Metagenome / Metatranscriptome Family F093948

Basic Information
Family ID	F093948
Family Type	Metagenome / Metatranscriptome
Number of Sequences	106
Average Sequence Length	38 residues
Representative Sequence	MAVEFPTKVTAIFNPFGGISQIDDLMLFGIHSTKYEEFLF
Number of Associated Samples	95
Number of Associated Scaffolds	106

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	8.49 %
% of genes near scaffold ends (potentially truncated)	53.77 %
% of genes from short scaffolds (< 2000 bps)	99.06 %
Associated GOLD sequencing projects	94
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.22

Most Common Taxonomy
Group	Eukaryota (81.132 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (12.264 % of family members)
Environment Ontology (ENVO)	Unclassified (33.962 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline) (40.566 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 22.06% β-sheet: 0.00% Coil/Unstructured: 77.94%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 106 Family Scaffolds
PF03953	Tubulin_C	37.74
PF00091	Tubulin	17.92
PF11965	DUF3479	0.94
PF04130	GCP_C_terminal	0.94

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	85.85 %
Unclassified	root	N/A	14.15 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	83.02 %
Unclassified	root	N/A	14.15 %
Viruses	superkingdom	All Organisms → Viruses	2.83 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	81.13 %
Unclassified	root	N/A	14.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	4.72 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4.72 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	2.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Alveolata	clade	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata	4.72 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	3.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.89 %
Chlorophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	3.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	1.89 %
Ciliophora	phylum	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora	1.89 %
Apicomplexa	phylum	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa	1.89 %
core chlorophytes	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes	0.94 %
Dinophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	3.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1.89 %
Aconoidasida	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida	1.89 %
Intramacronucleata	subphylum	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata	1.89 %
Gonyaulacales	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales	0.94 %
Trebouxiophyceae	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	3.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	1.89 %
Haemosporida	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida	1.89 %
Oligohymenophorea	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea	1.89 %
Trebouxiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales	0.94 %
Pyrocystaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	3.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	1.89 %
Plasmodiidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae	1.89 %
Trebouxiaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae	0.94 %
Alexandrium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium	0.94 %
Hymenostomatida	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	3.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	1.89 %
Plasmodium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium	1.89 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Trebouxia	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia	0.94 %
Tetrahymenina	suborder	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	3.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1.89 %
Plasmodium (Plasmodium)	subgenus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium)	0.94 %
Tetrahymenidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae	0.94 %
unclassified Trebouxia	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	3.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Tetrahymena	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena	0.94 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	3.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	3.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	3.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	3.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	3.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	3.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Paraneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera	2.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.94 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Hemiptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera	2.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Diptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera	0.94 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Sternorrhyncha	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha	2.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Brachycera	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera	0.94 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Aphidomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha	2.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	0.94 %
Muscomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Aphidoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea	2.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	0.94 %
Eremoneura	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Aphididae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae	2.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Cyclorrhapha	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha	0.94 %
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Aphidinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae	2.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Aschiza	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Aschiza	0.94 %
Mucuna	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Mucuna	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Aphidini	tribe	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini	2.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Platypezoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Aschiza → Platypezoidea	0.94 %
Mucuna pruriens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Mucuna → Mucuna pruriens	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Aphis	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis	1.89 %
Phoridae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Aschiza → Platypezoidea → Phoridae	0.94 %
Mucuna pruriens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Mucuna → Mucuna pruriens	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Aphis	subgenus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis	1.89 %
Metopininae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Aschiza → Platypezoidea → Phoridae → Metopininae	0.94 %
Mucuna pruriens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Mucuna → Mucuna pruriens	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Aphis glycines	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines	1.89 %
Megaseliini	tribe	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Aschiza → Platypezoidea → Phoridae → Metopininae → Megaseliini	0.94 %
Mucuna pruriens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Mucuna → Mucuna pruriens	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Aphis glycines	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines	1.89 %
Megaselia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Aschiza → Platypezoidea → Phoridae → Metopininae → Megaseliini → Megaselia	0.94 %
Mucuna pruriens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Mucuna → Mucuna pruriens	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.83 %
Aphis glycines	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines	1.89 %
Megaselia scalaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Aschiza → Platypezoidea → Phoridae → Metopininae → Megaseliini → Megaselia → Megaselia scalaris	0.94 %
Mucuna pruriens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Mucuna → Mucuna pruriens	0.94 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.94 %
Trebouxia sp. A1-2	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	0.94 %
Plasmodium knowlesi	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	0.94 %
Alexandrium monilatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	0.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.94 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000756\|JGI12421J11937_10101652	Not Available	784	Open in IMG/M
3300002027\|MIS_10157457	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea	1639	Open in IMG/M
3300004642\|Ga0066612_1041919	All Organisms → Viruses → Predicted Viral	1054	Open in IMG/M
3300004764\|Ga0007754_1003965	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines	588	Open in IMG/M
3300004769\|Ga0007748_10134135	All Organisms → cellular organisms → Eukaryota	575	Open in IMG/M
3300004769\|Ga0007748_10199684	All Organisms → cellular organisms → Eukaryota	846	Open in IMG/M
3300004769\|Ga0007748_11594439	All Organisms → cellular organisms → Eukaryota	1057	Open in IMG/M
3300004787\|Ga0007755_1000677	All Organisms → cellular organisms → Bacteria	1375	Open in IMG/M
3300004793\|Ga0007760_10076416	All Organisms → cellular organisms → Eukaryota	650	Open in IMG/M
3300004794\|Ga0007751_10155405	All Organisms → cellular organisms → Eukaryota	1103	Open in IMG/M
3300004796\|Ga0007763_11490683	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Mucuna → Mucuna pruriens	780	Open in IMG/M
3300004810\|Ga0007757_11487778	All Organisms → cellular organisms → Eukaryota	511	Open in IMG/M
3300004836\|Ga0007759_10200542	Not Available	752	Open in IMG/M
3300005565\|Ga0068885_1002022	All Organisms → cellular organisms → Eukaryota	658	Open in IMG/M
3300005595\|Ga0066833_10134855	All Organisms → cellular organisms → Eukaryota	678	Open in IMG/M
3300005596\|Ga0066834_10283419	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Aschiza → Platypezoidea → Phoridae → Metopininae → Megaseliini → Megaselia → Megaselia scalaris	521	Open in IMG/M
3300005660\|Ga0073904_10197138	All Organisms → cellular organisms → Eukaryota	1177	Open in IMG/M
3300006355\|Ga0075501_1003972	All Organisms → cellular organisms → Eukaryota	877	Open in IMG/M
3300006355\|Ga0075501_1098495	All Organisms → cellular organisms → Eukaryota	730	Open in IMG/M
3300006372\|Ga0075489_1294876	All Organisms → cellular organisms → Eukaryota	913	Open in IMG/M
3300006646\|Ga0099770_1277082	All Organisms → cellular organisms → Eukaryota	620	Open in IMG/M
3300007162\|Ga0079300_10194616	All Organisms → cellular organisms → Eukaryota	533	Open in IMG/M
3300007244\|Ga0075167_10991334	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	1278	Open in IMG/M
3300007562\|Ga0102915_1200973	All Organisms → cellular organisms → Eukaryota	647	Open in IMG/M
3300007636\|Ga0102856_1059029	All Organisms → cellular organisms → Eukaryota	614	Open in IMG/M
3300009113\|Ga0115926_1001199	Not Available	868	Open in IMG/M
3300009216\|Ga0103842_1039423	Not Available	558	Open in IMG/M
3300009247\|Ga0103861_10018585	All Organisms → cellular organisms → Eukaryota	931	Open in IMG/M
3300009268\|Ga0103874_1002404	All Organisms → cellular organisms → Eukaryota	978	Open in IMG/M
3300009434\|Ga0115562_1292470	All Organisms → cellular organisms → Eukaryota	559	Open in IMG/M
3300009436\|Ga0115008_11115940	Not Available	594	Open in IMG/M
3300009543\|Ga0115099_10179236	All Organisms → cellular organisms → Eukaryota	1158	Open in IMG/M
3300009581\|Ga0115600_1081599	All Organisms → cellular organisms → Eukaryota	631	Open in IMG/M
3300009606\|Ga0115102_10002791	All Organisms → cellular organisms → Eukaryota	579	Open in IMG/M
3300009677\|Ga0115104_10341204	All Organisms → cellular organisms → Eukaryota	705	Open in IMG/M
3300009677\|Ga0115104_10782732	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1377	Open in IMG/M
3300010306\|Ga0129322_1090445	All Organisms → cellular organisms → Eukaryota	1149	Open in IMG/M
3300012020\|Ga0119869_1113132	All Organisms → cellular organisms → Eukaryota	840	Open in IMG/M
3300012408\|Ga0138265_1224288	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium	707	Open in IMG/M
3300012411\|Ga0153880_1453494	All Organisms → cellular organisms → Eukaryota	1327	Open in IMG/M
3300012413\|Ga0138258_1499206	All Organisms → cellular organisms → Eukaryota	764	Open in IMG/M
3300012522\|Ga0129326_1168803	All Organisms → cellular organisms → Eukaryota	974	Open in IMG/M
3300012711\|Ga0157607_1189290	All Organisms → cellular organisms → Eukaryota	546	Open in IMG/M
3300012726\|Ga0157597_1062360	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi	1025	Open in IMG/M
3300012754\|Ga0138278_1014073	All Organisms → cellular organisms → Eukaryota	536	Open in IMG/M
3300012776\|Ga0138275_1287547	All Organisms → cellular organisms → Eukaryota	911	Open in IMG/M
3300012780\|Ga0138271_1194350	All Organisms → cellular organisms → Eukaryota	522	Open in IMG/M
3300012919\|Ga0160422_10573142	All Organisms → cellular organisms → Eukaryota	714	Open in IMG/M
3300013065\|Ga0157547_134185	All Organisms → cellular organisms → Eukaryota	881	Open in IMG/M
3300013295\|Ga0170791_10888008	All Organisms → cellular organisms → Eukaryota	1116	Open in IMG/M
3300013295\|Ga0170791_13875730	All Organisms → Viruses → Predicted Viral	1071	Open in IMG/M
3300016681\|Ga0180043_118570	All Organisms → cellular organisms → Eukaryota	1093	Open in IMG/M
3300017497\|Ga0186404_1027077	All Organisms → cellular organisms → Eukaryota	1145	Open in IMG/M
3300018681\|Ga0193206_1025383	All Organisms → cellular organisms → Eukaryota	653	Open in IMG/M
3300018754\|Ga0193346_1016113	All Organisms → Viruses → Predicted Viral	1049	Open in IMG/M
3300018940\|Ga0192818_10241449	All Organisms → cellular organisms → Eukaryota	522	Open in IMG/M
3300018993\|Ga0193563_10175813	All Organisms → cellular organisms → Eukaryota	712	Open in IMG/M
3300019022\|Ga0192951_10357167	All Organisms → cellular organisms → Eukaryota	554	Open in IMG/M
3300019033\|Ga0193037_10276237	All Organisms → cellular organisms → Eukaryota	587	Open in IMG/M
3300019051\|Ga0192826_10232899	All Organisms → cellular organisms → Eukaryota	679	Open in IMG/M
3300019055\|Ga0193208_10644291	All Organisms → cellular organisms → Eukaryota	551	Open in IMG/M
3300019129\|Ga0193436_1070007	All Organisms → cellular organisms → Eukaryota	530	Open in IMG/M
3300019191\|Ga0180035_1000130	All Organisms → cellular organisms → Eukaryota	1361	Open in IMG/M
3300020222\|Ga0194125_10244340	All Organisms → cellular organisms → Eukaryota	1237	Open in IMG/M
3300021298\|Ga0210349_1161023	All Organisms → cellular organisms → Eukaryota	1136	Open in IMG/M
3300021334\|Ga0206696_1653871	All Organisms → cellular organisms → Eukaryota	1302	Open in IMG/M
3300021342\|Ga0206691_1608705	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	511	Open in IMG/M
3300021342\|Ga0206691_1709257	Not Available	1259	Open in IMG/M
3300021345\|Ga0206688_11098614	All Organisms → cellular organisms → Eukaryota	960	Open in IMG/M
3300021353\|Ga0206693_1160607	All Organisms → cellular organisms → Eukaryota	507	Open in IMG/M
3300021355\|Ga0206690_10204491	All Organisms → cellular organisms → Eukaryota	1085	Open in IMG/M
3300021891\|Ga0063093_1007341	All Organisms → cellular organisms → Eukaryota	776	Open in IMG/M
3300021947\|Ga0213856_1233411	Not Available	882	Open in IMG/M
3300022597\|Ga0215185_1126626	All Organisms → cellular organisms → Eukaryota	958	Open in IMG/M
3300023685\|Ga0228686_1053401	Not Available	556	Open in IMG/M
3300023700\|Ga0228707_1008303	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines	1464	Open in IMG/M
3300024484\|Ga0256332_1104149	All Organisms → cellular organisms → Eukaryota	606	Open in IMG/M
3300024539\|Ga0255231_1047539	All Organisms → cellular organisms → Eukaryota	687	Open in IMG/M
3300024848\|Ga0255229_1014256	All Organisms → cellular organisms → Eukaryota	1288	Open in IMG/M
3300026193\|Ga0208129_1108892	All Organisms → cellular organisms → Eukaryota	538	Open in IMG/M
3300028113\|Ga0255234_1107260	All Organisms → cellular organisms → Eukaryota	737	Open in IMG/M
3300028647\|Ga0272412_1075326	Not Available	1437	Open in IMG/M
3300028647\|Ga0272412_1083020	Not Available	1365	Open in IMG/M
3300030529\|Ga0210284_1350227	All Organisms → cellular organisms → Eukaryota	534	Open in IMG/M
3300030564\|Ga0210256_10060390	All Organisms → cellular organisms → Eukaryota	562	Open in IMG/M
3300030594\|Ga0210280_1067935	All Organisms → cellular organisms → Eukaryota	690	Open in IMG/M
3300030626\|Ga0210291_11170846	All Organisms → cellular organisms → Eukaryota	725	Open in IMG/M
3300030626\|Ga0210291_11562820	Not Available	850	Open in IMG/M
3300030738\|Ga0265462_10608699	Not Available	833	Open in IMG/M
3300030738\|Ga0265462_12647902	All Organisms → cellular organisms → Eukaryota	503	Open in IMG/M
3300030741\|Ga0265459_13656101	Not Available	539	Open in IMG/M
3300030777\|Ga0075402_10069763	All Organisms → cellular organisms → Eukaryota	662	Open in IMG/M
3300030865\|Ga0073972_10000061	All Organisms → cellular organisms → Eukaryota	977	Open in IMG/M
3300030915\|Ga0061011_10511897	Not Available	607	Open in IMG/M
3300030938\|Ga0138299_10825287	All Organisms → cellular organisms → Eukaryota	613	Open in IMG/M
3300030961\|Ga0151491_1315212	Not Available	799	Open in IMG/M
3300031122\|Ga0170822_16349313	All Organisms → cellular organisms → Eukaryota	955	Open in IMG/M
3300031447\|Ga0272435_1019717	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2	3448	Open in IMG/M
3300031469\|Ga0170819_15797169	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini	530	Open in IMG/M
3300031474\|Ga0170818_103396254	All Organisms → cellular organisms → Eukaryota	524	Open in IMG/M
3300031474\|Ga0170818_104273065	All Organisms → cellular organisms → Eukaryota	543	Open in IMG/M
3300031725\|Ga0307381_10179703	All Organisms → cellular organisms → Eukaryota	734	Open in IMG/M
3300032521\|Ga0314680_10073819	All Organisms → cellular organisms → Eukaryota	1602	Open in IMG/M
3300032739\|Ga0315741_10276403	All Organisms → cellular organisms → Eukaryota	1199	Open in IMG/M
3300032739\|Ga0315741_11281201	All Organisms → cellular organisms → Eukaryota → Opisthokonta	657	Open in IMG/M
3300032755\|Ga0314709_10812607	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	551	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	90.57%
Engineered	Engineered	6.60%
Host-Associated	Host-Associated	2.83%

Habitat	Taxonomy	Distribution
Marine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine	12.26%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	10.38%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	9.43%
Marine	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine	8.49%
Seawater	Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater	5.66%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	5.66%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	4.72%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	3.77%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	3.77%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	3.77%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	2.83%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.89%
River Water	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water	1.89%
Seawater	Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater	1.89%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	1.89%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	1.89%
Polar Marine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine	1.89%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.94%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.94%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.94%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	0.94%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.94%
Sinkhole Freshwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater	0.94%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.94%
Seawater	Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater	0.94%
Seawater	Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater	0.94%
Pelagic Marine	Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine	0.94%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.94%
Rock	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock	0.94%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.94%
Fungi-Associated Bovine Rumen	Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen	0.94%
Coral	Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral	0.94%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.94%
Wastewater Effluent	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent	0.94%
Swimming Pool Sandfilter Backwash	Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash	0.94%
Surface Ocean Water	Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water	0.94%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000756	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011	Environmental	Open in IMG/M
3300002027	Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k	Environmental	Open in IMG/M
3300004642	Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_10m_RNA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004764	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004769	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004787	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004793	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004794	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004796	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004810	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004836	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005565	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005595	Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF47B	Environmental	Open in IMG/M
3300005596	Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF43B	Environmental	Open in IMG/M
3300005660	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate	Engineered	Open in IMG/M
3300006355	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006372	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_RNA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006646	Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_A3_L (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300007162	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11	Environmental	Open in IMG/M
3300007244	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 RNA (Eukaryote Community Metatranscriptome)	Engineered	Open in IMG/M
3300007562	Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02	Environmental	Open in IMG/M
3300007636	Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3	Environmental	Open in IMG/M
3300009113	Microbial communities from sand-filter backwash in Singapore swimming pools - SK-1	Engineered	Open in IMG/M
3300009216	Microbial communities of water from the North Atlantic ocean - ACM47	Environmental	Open in IMG/M
3300009247	Microbial communities of water from Amazon river, Brazil - RCM14	Environmental	Open in IMG/M
3300009268	Eukaryotic communities of water from the North Atlantic ocean - ACM43	Environmental	Open in IMG/M
3300009434	Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516	Environmental	Open in IMG/M
3300009436	Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome	Environmental	Open in IMG/M
3300009543	Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009581	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009606	Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009677	Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010306	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012020	Activated sludge microbial communities from Shanghai, China - wastewater treatment plant - Activated sludge	Engineered	Open in IMG/M
3300012408	Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012411	Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012413	Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012522	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012711	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012726	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012754	Freshwater microbial communities from Lake Montjoie, Canada - M_130821_M_mt (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012776	Freshwater microbial communities from Lake Montjoie, Canada - M_130207_X_mt (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012780	Freshwater microbial communities from Lake Croche, Canada - C_130625_M_mt (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012919	Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG	Environmental	Open in IMG/M
3300013065	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES037 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013295	northern Canada Lakes metatranscriptome co-assembly	Environmental	Open in IMG/M
3300016681	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES152 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300017497	Metatranscriptome of marine eukaryotic communities from La Jolla, California in f/2 medium with natural seawater and antibiotics, no silicate, 22 C, 21 psu salinity and 636 ?mol photons light - Kryptoperidinium foliaceum CCMP 1326 (MMETSP0120_2)	Host-Associated	Open in IMG/M
3300018681	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000072 (ERX1782177-ERR1712164)	Environmental	Open in IMG/M
3300018754	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001810 (ERX1789618-ERR1719236)	Environmental	Open in IMG/M
3300018940	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000536 (ERX1782257-ERR1712105)	Environmental	Open in IMG/M
3300018993	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002703	Environmental	Open in IMG/M
3300019022	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)	Environmental	Open in IMG/M
3300019033	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)	Environmental	Open in IMG/M
3300019051	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)	Environmental	Open in IMG/M
3300019055	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)	Environmental	Open in IMG/M
3300019129	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)	Environmental	Open in IMG/M
3300019191	Estuarine microbial communities from the Columbia River estuary - R.880 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020222	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m	Environmental	Open in IMG/M
3300021298	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.460 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021334	Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021342	Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021345	Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021353	Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021355	Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021891	Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-20M (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300021947	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022597	Metatranscriptome of coral microbial communities from Popa Island, Bocas del Toro, Panama - APAL T3 (Eukaryote Community Metatranscriptome)	Host-Associated	Open in IMG/M
3300023685	Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300023700	Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024484	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024539	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024848	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300026193	Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF47B (SPAdes)	Environmental	Open in IMG/M
3300028113	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300028647	Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300030529	Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030564	Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030594	Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030626	Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030738	Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly	Environmental	Open in IMG/M
3300030741	Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly	Environmental	Open in IMG/M
3300030777	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030865	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_0.2 metaT (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030915	Coassembly of Cow X Corn Stover	Host-Associated	Open in IMG/M
3300030938	Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300030961	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_Q_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300031122	Oak Spring Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031447	Rock endolithic microbial communities from Victoria Land, Antarctica - Ricker Hills nord	Environmental	Open in IMG/M
3300031469	Fir Spring Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031725	Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032521	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032739	Forest Soil Metatranscriptomics Site 2 LB Combined Assembly	Environmental	Open in IMG/M
3300032755	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.22
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.22
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F093948

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12421J11937_101016523	3300000756	Freshwater And Sediment	MADEFPMKVTAILSPLGGISQMDDFMLFGIHSTKYDEFLL*
MIS_101574571	3300002027	Sinkhole Freshwater	MAVELPTKVTAIFKPFGGISQIDDLMLLGIHSTKYDEFLF*
Ga0066612_10419192	3300004642	Marine	MAVELPMKVTAIFNPFGGISQMELFMLFGIHSTKYDEFLF*
Ga0007754_10039651	3300004764	Freshwater Lake	MAVELPRKVTAIFKPFGGISQIEDLILLGIHSTKYEEFLF*
Ga0007748_101341351	3300004769	Freshwater Lake	HFLDAVEFPTKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF*
Ga0007748_101996841	3300004769	Freshwater Lake	MAVEFPTKVTAIFNPFGGISQMDDLMLFGIHSTKYDEFLF*
Ga0007748_115944391	3300004769	Freshwater Lake	MAVEFPKKVTAIFNPFGGISQMDDLMLFGIHSTKYDEFLF*
Ga0007755_10006772	3300004787	Freshwater Lake	LNISYIAVELPKKVTAIFNPFGGISQMDDLMLFGIHSTKYDEFLF*
Ga0007760_100764161	3300004793	Freshwater Lake	AVEFPTKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF*
Ga0007751_101554053	3300004794	Freshwater Lake	FEHFLEAVEFPTKVTAIFNPFGGISQIDDLMLFGIHSTK*
Ga0007763_114906833	3300004796	Freshwater Lake	MAVEFPKKVTAIFNPFGGISQMDDFMLFGIHSTKYEEFLF*
Ga0007757_114877781	3300004810	Freshwater Lake	MAVEFPTKVTAILSPLGGISQMDDLMLFGIHSTKYDEFLF*
Ga0007759_102005422	3300004836	Freshwater Lake	AVELPMKVTAIFNPLGGISQMDDLMLLGIHSTKYEEFLF*
Ga0068885_10020222	3300005565	Freshwater Lake	MAVEFPTKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF*
Ga0066833_101348551	3300005595	Marine	MAVEFPTNVTAIFNPLGGISQIDDLMLLGIHSTKYELFLF*
Ga0066834_102834192	3300005596	Marine	MKVTDILRPFGGISQIADLMLFGIHSTKYEEFLF*
Ga0073904_101971381	3300005660	Activated Sludge	MAVEFPIKVTAILRPFGGISHIDDLMLFGIHYTK*
Ga0075501_10039724	3300006355	Aqueous	MAVELPMKVTAIFNPFGGISQIDDLTLFGIHSTKYDEFLF*
Ga0075501_10984952	3300006355	Aqueous	MAVELPTNVTDIFKPFGGISQMDDLMLLGIHSTKYDEFLF*
Ga0075489_12948764	3300006372	Aqueous	MAVEFPTKVTAILSPLGGISQMDDLMLLGIHSTK*
Ga0099770_12770823	3300006646	Activated Sludge	MAVLFPKKVTAIFNPFGGISQILDLMLFGIHSTKYDEFLF*
Ga0079300_101946162	3300007162	Deep Subsurface	MAVELPRKVTAIFNPFGGISQIDDLILLGIHSTK*
Ga0075167_109913341	3300007244	Wastewater Effluent	MKVTAIFNPFGGISQMDDLMLFGIHYTKYEEFLF*
Ga0102915_12009732	3300007562	Estuarine	VELPTNVTDIFKPFGGISQMDDLMLLGIHSTKYDEFLF*
Ga0102856_10590291	3300007636	Estuarine	IAVEFPRKVADILIPFGGMSQKLVFILFGIHSTK*
Ga0115926_10011991	3300009113	Swimming Pool Sandfilter Backwash	MAVVLPTNVDDILSPLGGISQMDDRTLLGIHSTKY
Ga0103842_10394232	3300009216	River Water	MKIEAILRPLGGISQTEDLMLLGIHSTKYEEFLFWTLS
Ga0103861_100185852	3300009247	River Water	MAVELPTKVTAIFNPFGGISQMDDLMLFGIHSTKYEEFLF*
Ga0103874_10024042	3300009268	Surface Ocean Water	MAVEFPTKATAIFNPFGGISQIDDLMLLGIHSTKYEEFLF*
Ga0115562_12924701	3300009434	Pelagic Marine	MAVELPKKVTAIFKPLGGISQMDDLMLLGIHSTKYKEFLF*
Ga0115008_111159401	3300009436	Marine	LPMKVTAIFNPFGGISQMELFILFGIHSTKYDEFLF*
Ga0115099_101792362	3300009543	Marine	YTAVEFPMKVTAIFNPFGGISQIDDLILFGIHSTKYDEFLF*
Ga0115600_10815992	3300009581	Wetland	MAVELPTKVTAIFNPFGGISQIDDLILFGIHSTKYEEFLF*
Ga0115102_100027911	3300009606	Marine	MAVELPKKVTAIFKPLGGISQMDDLMLLGIHSTKYEEFLF*
Ga0115104_103412041	3300009677	Marine	TNVTDILRPLGGISQIAVLILFGIHSTKYEEFLF*
Ga0115104_107827322	3300009677	Marine	MAVEFPTNVTDILRPFGGISQIAVLILLGIHSTK*
Ga0129322_10904453	3300010306	Aqueous	FPTKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF*
Ga0119869_11131322	3300012020	Activated Sludge	MAVEFPMKVTAIFNPFGGISQMDDLMLFGIHYTKYEEFLF*
Ga0138265_12242883	3300012408	Polar Marine	SWMEVEFPTNVDYIFNPFGGMSQTLDLMLFGIHSTN*
Ga0153880_14534941	3300012411	Freshwater Sediment	MAVEFPTKVTAIFNPFGGISQIDDLMLFGIHSTKYEEFLF*
Ga0138258_14992061	3300012413	Polar Marine	AVELPMKVTDIFKPFGGISQIADLMLFGIHSTKYEEFLF*
Ga0129326_11688032	3300012522	Aqueous	FPTKVTAIFNPFGGISQMDDLMLFGIHSTKYELFLF*
Ga0157607_11892901	3300012711	Freshwater	MAVELPMKVTAILSPLGGISQMDDLMLLGIHSTK*
Ga0157597_10623602	3300012726	Freshwater	MAVELPMKVTAILSPLGGISQMDDLMLFGIHSTKYDEFLF*
Ga0138278_10140732	3300012754	Freshwater Lake	MAVEFPKKVTAIFNPFGGISQMDDLMLLGIHSTK*
Ga0138275_12875472	3300012776	Freshwater Lake	MAVELPRKVTAIFNPFGGISQIDDLILLGIHSTKYEEFLF*
Ga0138271_11943501	3300012780	Freshwater Lake	MEVEFPMNVHAIFKPFGGISQIEDLMLLGIHSTKYEEFLFT
Ga0160422_105731422	3300012919	Seawater	TDILRPFGGMSQIAHLRLFGIHSTKYDEFLFWTLLV*
Ga0157547_1341852	3300013065	Freshwater	AVELPTNVTDIFKPFGGISQMDDLMLLGIHSTKYDEFLF*
Ga0170791_108880085	3300013295	Freshwater	EFPTKVTAIFNPFGGISQMDDLMLFGIHSTKYDEFLF*
Ga0170791_138757301	3300013295	Freshwater	MAVEFPKKVTAIFKPFGGISQIDDLILFGIHSTK*
Ga0180043_1185701	3300016681	Freshwater	PRKVTAIFNPFGGISQIDDLILLGIHSTKYEEFLF
Ga0186404_10270773	3300017497	Host-Associated	ISWIAVELPAKATAIFKPFGGMSQTEALMLFGIHSTK
Ga0193206_10253831	3300018681	Marine	PTKATAILRPFGGISQMDDLMLFGIHSTKYEEFLF
Ga0193346_10161132	3300018754	Marine	LPTKVTDILRPFGGISQIDDLILFGIHSTKYEEFLF
Ga0192818_102414491	3300018940	Marine	VEAILRPLGGMSQTLVITLLGIHSTKYEEFLFCTLS
Ga0193563_101758131	3300018993	Marine	MKVADIFKPRGGISQTAVLTLFGIHSTKYEEFLFWMLSIC
Ga0192951_103571673	3300019022	Marine	VEFPTKVTAIFNPFGGISQIDDLILLGIHSTKYDEFLF
Ga0193037_102762371	3300019033	Marine	MEVLFPKNVTDMSNPAGATVQIDDLMLLGIHSTKY
Ga0192826_102328993	3300019051	Marine	MAVEFPTKATAIFNPFGGISQIDDLILLGIHSTKYEEFLF
Ga0193208_106442912	3300019055	Marine	MAVEFPTKATAIFNPFGGISQMDDLMLLGIHSTKYDEFLF
Ga0193436_10700072	3300019129	Marine	MAVELPTKATAIFNPFGGISQMDDLMLLGIHSTKYEEFLF
Ga0180035_10001302	3300019191	Estuarine	MAVELPTNVTDIFKPFGGISQMDDLMLLGIHSTKYDEFLF
Ga0194125_102443403	3300020222	Freshwater Lake	LVIAVELPRKVTAILRPLGGISQTAVLILFGIHSTK
Ga0210349_11610233	3300021298	Estuarine	AVEFPRNVTAIFNPLGGISQIDDLILLGIHSTKYEEFLF
Ga0206696_16538712	3300021334	Seawater	MAVELPMKVTAIFKPFGGISQIDDLMLFGIHSTKYEEFLF
Ga0206691_16087051	3300021342	Seawater	MAVEFPTKVTLIFRPLGGMSQMEDLMLLGIHSTKYEEFLF
Ga0206691_17092572	3300021342	Seawater	MAVEFPTKATAIFNPFGGISQMEDLMLFGIHSTKYEEFLF
Ga0206688_110986143	3300021345	Seawater	VEFPTKATAIFNPFGGISQILDLMLFGIHSTKYEEFLF
Ga0206693_11606073	3300021353	Seawater	VEFPTKATAIFNPFGGISQIDDLMLLGIHSTKYEAFLF
Ga0206690_102044911	3300021355	Seawater	IAVELPMKVTDILRPFGGISQIADLMLFGIHSTKYEEFLF
Ga0063093_10073414	3300021891	Marine	VEFPTKATAIFNPFGGISQMDDLMLLGIHSTKYEEFLF
Ga0213856_12334113	3300021947	Watersheds	MAVELPMKVTAIFNPFGGISQMDDLMLFGIHSTKYDEFLL
Ga0215185_11266262	3300022597	Coral	MAVEFPKKVTAIFNPLGGISQIDDFMLLGIHSTKYDEFLF
Ga0228686_10534012	3300023685	Seawater	WTAVEFPRKVTAIFRPFGGMSQTDDLMLFGIHSTKYDEFLF
Ga0228707_10083034	3300023700	Freshwater	MAVELPTKVTAILRPFGGISQIDDLMLFGIHSTKYDEFLF
Ga0256332_11041491	3300024484	Freshwater	MAVELPTKVTAIFNPFGGISQMDDLMLFGIHSTKYEEFLF
Ga0255231_10475392	3300024539	Freshwater	MAVEFPTKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF
Ga0255229_10142561	3300024848	Freshwater	MAVELPTNVTDIFKTFGGISQMDDLMLLGIHSTKYDEFLF
Ga0208129_11088921	3300026193	Marine	MAVEFPTNVTAIFNPLGGISQIDDLMLLGIHSTKYELFLF
Ga0255234_11072601	3300028113	Freshwater	MAVEFPTKVTAIFNPFGGISQMDDLMLFGIHSTKYDEFLF
Ga0272412_10753262	3300028647	Activated Sludge	MAVEFPTNVTAIFNPFGGISQIDDLMLLGIHSTKYEEFLF
Ga0272412_10830204	3300028647	Activated Sludge	MAVELPTNVTAIFKPFGGISQILDLMLFGIHSTKYDEFLF
Ga0210284_13502273	3300030529	Soil	SYIAVELPKKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF
Ga0210256_100603903	3300030564	Soil	VELPKKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF
Ga0210280_10679353	3300030594	Soil	MAVEFPKKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF
Ga0210291_111708464	3300030626	Soil	NISYIAVELPKKVTAIFNPFGGISQIDDLMLFGIHSTKYEEFLF
Ga0210291_115628201	3300030626	Soil	PMKVTDILSPFGGISQIDDLMLLGIHSTNYELSLF
Ga0265462_106086993	3300030738	Soil	PMKVTDILSPFGGISQIDDLMLLGIHSTNYELFLF
Ga0265462_126479021	3300030738	Soil	MKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLFYTF
Ga0265459_136561011	3300030741	Soil	EVEFAIKVADISSPFGGISQTDDLILLGIQGTKNALFF
Ga0075402_100697634	3300030777	Soil	VELPMNVTDIFKPFGGISQIPALMLFGIHSTKYDEFLF
Ga0073972_100000613	3300030865	Marine	AVEFPTNVTAIFNPFGGISQILDLMLFGIHSTKYEEFLF
Ga0061011_105118972	3300030915	Fungi-Associated Bovine Rumen	RKAVVLPMKVAAILRPRGGISQIDDLTLDGIHSTK
Ga0138299_108252872	3300030938	Soil	MAVLLPMNVADIGIPLGGISQIEDLMLFGIHSTNYEEDLVLTENN
Ga0151491_13152122	3300030961	Marine	MAVEFPTKATAIFNPFGGISQMDDLMLFGIHSTKYEEFLF
Ga0170822_163493133	3300031122	Forest Soil	MEVEFPMKVVDILRPLGGMSQTEDLMLLGIHSTKYVLFLFCTDN
Ga0272435_10197171	3300031447	Rock	MKVADIFNPLGGMSQTEDLTLLGIHSMKYEEFLFWT
Ga0170819_157971693	3300031469	Forest Soil	LPTNVTAIFKPFGGISQIPALMLFGIHSTKYDEFLF
Ga0170818_1033962543	3300031474	Forest Soil	LPMKVTAILSPFGGISQMDDLMLFGIHSTKYELFLF
Ga0170818_1042730651	3300031474	Forest Soil	VELPMNVVAILRPFGGMSHTDDLMLLGIHSTNYDEFLF
Ga0307381_101797032	3300031725	Marine	MAVEFPTKDTDIFNPFGGISQMDDLMLFGIHSTKYEEFLF
Ga0314680_100738191	3300032521	Seawater	MAVVLPRKVTAILRPFGGMSQTDALTLFGIHSTKY
Ga0315741_102764032	3300032739	Forest Soil	MAVELPKKVTAIFNPFGGISQIDDLMLFGIHSTKYEEFLF
Ga0315741_112812013	3300032739	Forest Soil	ELPMNVTDIFKPFGGISQMDDLMLFGIHSTKYDEFLF
Ga0314709_108126071	3300032755	Seawater	VKPQKPTDILRPFGGMSQIAHLRLFGIHSTKYDEFL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign