/M |
3300005938|Ga0066795_10205784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
3300005947|Ga0066794_10211460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans | 582 | Open in IMG/M |
3300006049|Ga0075417_10368045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
3300006049|Ga0075417_10458265 | Not Available | 637 | Open in IMG/M |
3300006057|Ga0075026_100923293 | Not Available | 538 | Open in IMG/M |
3300006059|Ga0075017_101205996 | Not Available | 593 | Open in IMG/M |
3300006102|Ga0075015_100523457 | Not Available | 686 | Open in IMG/M |
3300006174|Ga0075014_100507548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 676 | Open in IMG/M |
3300006174|Ga0075014_100958143 | Not Available | 516 | Open in IMG/M |
3300006844|Ga0075428_100489953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1315 | Open in IMG/M |
3300006854|Ga0075425_100125986 | Not Available | 2925 | Open in IMG/M |
3300006854|Ga0075425_100394684 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
3300006914|Ga0075436_100172943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1525 | Open in IMG/M |
3300006969|Ga0075419_10000001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 144792 | Open in IMG/M |
3300009545|Ga0105237_10548365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1163 | Open in IMG/M |
3300009634|Ga0116124_1140070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
3300009762|Ga0116130_1197862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
3300010047|Ga0126382_11052270 | Not Available | 717 | Open in IMG/M |
3300010358|Ga0126370_11134410 | Not Available | 723 | Open in IMG/M |
3300010362|Ga0126377_10311749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1555 | Open in IMG/M |
3300010379|Ga0136449_104165652 | Not Available | 537 | Open in IMG/M |
3300012019|Ga0120139_1003655 | All Organisms → cellular organisms → Bacteria | 3913 | Open in IMG/M |
3300012957|Ga0164303_11545712 | Not Available | 503 | Open in IMG/M |
3300013307|Ga0157372_13283410 | Not Available | 515 | Open in IMG/M |
3300013770|Ga0120123_1018840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1380 | Open in IMG/M |
3300014056|Ga0120125_1071914 | Not Available | 781 | Open in IMG/M |
3300014165|Ga0181523_10086455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1894 | Open in IMG/M |
3300014489|Ga0182018_10548830 | Not Available | 609 | Open in IMG/M |
3300015374|Ga0132255_105692603 | Not Available | 527 | Open in IMG/M |
3300016270|Ga0182036_11312476 | Not Available | 604 | Open in IMG/M |
3300016341|Ga0182035_11717812 | Not Available | 567 | Open in IMG/M |
3300016422|Ga0182039_10149485 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
3300017940|Ga0187853_10135213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1190 | Open in IMG/M |
3300018043|Ga0187887_10441109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 768 | Open in IMG/M |
3300022694|Ga0222623_10164694 | Not Available | 863 | Open in IMG/M |
3300025457|Ga0208850_1013340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1531 | Open in IMG/M |
3300025627|Ga0208220_1163852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 560 | Open in IMG/M |
3300025862|Ga0209483_1125358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1094 | Open in IMG/M |
3300025903|Ga0207680_10526466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 843 | Open in IMG/M |
3300025916|Ga0207663_11443081 | Not Available | 554 | Open in IMG/M |
3300025941|Ga0207711_11499682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 617 | Open in IMG/M |
3300026692|Ga0207725_103355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
3300026804|Ga0207737_105860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 865 | Open in IMG/M |
3300026804|Ga0207737_110735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
3300026809|Ga0207820_102747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1681 | Open in IMG/M |
3300026817|Ga0207775_100382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4984 | Open in IMG/M |
3300026833|Ga0207728_102448 | All Organisms → cellular organisms → Bacteria | 2021 | Open in IMG/M |
3300026849|Ga0207804_119272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 608 | Open in IMG/M |
3300026872|Ga0207785_1014507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 697 | Open in IMG/M |
3300026928|Ga0207779_1006077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1758 | Open in IMG/M |
3300026941|Ga0207741_1009891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1115 | Open in IMG/M |
3300026945|Ga0207743_1006250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1363 | Open in IMG/M |
3300026982|Ga0207854_1003660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2159 | Open in IMG/M |
3300027023|Ga0207736_103860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 999 | Open in IMG/M |
3300027090|Ga0208604_1015328 | Not Available | 728 | Open in IMG/M |
3300027854|Ga0209517_10509387 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300027873|Ga0209814_10000151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 19630 | Open in IMG/M |
3300027873|Ga0209814_10498437 | Not Available | 539 | Open in IMG/M |
3300027880|Ga0209481_10265849 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 866 | Open in IMG/M |
3300027915|Ga0209069_10055281 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
3300028711|Ga0307293_10147442 | Not Available | 749 | Open in IMG/M |
3300028791|Ga0307290_10082730 | Not Available | 1168 | Open in IMG/M |
3300028799|Ga0307284_10071551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1257 | Open in IMG/M |
3300028807|Ga0307305_10121587 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
3300028807|Ga0307305_10154427 | Not Available | 1059 | Open in IMG/M |
3300028824|Ga0307310_10487326 | Not Available | 620 | Open in IMG/M |
3300030945|Ga0075373_11579473 | Not Available | 522 | Open in IMG/M |
3300031128|Ga0170823_12907047 | Not Available | 562 | Open in IMG/M |
3300031170|Ga0307498_10000016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16138 | Open in IMG/M |
3300031170|Ga0307498_10020164 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
3300031226|Ga0307497_10094886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1151 | Open in IMG/M |
3300031226|Ga0307497_10176083 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300031231|Ga0170824_107196660 | Not Available | 728 | Open in IMG/M |
3300031231|Ga0170824_115010405 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300031231|Ga0170824_125286468 | Not Available | 896 | Open in IMG/M |
3300031446|Ga0170820_13588686 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300031446|Ga0170820_16579288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2172 | Open in IMG/M |
3300031474|Ga0170818_101979475 | Not Available | 799 | Open in IMG/M |
3300031708|Ga0310686_110754818 | Not Available | 785 | Open in IMG/M |
3300032012|Ga0310902_10824335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 634 | Open in IMG/M |
3300033887|Ga0334790_004379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9344 | Open in IMG/M |
3300033888|Ga0334792_015023 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 2901 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 19.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.54% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.62% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 6.73% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.81% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.88% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.92% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.92% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.92% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.92% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.92% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.92% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.96% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.96% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918025 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000675 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 | Environmental | Open in IMG/M |
3300000687 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 | Environmental | Open in IMG/M |
3300000690 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75 | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300001383 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 | Environmental | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026692 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 38 (SPAdes) | Environmental | Open in IMG/M |
3300026804 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
3300026809 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 (SPAdes) | Environmental | Open in IMG/M |
3300026817 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 17 (SPAdes) | Environmental | Open in IMG/M |
3300026833 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes) | Environmental | Open in IMG/M |
3300026849 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes) | Environmental | Open in IMG/M |
3300026872 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 (SPAdes) | Environmental | Open in IMG/M |
3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
3300026945 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 (SPAdes) | Environmental | Open in IMG/M |
3300026982 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 7 (SPAdes) | Environmental | Open in IMG/M |
3300027023 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 1 (SPAdes) | Environmental | Open in IMG/M |
3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
b3_nosca_v_01992570 | 2140918025 | Soil | MSSPLDLLNKIIGAVIAYGPRNKTKKARKARKAAHRKKIAAIKRD |
cont_0377.00005430 | 2166559005 | Simulated | MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN |
E41_06892840 | 2170459005 | Grass Soil | MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRF |
F62_02273760 | 2170459010 | Grass Soil | DLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN |
ICCgaii200_06136602 | 2228664021 | Soil | MRTPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKIAAMKRD |
ICChiseqgaiiFebDRAFT_111053511 | 3300000363 | Soil | IGAIIAYGPKNKTKKATMARKVARRKKLAPMKPN* |
JGI12335J11872_1003181 | 3300000675 | Tropical Forest Soil | RSQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH* |
JGI12487J11892_1001891 | 3300000687 | Tropical Forest Soil | LNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH* |
JGI12582J11924_1013251 | 3300000690 | Tropical Forest Soil | RSQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH* |
JGI11643J11755_117936242 | 3300000787 | Soil | MSNPLDLLNKFIGAIIAXGPKNKTKKAXMARXXARRKKXAAMKRX* |
JGI11643J12802_115127594 | 3300000890 | Soil | MSNPLDLLNKFIGAIIAYGPKNKTKKATMARKVARRKKLAAMKRN* |
JGI11643J12802_116415772 | 3300000890 | Soil | MRTPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKIAAMKRD* |
JGI20194J14741_10146091 | 3300001383 | Arctic Peat Soil | VRSPLDLLNKIIGAVIAYGPKNKTMKARKARKAARRKKVAER |
JGI25405J52794_101403761 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MTNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN* |
Ga0062594_1003773012 | 3300005093 | Soil | MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN* |
Ga0066388_1053268352 | 3300005332 | Tropical Forest Soil | MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN* |
Ga0070710_109169432 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN* |
Ga0070711_1012932021 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKFAAMKRH* |
Ga0066905_1023139101 | 3300005713 | Tropical Forest Soil | MSNLLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD* |
Ga0066903_1004117094 | 3300005764 | Tropical Forest Soil | MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKR |
Ga0066903_1009336831 | 3300005764 | Tropical Forest Soil | MRNPLDLLNKFIGAIIAHGPKNKTKKARMARKAARRKKLAAMKRN* |
Ga0081455_106112772 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD* |
Ga0066795_102057841 | 3300005938 | Soil | MGSPLDLLNKIIGALIAYGPRNKTKKARKARKAAHRKKIAAIKRD* |
Ga0066794_102114602 | 3300005947 | Soil | MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKNFVAMKRD* |
Ga0075417_103680452 | 3300006049 | Populus Rhizosphere | MTNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKR |
Ga0075417_104582652 | 3300006049 | Populus Rhizosphere | MSNLLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN* |
Ga0075026_1009232932 | 3300006057 | Watersheds | GAARTRRSQTMSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD* |
Ga0075017_1012059961 | 3300006059 | Watersheds | MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN* |
Ga0075015_1005234571 | 3300006102 | Watersheds | MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD* |
Ga0075014_1005075483 | 3300006174 | Watersheds | LNKFIGAIIAYGPKNKTKKARMARKTARRKKLAAMKRD* |
Ga0075014_1009581431 | 3300006174 | Watersheds | MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKTARRKKLAAMKRD* |
Ga0075428_1004899532 | 3300006844 | Populus Rhizosphere | MTNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD* |
Ga0075425_1001259861 | 3300006854 | Populus Rhizosphere | MRYPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD* |
Ga0075425_1003946843 | 3300006854 | Populus Rhizosphere | MTNPLDFLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN* |
Ga0075436_1001729434 | 3300006914 | Populus Rhizosphere | MTNPLNLLNKFIGAIIAYGPKNKTKKARMARKAARRK |
Ga0075419_10000001162 | 3300006969 | Populus Rhizosphere | MTNPLDLLNKFIGSIIAYGPKNKTKKARMARKAARRKKLAAMKRN* |
Ga0105237_105483652 | 3300009545 | Corn Rhizosphere | MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRNRFAAMKRN* |
Ga0116124_11400701 | 3300009634 | Peatland | MSGPLDLLNKFIGAVIAYGPKNKTKKARKARKAARRKTIAAIKRD* |
Ga0116130_11978621 | 3300009762 | Peatland | DLLNKFIGAVIAYGPKNKTKKARKARKAARRKTIAAIKRD* |
Ga0126382_110522703 | 3300010047 | Tropical Forest Soil | FIGAVIAYGPKDKTKKARMARKAARRKKLAAMKRD* |
Ga0126370_111344101 | 3300010358 | Tropical Forest Soil | MTNLLDILNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN* |
Ga0126377_103117492 | 3300010362 | Tropical Forest Soil | MRNPLDLLKKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN* |
Ga0136449_1041656521 | 3300010379 | Peatlands Soil | MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKVAAMQRD* |
Ga0120139_10036554 | 3300012019 | Permafrost | MTNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARHKKFAAKIRE* |
Ga0164303_115457121 | 3300012957 | Soil | MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAALKRN* |
Ga0157372_132834101 | 3300013307 | Corn Rhizosphere | RRMRSSQTMRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN* |
Ga0120123_10188402 | 3300013770 | Permafrost | MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARHKKYTAKRLAK* |
Ga0120125_10719141 | 3300014056 | Permafrost | MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARHKKYTAKRLAK* |
Ga0181523_100864552 | 3300014165 | Bog | MGRPLDLLNKIIGAVIAYGPRNKTKKARKARKAARRKTLAAIKRD* |
Ga0182018_105488302 | 3300014489 | Palsa | MGSPLDLLNKTIGAVIAYGPRNKTKKARKARKVARRKKLAAIKRD* |
Ga0132255_1056926032 | 3300015374 | Arabidopsis Rhizosphere | FIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRD* |
Ga0182036_113124761 | 3300016270 | Soil | MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN |
Ga0182035_117178121 | 3300016341 | Soil | MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARSKKLAAMKRN |
Ga0182039_101494851 | 3300016422 | Soil | QTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH |
Ga0187853_101352132 | 3300017940 | Peatland | MSGPLDLLNKFIGAVIAYGPKNKTKKARKARKAARRKTIAAIKRD |
Ga0187887_104411092 | 3300018043 | Peatland | MGSPLDLLNKTIGAVIAYGPRNKTKKARKARKVARRKKLAAIKRD |
Ga0222623_101646942 | 3300022694 | Groundwater Sediment | MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN |
Ga0208850_10133404 | 3300025457 | Arctic Peat Soil | VRSPLDLLNKIIGAVIAYGPKNKTMKARKARKAARRKK |
Ga0208220_11638522 | 3300025627 | Arctic Peat Soil | MGSPLDLLNKIIGAVIAYGPRNKTKKARKATKAARRKKLAALKRD |
Ga0209483_11253581 | 3300025862 | Arctic Peat Soil | GSPLDLLNKIIGAVIAYGPRNKTKKARKATKAARRKKLAALKRD |
Ga0207680_105264663 | 3300025903 | Switchgrass Rhizosphere | MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMK |
Ga0207663_114430811 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKFAAMKRH |
Ga0207711_114996821 | 3300025941 | Switchgrass Rhizosphere | MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKR |
Ga0207725_1033551 | 3300026692 | Tropical Forest Soil | MINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH |
Ga0207737_1058602 | 3300026804 | Tropical Forest Soil | MINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH |
Ga0207737_1107351 | 3300026804 | Tropical Forest Soil | LDLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH |
Ga0207820_1027474 | 3300026809 | Tropical Forest Soil | DLLNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH |
Ga0207775_1003821 | 3300026817 | Tropical Forest Soil | RTRRSQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH |
Ga0207728_1024481 | 3300026833 | Tropical Forest Soil | ERARSQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH |
Ga0207804_1192721 | 3300026849 | Tropical Forest Soil | SQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH |
Ga0207785_10145071 | 3300026872 | Tropical Forest Soil | ARTRRSQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH |
Ga0207779_10060771 | 3300026928 | Tropical Forest Soil | SQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH |
Ga0207741_10098911 | 3300026941 | Tropical Forest Soil | TRRSQTMINPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH |
Ga0207743_10062504 | 3300026945 | Tropical Forest Soil | LNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH |
Ga0207854_10036601 | 3300026982 | Tropical Forest Soil | NPLDLLNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH |
Ga0207736_1038603 | 3300027023 | Tropical Forest Soil | DLLNKFISAIIAYGPKNKTKKARMARKAARRKKLAAIKRH |
Ga0208604_10153281 | 3300027090 | Forest Soil | MTNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKFAAMKRH |
Ga0209517_105093872 | 3300027854 | Peatlands Soil | MSNPLDLLNKFISAIIAYGPKNKTKKARMARKATRRKKFAAMKRD |
Ga0209814_1000015123 | 3300027873 | Populus Rhizosphere | MTNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN |
Ga0209814_104984371 | 3300027873 | Populus Rhizosphere | MSNLLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN |
Ga0209481_102658491 | 3300027880 | Populus Rhizosphere | MTNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD |
Ga0209069_100552811 | 3300027915 | Watersheds | MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKFAPMKRH |
Ga0307293_101474421 | 3300028711 | Soil | LLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN |
Ga0307290_100827301 | 3300028791 | Soil | MSNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN |
Ga0307284_100715511 | 3300028799 | Soil | KFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN |
Ga0307305_101215871 | 3300028807 | Soil | MSNLLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRYAAMKRN |
Ga0307305_101544272 | 3300028807 | Soil | MRDPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN |
Ga0307310_104873262 | 3300028824 | Soil | EPVNPIDLLNKFIGAIIAYGPKNKTKKSRMARKATRRKRFAAMKRN |
Ga0075373_115794732 | 3300030945 | Soil | LEPVNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN |
Ga0170823_129070471 | 3300031128 | Forest Soil | LLNKIIGAIIAYGPKNKTKKARMARKAARRKKFAAMKRH |
Ga0307498_100000166 | 3300031170 | Soil | MHNPLDLLNKFIGAIIAHGPKNKTKKARMARKAARRKKLAAMKRD |
Ga0307498_100201641 | 3300031170 | Soil | MRNLLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRD |
Ga0307497_100948861 | 3300031226 | Soil | MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAM |
Ga0307497_101760832 | 3300031226 | Soil | MRNPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAALKRN |
Ga0170824_1071966602 | 3300031231 | Forest Soil | MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKR |
Ga0170824_1150104051 | 3300031231 | Forest Soil | LEPVNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRK |
Ga0170824_1252864681 | 3300031231 | Forest Soil | QTMRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN |
Ga0170820_135886861 | 3300031446 | Forest Soil | LEPVNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKR |
Ga0170820_165792884 | 3300031446 | Forest Soil | MRNPIDLLNKFIGAIIAYGPKNKTKKARMERKAARRKRFAAMKRN |
Ga0170818_1019794751 | 3300031474 | Forest Soil | NKFIGAIIAYGPKNKTKKARMARKAARRKRFAAMKRN |
Ga0310686_1107548181 | 3300031708 | Soil | MSPLDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKFAPMKRH |
Ga0310902_108243352 | 3300032012 | Soil | MRNPIDLLNKFIGAIIAYGPKNKTKKARMARKAARRKKLAAMKRN |
Ga0334790_004379_7396_7533 | 3300033887 | Soil | MGSPLDLLNKIIGAVIAYGPRNKTKKARKARKVARRKKLAAIKRD |
Ga0334792_015023_2774_2899 | 3300033888 | Soil | MGSPLDLLNKIIGAVIAYGPRNKTKKARKARKVARRKKLAAI |
⦗Top⦘ |