NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095640

Metagenome / Metatranscriptome Family F095640

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095640
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 56 residues
Representative Sequence MRRALLGATMLFLALPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLSITKAVVYL
Number of Associated Samples 100
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 83.81 %
% of genes near scaffold ends (potentially truncated) 98.10 %
% of genes from short scaffolds (< 2000 bps) 96.19 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.381 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(14.286 % of family members)
Environment Ontology (ENVO) Unclassified
(28.571 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.571 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 25.30%    β-sheet: 19.28%    Coil/Unstructured: 55.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF12697Abhydrolase_6 15.24
PF12840HTH_20 1.90
PF00953Glycos_transf_4 0.95
PF12833HTH_18 0.95
PF10282Lactonase 0.95
PF02515CoA_transf_3 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.95
COG0472UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferaseCell wall/membrane/envelope biogenesis [M] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.38 %
UnclassifiedrootN/A7.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig92706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
2228664021|ICCgaii200_c0538446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300002568|C688J35102_119231960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei658Open in IMG/M
3300004643|Ga0062591_100694693All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300005093|Ga0062594_100997685All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300005163|Ga0066823_10109048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei576Open in IMG/M
3300005175|Ga0066673_10413833All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300005176|Ga0066679_10151321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1453Open in IMG/M
3300005179|Ga0066684_10314366All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300005180|Ga0066685_11027315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei543Open in IMG/M
3300005187|Ga0066675_10556387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria861Open in IMG/M
3300005334|Ga0068869_100481955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1033Open in IMG/M
3300005338|Ga0068868_100973533All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300005364|Ga0070673_100220108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1643Open in IMG/M
3300005445|Ga0070708_102227831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300005456|Ga0070678_100084408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2417Open in IMG/M
3300005456|Ga0070678_100257603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1466Open in IMG/M
3300005518|Ga0070699_101017238All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300005543|Ga0070672_101934964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia531Open in IMG/M
3300005548|Ga0070665_102071156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia574Open in IMG/M
3300005549|Ga0070704_100977659All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300005553|Ga0066695_10457006All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300005576|Ga0066708_10801576Not Available591Open in IMG/M
3300005587|Ga0066654_10556788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei632Open in IMG/M
3300005614|Ga0068856_101538853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria679Open in IMG/M
3300005616|Ga0068852_101360412All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300005842|Ga0068858_100942156All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300006046|Ga0066652_100919630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria834Open in IMG/M
3300006237|Ga0097621_101629560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei614Open in IMG/M
3300006903|Ga0075426_10180452All Organisms → cellular organisms → Bacteria1528Open in IMG/M
3300006954|Ga0079219_10853626All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300009101|Ga0105247_11515313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300009137|Ga0066709_100734622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1423Open in IMG/M
3300009162|Ga0075423_10765260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1021Open in IMG/M
3300009177|Ga0105248_12216323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300010321|Ga0134067_10510198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300010336|Ga0134071_10747503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300010371|Ga0134125_10270493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1888Open in IMG/M
3300010397|Ga0134124_13122286Not Available507Open in IMG/M
3300010399|Ga0134127_11085417Not Available864Open in IMG/M
3300010401|Ga0134121_10273585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1486Open in IMG/M
3300011107|Ga0151490_1097729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria787Open in IMG/M
3300012198|Ga0137364_10560815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium860Open in IMG/M
3300012206|Ga0137380_11377705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300012210|Ga0137378_10739169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium895Open in IMG/M
3300012359|Ga0137385_10349389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1266Open in IMG/M
3300012477|Ga0157336_1017889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300012683|Ga0137398_10584171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium772Open in IMG/M
3300012931|Ga0153915_13363874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300012938|Ga0162651_100007457Not Available1263Open in IMG/M
3300012958|Ga0164299_10057271All Organisms → cellular organisms → Bacteria1853Open in IMG/M
3300012958|Ga0164299_10777383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300012986|Ga0164304_10328534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1060Open in IMG/M
3300012988|Ga0164306_10205196Not Available1386Open in IMG/M
3300012988|Ga0164306_10694545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria808Open in IMG/M
3300013763|Ga0120179_1096302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300014166|Ga0134079_10098902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1111Open in IMG/M
3300014166|Ga0134079_10455461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300014497|Ga0182008_10489917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300015358|Ga0134089_10525038Not Available521Open in IMG/M
3300015374|Ga0132255_100318959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2242Open in IMG/M
3300017959|Ga0187779_10230795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1167Open in IMG/M
3300017961|Ga0187778_11338708Not Available505Open in IMG/M
3300018032|Ga0187788_10288280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium662Open in IMG/M
3300018061|Ga0184619_10338459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300018081|Ga0184625_10561606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300018089|Ga0187774_11377505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300018431|Ga0066655_10210277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1211Open in IMG/M
3300018433|Ga0066667_10787520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium807Open in IMG/M
3300019877|Ga0193722_1023480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1596Open in IMG/M
3300022694|Ga0222623_10342734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300022756|Ga0222622_10006868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5213Open in IMG/M
3300023062|Ga0247791_1088246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300024187|Ga0247672_1010681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1457Open in IMG/M
3300024224|Ga0247673_1002879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2060Open in IMG/M
3300025910|Ga0207684_10857350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria765Open in IMG/M
3300025916|Ga0207663_11705084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300025927|Ga0207687_10155122All Organisms → cellular organisms → Bacteria1751Open in IMG/M
3300025936|Ga0207670_10559583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria935Open in IMG/M
3300025940|Ga0207691_10845668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300025949|Ga0207667_10782055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria952Open in IMG/M
3300026041|Ga0207639_10813621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria871Open in IMG/M
3300026323|Ga0209472_1158647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria834Open in IMG/M
3300026697|Ga0207569_101594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300028138|Ga0247684_1016253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1168Open in IMG/M
3300028577|Ga0265318_10157925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium832Open in IMG/M
3300028705|Ga0307276_10023385All Organisms → cellular organisms → Bacteria → Terrabacteria group1231Open in IMG/M
3300028708|Ga0307295_10193240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300028718|Ga0307307_10248565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei568Open in IMG/M
3300028744|Ga0307318_10063016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1234Open in IMG/M
3300028810|Ga0307294_10024197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1627Open in IMG/M
3300028876|Ga0307286_10164043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria799Open in IMG/M
3300028880|Ga0307300_10064516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1058Open in IMG/M
3300030336|Ga0247826_10907127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria696Open in IMG/M
3300031152|Ga0307501_10075610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium807Open in IMG/M
3300031226|Ga0307497_10129055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1024Open in IMG/M
3300031240|Ga0265320_10389508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300031251|Ga0265327_10149248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1087Open in IMG/M
3300031740|Ga0307468_101564568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria614Open in IMG/M
3300031852|Ga0307410_12113358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300031938|Ga0308175_100509434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1281Open in IMG/M
3300031938|Ga0308175_102830609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300031962|Ga0307479_11652792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium595Open in IMG/M
3300032770|Ga0335085_11982159Not Available591Open in IMG/M
3300034268|Ga0372943_0315543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium995Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.52%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.76%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.86%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.86%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.86%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.90%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.90%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.90%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.95%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.95%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.95%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.95%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.95%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.95%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012477Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610Host-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300024224Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026697Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-12 (SPAdes)EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0706.000061302166559005SimulatedLTRIRILLVFAAFALLAPQAAFARGNFDPTTEFEQHEWIPIHIGPLNLSITKAVVYLM
ICCgaii200_053844612228664021SoilLFLASTAALVFPTAAFARGKFDPTTEFEQHEWISIHIGGLDLSITKAVVY
C688J35102_11923196023300002568SoilVTRRLLVVSFLALAFPASAFARGEFDPSTEFEQHVWVSIHLGPLDLSITK
Ga0062591_10069469333300004643SoilMRKALLAASVFALAVPAQAFARGDFDPTTEFEQHEWVSIHIGGLNLSIT
Ga0062594_10099768513300005093SoilMRRALLGATMLFLALPAPAFARGDFDPTTEFEQHEWVSIHLGPLNLSI
Ga0066823_1010904823300005163SoilVRRALLAATMLFLALPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLMLG
Ga0066673_1041383313300005175SoilVRRLFVALTLLALALPAPAFARGDFDPTTEFEQHEWVSIHIGGLNLSITKAVVYLMIG
Ga0066679_1015132143300005176SoilVIRRVPLVALFALAFPASAFARGTFDPSKEFELKPWLSIHLGPLDLSITKAVVYLLLGA
Ga0066684_1031436643300005179SoilVKRMLAAAAVFALTLPAPAFARGTFDPTTEFEQHDWIPIHLGPLNLSITKA
Ga0066685_1102731513300005180SoilMKRLLFVALLAFAAPQAALARGEFDPSTEFEQHKWVSIQLGPLDMSITKAVVYLLI
Ga0066675_1055638733300005187SoilMKRALAIVALAALSLPAPSFARGKFDPTTEFEQHEWIPIHIGPLNLSITKAVV
Ga0068869_10048195513300005334Miscanthus RhizosphereMMRRALLAATMLFLTLPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLMLGTVLT
Ga0068868_10097353333300005338Miscanthus RhizosphereMRRALLGATMLFLALPAPAFARGDFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLML
Ga0070673_10022010813300005364Switchgrass RhizosphereMKRVLLAATMLFLALPAPAFARGDFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLMLGTVLT
Ga0070708_10222783123300005445Corn, Switchgrass And Miscanthus RhizosphereMKRWLFVAATMALVFPAAAFARGEFDPTTEFEQHEWVSIHIGGLNLSITKAVVYLMIGT
Ga0070678_10008440863300005456Miscanthus RhizosphereMRRALLAASLFALVLPAQAFARGSFDPTTEFEQHEWVSIHVLGLNLSITKAVAYLLLGTVLTI
Ga0070678_10025760313300005456Miscanthus RhizosphereMMRRALLAATMLFLTLPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLM
Ga0070699_10101723833300005518Corn, Switchgrass And Miscanthus RhizosphereMRLRLLWTTALLALVAPSTALARGKFDPTTEFEQHEWIPIHLGSLNLSITKAVAYLML
Ga0070672_10193496413300005543Miscanthus RhizosphereMMRRVLFLSATAVLLFPAAAWARGDFDPTTEFEQHEWVSIHLGGLNLSITKAVVYLM
Ga0070665_10207115623300005548Switchgrass RhizosphereMMRRVLFLSATAVLLFPAAAWARGDFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLM
Ga0070704_10097765933300005549Corn, Switchgrass And Miscanthus RhizosphereMRRALLGATMLFLALPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLSITKAVVYL
Ga0066695_1045700633300005553SoilVRRLFVSLTLLALALPSPAFARGHFDPTTEFEQHEWVSIHIGGLNLSITKA
Ga0066708_1080157613300005576SoilVIRRLLVAAFLALAFPASAFARGTFDPSKEFEQHEWVSIHLGPLDLSITKAVVY
Ga0066654_1055678813300005587SoilLRRALLAATMLFLALPAPAFARGQFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLMLGTV
Ga0068856_10153885333300005614Corn RhizosphereVRRALVSLTMLALAVPAPAFARGDFDPTTEFEQHEWVSIHLGGLNLSITKAVVYLMISAA
Ga0068852_10136041233300005616Corn RhizosphereMMRRVLFLSATAVLLFPAAAWARGDFDPTTEFEQHEWVSIHLGSLNLSITKAVVYLML
Ga0068858_10094215633300005842Switchgrass RhizosphereMKRWLFVAATMALVFPAAAFARGEFDPTTEFEQHEWVSIHLGGLDLSITKAVVYLMIGT
Ga0066652_10091963033300006046SoilMRRALVSLTMLALALPAPAFARGDFDPTTEFEQHEWVSIHLGGLNLSITKAVVYLMI
Ga0097621_10162956023300006237Miscanthus RhizosphereMRRALLGATMLFLALPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLMLG
Ga0075426_1018045243300006903Populus RhizosphereVIRRFLVAAFLALAFPGAAFARGHFDPTTEFEQHEWVPIHIGPLNMSITKA
Ga0079219_1085362613300006954Agricultural SoilMKRALLAASVFALALPAQAFARGEFDPTKEFEQHEWVSIHVGGLNLSITKAV
Ga0105247_1151531323300009101Switchgrass RhizosphereMLFLALPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLML
Ga0066709_10073462243300009137Grasslands SoilVRRLFVSLTLLALALPSPAFARGHFDPTTEFEQHEWVSIHIGGLNLSITKAVVYLMLG
Ga0075423_1076526043300009162Populus RhizosphereVKRLFVSLTLLALALPSPAFARGEFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLFLG
Ga0105248_1221632313300009177Switchgrass RhizosphereMRRALLGATMLFLALPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLSITKA
Ga0134067_1051019813300010321Grasslands SoilMLAAAVLFALTLPAPAFARGTFDPTTEFEQHDWIPIHLGPLNLSITKA
Ga0134071_1074750313300010336Grasslands SoilVIRKLTWAVLLALAFPAAASARGTFDPSTEFEQHTWVSIHLGPLDLSITKAVVYLFIGAG
Ga0134125_1027049353300010371Terrestrial SoilMRRALLAATMLFLTLPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLMLGTVLT
Ga0134124_1312228623300010397Terrestrial SoilVKARLFAAVVAALTFPQAAFARGEFDPVKEFEQHEWVSIHLGPLDLSITKAVVYLML
Ga0134127_1108541713300010399Terrestrial SoilVKARLFAAVVVALAFPQAAFARGEFDPVKEFEQHEWVSIHLGPLDLSITKAVVYL
Ga0134121_1027358513300010401Terrestrial SoilMRRALLAATMLFLTLPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLSITKA
Ga0151490_109772933300011107SoilVRARLFAAVVVALAFPQAAFARGEFDPVKEFEQHEWVSIHLGPLDLSITKAVVYLMLGTV
Ga0137364_1056081513300012198Vadose Zone SoilVKRLLASATLLALALPAPAFARGTFDPTTEFEQHEWVSIHLGGLNLSITKA
Ga0137380_1137770513300012206Vadose Zone SoilVTRLRILLFCGALALLAPQAAFARGNFDPTTEFEQHEWIPIHVGPLNLSITKAVVYLM
Ga0137378_1073916933300012210Vadose Zone SoilMKRRLFAVALFALAFPQAAFARGTFDPVKEFEQHDWVSIHLGPLDLSITKAVAYL
Ga0137385_1034938943300012359Vadose Zone SoilVRRALLAVSLFALALPSQALARGKFDPSTEFEQHTWVSIHLGPLDLSITKAVAYLVLGAAITI
Ga0157336_101788923300012477Arabidopsis RhizosphereMKRALLAASLFALVLPAQAFARGSFDPTTEFEQHEWVSIHVLGLNLSITKAV
Ga0137398_1058417113300012683Vadose Zone SoilMRRFLIVATLALAAPPAALARGKFDPTTEFEQHEWVSIHLGPLNLSITKAVV
Ga0153915_1336387413300012931Freshwater WetlandsMKRLGILVMLALATPPAAFARGEFDPTTEYEQHAWIPIPLGPLHLSITKAVAYLILGTLL
Ga0162651_10000745713300012938SoilVKTRVLAAVFFALAFPQAAFARGEFDPVKEFEQHEWVSIHLGPLDLSITKAVVYLMLGTVLT
Ga0164299_1005727153300012958SoilMKRWVFLAATLALAFPTAAFARGKFDPTTEFEQHEWISIHIGGLNLSITKAVV
Ga0164299_1077738333300012958SoilMRRALVSLTMLALAVPAPAFARGDFDPTTEFEQHEWVSIHLGGLNLSITT
Ga0164304_1032853443300012986SoilMRRALLALTMLFLALPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLMLGTVLS
Ga0164306_1020519653300012988SoilVKARLFAAVVVALAFPQAAFARGEFDPVKEFEQHEWVSIHLGPLDLSITKAVVYLMLGT
Ga0164306_1069454533300012988SoilMRRALVSLTMLALALPAPAFARGDFDPTTEFEQHEWVSIHVLGLNLSITKAVAYLLL
Ga0120179_109630223300013763PermafrostMKRLTLAIAVAALALPADALARGKFDPAKEFEQHEWVPIHLGPLNLSITKA
Ga0134079_1009890213300014166Grasslands SoilMKRALAIVALAALSLPAPSFARGKFDPTTEFEQHEWIPIHIGPLNLSITKAVVYL
Ga0134079_1045546113300014166Grasslands SoilLTRLRILLTFAALALLAPQAAFARGNFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLMLGTL
Ga0182008_1048991733300014497RhizosphereVRYRVLTVLLVALALPASALARGEFDPSKEFEQHEWLGIHLGPLDLSITKAVVYLLIGS
Ga0134089_1052503823300015358Grasslands SoilMRSRLLAVVLFALAFPQAAFARGEFDPTKEFEQHEWVQIHLGPLDLSITKAVAYLML
Ga0132255_10031895913300015374Arabidopsis RhizosphereMKRWLFVATTVALAFPTAAFARGKFDPTTEFEQHEWISIHIGGLDLSITKAVVYLMIGTL
Ga0187779_1023079543300017959Tropical PeatlandVRLRRLGIVAVLALATPPAALARGTFDPTTEFEQHEWVSIHLGPLNLSITKAVAYLMLG
Ga0187778_1133870823300017961Tropical PeatlandVRRAVAAVALLALAAPSAALARGTFDPTTEFAQHDWIPIHIGGLDLSVTKAVVYLW
Ga0187788_1028828013300018032Tropical PeatlandVRRALLALATLALLAPANAFARGDFDPTTEFEQHEWIPIHVGPLNLSITKAV
Ga0184619_1033845913300018061Groundwater SedimentVRRALLAASLVALTLPAQAFARGQFDPTTEFEQHKWISINIAGLDLSI
Ga0184625_1056160623300018081Groundwater SedimentMRRALLAASIFALALPTQAFARGEFDPTTEFEQHEWISIHLGPLNLSITKAVVYLRYRNA
Ga0187774_1137750513300018089Tropical PeatlandMKRLLVSGMLLALALPSPAFARGHFDPTTEFEQHKWVKIQIGPLDLSITKAV
Ga0066655_1021027713300018431Grasslands SoilVIRRLLVAAFLALAFPASAFARGAFDPSKEFEQHEWVSIHLGPLDLSITKAVVY
Ga0066667_1078752013300018433Grasslands SoilVKRLLASATLLVLALPAPAFARGTFDPTTEFEQHEWVSIHLGGLNLSITKAV
Ga0193722_102348013300019877SoilMRMRRLLIVVLLALAAPPAALARGHFDPTTEFEQHEWVSIHLGPLNLSITKAVV
Ga0222623_1034273423300022694Groundwater SedimentMRRALLAASLIALTLPTQAFARGTFDPTTEFEQHKWISINIAGLDLSITKAVVYLFIG
Ga0222622_1000686883300022756Groundwater SedimentMKRALLAASVFALSLPTQAFARGEFDPTTEFEQHEWISIHLGPLNLSITKAVVYLLL
Ga0247791_108824613300023062SoilMKRALLAASVFALALPTQAFARGEFDPTTEFEQHEWVSIHLGPLDLSITKA
Ga0247672_101068113300024187SoilMKRALLAASLFALVLPAQAFARGSFDPTTEFEQHEWVSIHVLGLNLSITKAVAYL
Ga0247673_100287953300024224SoilMKRALLAASLFALVLPAQALARGSFDPTTEFEQHEWVSIHVLGLNLSITKAVAYLLLG
Ga0207684_1085735033300025910Corn, Switchgrass And Miscanthus RhizosphereMKRLLVSATLLALALPAPAFARGHFDPTTEFEQHEWVPIHLGGLNLSITK
Ga0207663_1170508413300025916Corn, Switchgrass And Miscanthus RhizosphereMSARLLLAALAVLVFPSAAFARGSFDPSKEFEQHEWLAIHLGPLNLSITKAVVYLLLGS
Ga0207687_1015512213300025927Miscanthus RhizosphereMTRALLAASVFALALPTQAFARGEFDPTTEFEQHEWVSIHLGPLDLSITKAVVY
Ga0207670_1055958313300025936Switchgrass RhizosphereMKRVLLAATMLFLALPAPAFARGDFDPTTEFEQHEWVSIHLGPLNLSITKSVVYLM
Ga0207691_1084566833300025940Miscanthus RhizosphereMKRWLFLAATAALVFPTAAFARGKFDPTTEFEQHEWISIHIGGLDLSITKAVVYLMIGTA
Ga0207667_1078205543300025949Corn RhizosphereMMRRALLAATMLFLTLPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLSITK
Ga0207639_1081362133300026041Corn RhizosphereMRRALVSLTMLALALPAPAFARGDFDPTTEFEQHEWVSIHLGGLNLSITKAVVYLMISA
Ga0209472_115864713300026323SoilMKRALAVVTLAVLSLPAPALARGKFDPTTEFEQHEWIPIHIGPLNLSITKAVVYLF
Ga0207569_10159423300026697SoilMKRALLAASVFALALPTQAFARGEFDPTTEFEQHEWVSIHLGPLDLSI
Ga0247684_101625313300028138SoilMKRALLAASLFALLLPAQAFARGSFDPTTEFEQHEWVSIHVLGLNLSITKAVAYL
Ga0265318_1015792533300028577RhizosphereMRRALALLVTLALVAPAGAFAGDFDPSVEFEQKTWLSIHLGPLDLSITKAVVYLFLAAGVSMALGI
Ga0307276_1002338543300028705SoilVKRALFLTATAVLLFPAAAFARGEFDPTDEFEQHEWVSIHLGGLNLSITKAVVYL
Ga0307295_1019324023300028708SoilMRRMLLAATMVFLALPAPAFARGDFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLMLGTVIT
Ga0307307_1024856523300028718SoilMKRALLAASVFALSLPTQAFARGEFDPTTEFEQHEWISIHLGPLNLSITKAVVYLLLAT
Ga0307318_1006301613300028744SoilVKRLLVSLALFALALPSSAFARGTFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLLIGT
Ga0307294_1002419713300028810SoilMKRALLAASVFALSLPTQAFARGEFDPTTEFEQHEWISIHLGPLNLSITKAVVYLLLATV
Ga0307286_1016404313300028876SoilMRRMLLAATMVFLALPAPAFARGDFDPTTEFEQHEWVSIHLGPLNLSITKAVV
Ga0307300_1006451633300028880SoilMRRALLAASLIALTLPTQAFARGTFDPTTEFEQHKWISINIAGLDLSITKAVVY
Ga0247826_1090712733300030336SoilVKRLFVGLTLLALALPSPAFARGEFDPTTEFEQHEWVSIHLGPLNLSITKAVVYLML
Ga0307501_1007561013300031152SoilLTRLRILLVFAAFALLAPQAAFARGNFDPTTEFEQHEWIPIHIGPLNLSITKAVVYLM
Ga0307497_1012905543300031226SoilMKSRLLAVVLFALAFPQAAFARGEFDPVKEFEQHEWVSIHLGPLDLSITKAVVYLMLA
Ga0265320_1038950823300031240RhizosphereMRWRYLLVVATLALAAPQAAFARGVFDPTTEFQQHDWVSIHLGGLNLSITKAV
Ga0265327_1014924843300031251RhizosphereMRWRYLLVVAALALAAPQAAFARGVFDPTTEFQQHDWVSIHLGGLNLSITKAVAYLM
Ga0307468_10156456813300031740Hardwood Forest SoilMMRRALLAATMLFLTLPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLSITKAVVY
Ga0307410_1211335813300031852RhizosphereMRRALLAASVFALALPTQAFARGEFDPTEEFEQHEWVSIHLGPLDLSIT
Ga0308175_10050943413300031938SoilVRYRLLTVALLALALPSAASARGEFDPSIEFEQHEWIPIHLGGLNLSITKAVAYLFL
Ga0308175_10283060923300031938SoilMRRALLAWVILGTVWLLALPTQAFARGEFDPTEEFEQHEWVSIHIGGLDLSITKAVVYLFIGAG
Ga0307479_1165279223300031962Hardwood Forest SoilMRIRLLCTAAALALAAPSTALARGKFDPTTEFEQHEWIPIHLGALNLSITKAVVYLMIG
Ga0335085_1198215923300032770SoilVKRLFVVATLFLAMPQAAFARGTFDPTTEFEQHAWVSIHIGPLDLSITKAVAYLML
Ga0372943_0315543_1_1593300034268SoilVLVLALALPGSAFARGTFDPSKEFEQHTWLSLKLGPLDLSITKAVVYLLIGAG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.