NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F093942

Metagenome / Metatranscriptome Family F093942

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093942
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 81 residues
Representative Sequence MTKRHWAGKDDPHYFWFYDTLYPDLLHDADDMRYINFRYTDNKVTPDPMTGYYPHDNMRYGDFLNKKEDNRF
Number of Associated Samples 90
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 27.62 %
% of genes near scaffold ends (potentially truncated) 21.70 %
% of genes from short scaffolds (< 2000 bps) 95.28 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.113 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(20.755 % of family members)
Environment Ontology (ENVO) Unclassified
(39.623 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(53.774 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.00%    β-sheet: 2.00%    Coil/Unstructured: 70.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF10601zf-LITAF-like 0.94



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.06 %
UnclassifiedrootN/A0.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001271|BBAY90_10005322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1771Open in IMG/M
3300001355|JGI20158J14315_10125029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea829Open in IMG/M
3300004112|Ga0065166_10196487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea792Open in IMG/M
3300004112|Ga0065166_10309214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → Kitasatospora cheerisanensis646Open in IMG/M
3300005527|Ga0068876_10307491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae899Open in IMG/M
3300005662|Ga0078894_10824497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea810Open in IMG/M
3300005987|Ga0075158_10183594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae1205Open in IMG/M
3300005988|Ga0075160_10177205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae1175Open in IMG/M
3300005988|Ga0075160_10182741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae1155Open in IMG/M
3300006037|Ga0075465_10154435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae523Open in IMG/M
3300006357|Ga0075502_1562175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea704Open in IMG/M
3300006415|Ga0099654_10582890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae706Open in IMG/M
3300006641|Ga0075471_10318539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea789Open in IMG/M
3300006641|Ga0075471_10362408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae731Open in IMG/M
3300006803|Ga0075467_10031736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae3359Open in IMG/M
3300006803|Ga0075467_10308270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea841Open in IMG/M
3300006917|Ga0075472_10373704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea704Open in IMG/M
3300006917|Ga0075472_10579401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea561Open in IMG/M
3300006920|Ga0070748_1076410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae1298Open in IMG/M
3300007171|Ga0102977_1223559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1232Open in IMG/M
3300007516|Ga0105050_10398702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea825Open in IMG/M
3300007600|Ga0102920_1142377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea767Open in IMG/M
3300007862|Ga0105737_1206741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea520Open in IMG/M
3300008114|Ga0114347_1149175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea841Open in IMG/M
3300008937|Ga0103740_1038298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea588Open in IMG/M
3300009172|Ga0114995_10294547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani894Open in IMG/M
3300009436|Ga0115008_10495259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae873Open in IMG/M
3300009441|Ga0115007_10421373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae875Open in IMG/M
3300009592|Ga0115101_1653821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea710Open in IMG/M
3300009599|Ga0115103_1053167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea697Open in IMG/M
3300009599|Ga0115103_1105374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea732Open in IMG/M
3300009608|Ga0115100_10469989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae652Open in IMG/M
3300009677|Ga0115104_10985595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae671Open in IMG/M
3300009785|Ga0115001_10727273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea600Open in IMG/M
3300010392|Ga0118731_101028616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea737Open in IMG/M
3300011009|Ga0129318_10123723All Organisms → cellular organisms → Eukaryota → Opisthokonta764Open in IMG/M
3300012504|Ga0129347_1017211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea631Open in IMG/M
3300012716|Ga0157605_1016632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea518Open in IMG/M
3300012782|Ga0138268_1372913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea556Open in IMG/M
3300012954|Ga0163111_12720431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea505Open in IMG/M
3300013014|Ga0164295_11604941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae504Open in IMG/M
3300013308|Ga0157375_12679658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae596Open in IMG/M
3300014745|Ga0157377_11614822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae520Open in IMG/M
3300017772|Ga0181430_1105677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea836Open in IMG/M
3300017788|Ga0169931_10088919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea3027Open in IMG/M
3300017957|Ga0181571_10443356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea800Open in IMG/M
3300018599|Ga0188834_1019986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea695Open in IMG/M
3300018684|Ga0192983_1037640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea670Open in IMG/M
3300018698|Ga0193236_1048990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea564Open in IMG/M
3300018710|Ga0192984_1070371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea627Open in IMG/M
3300018880|Ga0193337_1027467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae676Open in IMG/M
3300018980|Ga0192961_10140874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea735Open in IMG/M
3300018989|Ga0193030_10241082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani594Open in IMG/M
3300019011|Ga0192926_10453720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea535Open in IMG/M
3300019021|Ga0192982_10305333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea571Open in IMG/M
3300019027|Ga0192909_10276212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea524Open in IMG/M
3300019032|Ga0192869_10275559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea732Open in IMG/M
3300019037|Ga0192886_10192959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea651Open in IMG/M
3300019045|Ga0193336_10250338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae748Open in IMG/M
3300019048|Ga0192981_10218634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae739Open in IMG/M
3300019048|Ga0192981_10286717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae619Open in IMG/M
3300019049|Ga0193082_10301183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea832Open in IMG/M
3300019150|Ga0194244_10122456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea508Open in IMG/M
3300019151|Ga0192888_10162230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea706Open in IMG/M
3300020146|Ga0196977_1101439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea666Open in IMG/M
3300020202|Ga0196964_10277709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae790Open in IMG/M
3300021303|Ga0210308_1076014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea663Open in IMG/M
3300021898|Ga0063097_1099046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300021941|Ga0063102_1117606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea581Open in IMG/M
3300021950|Ga0063101_1081373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae648Open in IMG/M
3300022374|Ga0210311_1012235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1033Open in IMG/M
3300025732|Ga0208784_1055101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1220Open in IMG/M
3300025872|Ga0208783_10215240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea789Open in IMG/M
3300025887|Ga0208544_10010408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae5333Open in IMG/M
3300026495|Ga0247571_1080788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae749Open in IMG/M
3300026495|Ga0247571_1125163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea602Open in IMG/M
3300027760|Ga0209598_10357367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae550Open in IMG/M
3300027781|Ga0209175_10106364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae1206Open in IMG/M
3300027781|Ga0209175_10111285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae1177Open in IMG/M
3300027805|Ga0209229_10415007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea583Open in IMG/M
3300027816|Ga0209990_10259447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae788Open in IMG/M
3300028137|Ga0256412_1270179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae626Open in IMG/M
3300028595|Ga0272440_1145674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae780Open in IMG/M
3300030564|Ga0210256_10215900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae811Open in IMG/M
3300030621|Ga0247655_10129478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea678Open in IMG/M
3300030625|Ga0210259_11431850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea706Open in IMG/M
3300030741|Ga0265459_11307627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae806Open in IMG/M
3300030741|Ga0265459_11340349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae799Open in IMG/M
3300030741|Ga0265459_12138366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea676Open in IMG/M
3300030741|Ga0265459_12933236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea595Open in IMG/M
3300030777|Ga0075402_11816917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae638Open in IMG/M
3300030840|Ga0074020_10019958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae761Open in IMG/M
3300031231|Ga0170824_103136363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea691Open in IMG/M
3300031446|Ga0170820_12756114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae537Open in IMG/M
3300032092|Ga0315905_11191862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea623Open in IMG/M
3300033984|Ga0334989_0052242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2244Open in IMG/M
3300033984|Ga0334989_0210573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1065Open in IMG/M
3300033984|Ga0334989_0285801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea882Open in IMG/M
3300033984|Ga0334989_0303290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea849Open in IMG/M
3300034022|Ga0335005_0339203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea881Open in IMG/M
3300034064|Ga0335001_0365488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae779Open in IMG/M
3300034068|Ga0334990_0618841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea567Open in IMG/M
3300034105|Ga0335035_0362698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii834Open in IMG/M
3300034355|Ga0335039_0220839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1037Open in IMG/M
3300034355|Ga0335039_0624539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea526Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine20.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater12.26%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.49%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.60%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake5.66%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent4.72%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.83%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.83%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.89%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.94%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.94%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.94%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.94%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.94%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.94%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.94%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.94%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.94%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.94%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.94%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.94%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.94%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.94%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.94%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.94%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001271Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY90Host-AssociatedOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008937Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3CEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300011009Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNAEnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012716Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018698Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001473 (ERX1809465-ERR1739846)EnvironmentalOpen in IMG/M
3300018710Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809766-ERR1740136)EnvironmentalOpen in IMG/M
3300018880Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782455-ERR1712124)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300020202Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10EnvironmentalOpen in IMG/M
3300021303Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1080 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022374Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1166 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028595Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030621Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030777Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030840Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
BBAY90_1000532213300001271Macroalgal SurfaceMVERRIQGKDDLHYFWYYDTLYPDMFFDEEDMRYINFRYTDAKVVPDPLTAYYPYDHLKYGQFLNKKEENLFTKAPTYN*
JGI20158J14315_1012502913300001355Pelagic MarineMVKRHWEGKDDPHYFWYYDTLYPDLLHDADDMRYINFRYTDAKVTPDPMTGYYPHDNMRYGSWLSKKEDNRFVDRIATENQVKV*
Ga0065166_1019648723300004112Freshwater LakeVCFRMTRFLYFMIKRHWEGKDDQHYFWYYDTLYPDLLHDEEDMRYIGFRYTDQKVSPDGMTGYYPYQNMRYGDFLHKKEDSRGITRK*
Ga0065166_1030921413300004112Freshwater LakeMAGRHFEGKDDLHVFWYSDTNYPDMLHDEEDMRYINFRYTDAKVSPDPITGYYPYDHLKYGKFLDKKGSQYLPTKDLPHV*
Ga0068876_1030749113300005527Freshwater LakeMILKHWEGKDDLHYYWYNDSNFPDMLHDEEDMRYINFRYTDQKVSPDPLTGYYPYDHLKYGKWLDKKGDQYHGTKENHGY*
Ga0078894_1082449723300005662Freshwater LakeMIKRHYEGKDDLHVFWYSDSNYPDMFHDEDDMRYINFRYTDAKVAPDPLTGYYPYDHLKYGKFLDKKGEAYLPTREQPHVQKI*ETISLLLVD*
Ga0075158_1018359413300005987Wastewater EffluentMTKLLASMVVRHWQGKDDLHYFWYYDTLYPDMFHDEEDMRYINFRYTDNKVVPDPLTGYYPYDNLKYGKFLDKKGDSYDTNPYKY*
Ga0075160_1017720523300005988Wastewater EffluentMSKLMVTMIVRHWQGKDDLHYTWYYDTLYPDMFHDEEDMRYINFRYTDNKVVPDPLTGYYPYDNLKYGKFLDKKGDAYSSGQNPYRYRE*
Ga0075160_1018274123300005988Wastewater EffluentMVVRHWQGKDDLHYFWYYDTLYPDMFHDEEDMRYINFRYTDNKVVPDPLTGYYPYDNLKYGKFLDKKGDSYDTNPYKY*
Ga0075465_1015443513300006037AqueousRHWEGKDDQHYFWYYDTLYPDLLHDEDDMRYINFRYTDQKVSPDPMTGYYPYQNVRYGDFLNKKEDNTYVNRPKE*
Ga0075502_156217523300006357AqueousMIKRHWEGKDDPHYFWYYDTLYPDLIHDEDDMRYINFRYTDQKLQVEEMTGYYPYDHLRYGDFLSKKEQS*
Ga0099654_1058289013300006415LakeMTKFMYFMVKRHWEGKDDQHYFWYYDTLYPDLLHDEDDMRYINFRYTDQKVSPDPMTGFYPYQHMRYEKFLNKKEDSTYSNRPTQ*MVSECTSIVHI*
Ga0075471_1031853913300006641AqueousMIKRHWRGEDDMHMTWYQDTMYPDLISDADDMRYINFRYSDSKVVPEPLTGYYPHEHARYGDILNKKRDNSGMDAYKVYQHYRRDD*
Ga0075471_1036240813300006641AqueousMTRFMYFMIKRHWEGKDDQHYFWYYDTLYPDLLHDADDMRYINFRYTDQQVSPTDMTGYYPWSDLKYGNFLREKKDT*
Ga0075467_1003173683300006803AqueousMTIRMTKFMYFMVKRHWEGKDDLHYWWYYDTLYPDMLHDEEDMRYINFRYTDNKVSPDAMNGYYPYMNMRYGDFLNKKEDTRYVFKNQEKME*
Ga0075467_1030827023300006803AqueousMSRFLYYMIDRHWKGKDDQHYFWYYDTLYPDLLHDADDMRYINFRYTDQKVSPEPLTGYYPYQNIRYGDFLNEKKDNRFVYRSESKIDTE*
Ga0075472_1037370423300006917AqueousMIKRHWAGNDDPHYFWFYDTAYPDMILDEDDMKPINFRYSDQKVSPDAMNGYYPYGHLRYGDFLNKKEDTSFTKRALSPTATQIPE*
Ga0075472_1057940113300006917AqueousMLRPIFWAYICARMTRFLYHMIKRHWEGNDDPHYFWFYDTAYPDMILDADDMKPINFRYTDNQVSPDALNGYYPYSHLRYGDFLKKKEDT*
Ga0070748_107641013300006920AqueousMTIRMTKFMYFMVKRYWEGKDDLHYWWYYDTLYPDMLHDEEDMRYINFRYTDNKVSPDAMNGYYPYMNMRYGDFLNKKEDTRYVFKNQEKME*
Ga0102977_122355923300007171Freshwater LakeLIVRYYQGKGDLHYYWYYDSLFPDLFHDEDDMRYINFRYTDAKVAPDALTGYYPFENMKYGPFLNKKEENDYVRGWHWSGDK*
Ga0105050_1039870213300007516FreshwaterMIKRHWEGKDDLHYTFYYDTLYPDLLHDADDMRYINFRYTDNKVTPEPMTGYYPHDNMRYGDFLNKKKDNSYTKKSQVYADFRVEE*
Ga0102920_114237713300007600EstuarineMTKFMYFMVKRHWEGKDDQHYFWYYDTLYPDLLHVEDDMRYINFRYTDQKVSPDPMTGFYPYQHMRYEKFLNKKEDSTYSNRPAQ*
Ga0105737_120674113300007862Estuary WaterMIKRHWAGKDDQHYFWYYDTLYPDLLHDEEDMRYIGFRYTDSKVSPDAMTGYYPYQNQRYGDFLNKKEDSTYTQAKIPRAE*
Ga0114347_114917523300008114Freshwater, PlanktonWTYVCFRMTRFLYFMIKRHWEGKDDQHYFWYYDTLYPDLLHDEEDMRYIGFRYTDQKVSPDGMTGYYPYQNMRYGDFLHKKEDSRGITRK*
Ga0103740_103829813300008937Ice Edge, Mcmurdo Sound, AntarcticaMIKRHWEGKDDQHYFWYYDTLYPDLIHDEDDMRYINFRYTDQKLQVEELTGYYPYDHLRYGDFLSKKE*
Ga0114995_1029454713300009172MarineMTKRHWRGEDDMHYTWYYDTLYPDLLHDADDMRYINFRYTDAKVTPEPMTGYYPYDNLRYGKFLNKKEDTQ*
Ga0115008_1049525923300009436MarineMSRFLYYMIDRHWKGKDDQHYFWYYDTLYPDLLHDSDDMRYINFRYTDQKVSPEPLTGYYPYQNIRYGDFLNKKEDNTFTKR*
Ga0115007_1042137313300009441MarineMTKHLIFMSLRHLRGEDELHYWWYYDTLYPDMLHDEEDMRYINFRYTDQKVSPDAMTGYYPYDNLKYGDFLGKKADHKY*
Ga0115101_165382113300009592MarineMIKRHWEGNDDPHYTWFYDTLYPDLLHDADDMRYINFRYTDAKVTPEPITGYYPHDHMHYAPFLNKKEDNTFRNMATMDK*
Ga0115103_105316723300009599MarineMIKRHWEGKDDPHYFWYYDTLYPDLIHDEDDMRYINFRYTDQKLQVEEMTGYYPYDHLRYGDFLSKKE*
Ga0115103_110537413300009599MarineMIQRHWQGKDDAHYFWYYDTLYPDLLHDADDMRYINFRYTDQRVTPEPMTGYFPHDNMRYGDFLNKKEDNTFTKMSEVNKMKV*
Ga0115100_1046998913300009608MarineMTKFLYFMVKRHWEGKDDMHYFWYYDTLYPDLLHDEEDMRYVNFRYTDNKVAPDAMNGYYPYQHMRYGDFLNKKTDTQYTTNVPMKH*
Ga0115104_1098559513300009677MarineMIKRHWFPSAHLGEDDQHYFWYYDTLYPDLLHDADDMRYINFRYTDQKVSPDAMTGYYPYQNMRYGDFLAKKEDTTFRTHSG
Ga0115001_1072727323300009785MarineMTKRHWRGEDDMHYTWYYDTLYPDLLHDADDMRYINFRYTDAKVTPEPMTGYYPHDNMRYGKFLNKKEDNINP*
Ga0118731_10102861623300010392MarineMTLRHWAGEDDQHYFWYYDTLYPDMLHDEEDMRYINFRYSDQKVVPDQLTGYYPFENLKYRGFLNKKHDQAKINSKE*
Ga0129318_1012372313300011009Freshwater To Marine Saline GradientDQHYFWYYDTLYPDLLHDEDDMRYINFRYTDQKVSPDPMTGYYPYQNIRYGDFLNKKEDNTYTSRPKE*
Ga0129347_101721113300012504AqueousMMTKRHWAGKDDPHYTWFYDTMYPDLLHDADDMRYINFRYTDAKVTPEPMTGYYPHDNMRYGDFLNKKEDNQFTNI
Ga0157605_101663213300012716FreshwaterMTKFMYFMVKRHWEGKDDQHYFWYYDTLYPDLIHDEDDMRYINFRYTDQKVSPDPMTGFYPYQHMRYEKFLNKKEDSTYSNRPA*
Ga0138268_137291313300012782Polar MarineMIKRHWDGKDDPHYTWFYDTLYPDLLHDADDMRYINFRYTDQKVTPEPMTGYYPHDYMRYGDFINKKEDNTFTKGHVAR*
Ga0163111_1272043113300012954Surface SeawaterMTKRHWEGKDDPHYTWFYDTLYPDLLHDADDMRYINFRYTDQKVTPEPMTGYYPHDYMRYGDFINKKEANQFTNGFVARQ*
Ga0164295_1160494123300013014FreshwaterMTRTLGAMIVRHYEGKDDLHYYWYYDSNYPDMLHDEEDMRYINFRYTDAKVSPDPMTGYYPYDNLKYGKFLDKKASSY*
Ga0157375_1267965813300013308Miscanthus RhizosphereLHYFWFYDTLYPDMFFDEEDMRYINFRYTDAKVVPDPLTGYYPYENLKYGEFLNKKEENMPIKEGQFA*
Ga0157377_1161482213300014745Miscanthus RhizosphereAHMIKRHWQGKDDLHYFWFYDTLYPDMFFDEEDMRYINFRYTDAKVVPDPLTGYYPYENLKYGEFLNKKEENMPIKEGQFA*
Ga0181430_110567713300017772SeawaterMIKRHWEGKDDPHYFWYYDTLYPDLIHDEDDMRYINFRYTDQKLQVEEMTGYYPYDHLRYGDFLSKKE
Ga0169931_1008891923300017788FreshwaterMFWTYICYRMTKFMYFMVKRHWEGKDDQHYFWYYDTLYPDLLHDEDDMRYINFRYTDQKVSPDPMTGYYPYQNVRYGDFLNKKEDNTYVNRPRE
Ga0181571_1044335633300017957Salt MarshMTTRHWEGKDDPHYTWYYDTLYPDLLHDADDMRYINFRYTDAKVTPEPMTGYYPHDNMRYGKFLNKKEDN
Ga0188834_101998613300018599Freshwater LakeMIKRHWEGKDDPHYFWYYDTLYPDLIHDEDDMRYINFRYTDQKLQVEEMTGYYPYDHLRYGDFLSKKEQS
Ga0192983_103764013300018684MarineMTRFLYYMIDRHWKGKDDQHYFWYYDTLYPDLLHDADDMRYINFRYTDQKVSPEPLTGYYPYQNIRYGDFLNKKEDSRFIYKTESKINNAT
Ga0193236_104899013300018698MarineMIYRHWFPSAEGKDDQHYFWYYDTLYPDMFHDADDMRYINFRYTDNKVVPDGLTGYYPYQQIRYGDFLNKKEDSTYTYKSMAPSADGQXTY
Ga0192984_107037113300018710MarineMIKRHWEGKDDQHYFWYYDTLYPDLIHDEDDMRYINFRYTDQKLQVEELTGYYPYDHLRYGDFLSKKE
Ga0193337_102746723300018880MarineMVKRHWQGKDDAHYYWYYDTLYPDLLHDADDMRYINFRYSDNKVTPEPMTGYYPHDNMRYGSFLNKKEDNRLLTYKD
Ga0192961_1014087413300018980MarineMIKRHWEGKDDPHYFWYYDTLYPDLIHDEDDMRYINFRYTDQKLQVEELTGYYPYDHLRYGDFLGKKEQS
Ga0193030_1024108213300018989MarineMIKRHWNGQDDMHYTWFYDTLYPDLLHDADDMRYINFRYTDAKVTPEPLTGYYPHDNMHYGPFLNKKEDNTFRNMNNSKFN
Ga0192926_1045372013300019011MarineMIYRHWFPSPEGKDDQHYFWYYDTLYPDMFHDADDMRYINFRYTDNKVVPDGLTGYYPYQQIRYGDFLNKKEDSSYTYKSMAPSADGQ
Ga0192982_1030533323300019021MarineMWTYITIRLTRAVWWMTKRHWEGKDDPHYTWFYDTLYPDLLHDADDMRYINFRYTDQKVTPEPMTGYYPHDYMRYGDFINKKEANQFT
Ga0192909_1027621213300019027MarineMIKRHWEGKDDPHYTWYYDTLYPDLLHDADDMRYINFRYTDAKVVPDPMTGYFPFDNMRYGDFLNKKEDNQFVNAGAILKSLGMKF
Ga0192869_1027555923300019032MarineMIKRHWEGKDDPHYFWYYDTLYPDLVHDEDDMRYINFRYTDQKLQAEEMTGYYPYDHMRYGDFLDKKEDTLYNKRPSNAQVAK
Ga0192886_1019295913300019037MarineMIKRHWFPSPHLGEDDQHYFWYYDTLYPDLLHDADDMRYINFRYTDQKVSPDAMIGYYPYQNMRYGDFLSKKEDTTYRFRDGAAAHAKVE
Ga0193336_1025033823300019045MarineMVKRHWQGKDDAHYYWYYDTLYPDLLHDADDMRYINFRYSDNKVTPEPMTGYYPHDNMRYGSFLNKKEDNRLLTYKDAE
Ga0192981_1021863423300019048MarineMTRFLYYMVRRHWEGKDDMHYFWYYDTLYPDLLHDEDDMRYINFRYTDQKVSPDGMTGYYPHANERYGDWLHKKSDAGDQTNAP
Ga0192981_1028671723300019048MarineMTRFLYYMIKRKWEGKDDPHYFWYYDTLYPDLLHDEDDMRYINFRYTDQKVSPDGMTGYYPHANERYG
Ga0193082_1030118323300019049MarineMIKRHWFPSPHLGEDDQHYFWYYDTLYPDLLHDADDMRYINFRYTDQKVSPDAMIGYYPYQNMRYGEFLSKKDDTTYRFRDGAAAHAKVD
Ga0194244_1012245613300019150MarineFLGFMILRHWEGKDDPHYFMYYDTLYPDLLHDEEDMRYINFRYSDQKVVPDDLTGYYPYTNMRYGNFLHKKEDIRYVDKSSAPPV
Ga0192888_1016223013300019151MarineMIYRHWLPGPEGKDDQHYFWYYDTLYPDMFHDADDMRYINFRYTDNKVVPDGLTGYYPYQQIRYGDFLNKKEDSSYTYKSMAPKADGQXNHPL
Ga0196977_110143913300020146SoilMIKNHWAGKDELHYFWYYDTLYPDLIFDEDDMRYINFRYTDQKVAPDPLTGYYPYEHLKYGEFLNKKEDNLPFQRGM
Ga0196964_1027770923300020202SoilYYMVLRHLDGKGDLHYHWYYDTLYPDMFFDEEDMRYINFRYTDAKVVPDPLTGYYPYDNMKYGGWLNQKSEDALPTKVNLLK
Ga0210308_107601413300021303EstuarineMIKRHWAGKDDQHYFWYYDTLYPDLLHDEEDMRYIGFRYTDSKVSPDAMTGYYPYQNQRYGDFLNKKEDSTYTQAKIPRAE
Ga0063097_109904613300021898MarineMIQRHWAGKDDLHYFWYYDTLYPDLLHDSDDMRYINFRYTDARVTPENLTGYYPYANMRFNSFLNKKEESTMGNMKNA
Ga0063102_111760623300021941MarineMIKRHLEGKDDPHYFWYYDTLYPDLIHDEDDMRYINFRYTDQKLQVEEMTGYYPYDHLRYGDFLSK
Ga0063101_108137323300021950MarineMWTYCCYRMTKFLGFMIQRHWQGNDDQHYFWYYDTLYPDLVCDEEDMRYIGFRYTDQKVSPDAMTGYYPYANMRYGDFLNKKEDSRFLNYKKE
Ga0210311_101223523300022374EstuarineLGYMIKRHWAGKDDQHYFWYYDTLYPDLLHDEEDMRYIGFRYTDSKVSPDAMTGYYPYQNQRYGDFLNKKEDSTYTQAKIPRAE
Ga0208784_105510113300025732AqueousMTRFMYFMIKRHWEGKDDQHYFWYYDTLYPDLLHDADDMRYINFRYTDQQVSPTDMTGYYPWSDLKYGNFLREKKDT
Ga0208783_1021524013300025872AqueousMIKRHWRGEDDMHMTWYQDTMYPDLISDADDMRYINFRYSDSKVVPEPLTGYYPHEHARYGDILNKKRDNSGMDAYKVYQHYRRDD
Ga0208544_1001040813300025887AqueousMTIRMTKFMYFMVKRHWEGKDDLHYWWYYDTLYPDMLHDEEDMRYINFRYTDNKVSPDAMNGYYPYMNMRYGDFLNKKEDTRYVFKNQEKME
Ga0247571_108078823300026495SeawaterMIKRHWEGKDDPHYFWYYDTLYPDLLHDADDMRYINFRYTDAKVTPDPMTGYYPHDQMRYGDFLNKKEDNRFVKSHLAASQIREAN
Ga0247571_112516323300026495SeawaterMIKRHWEGNDDPHYTWFYDTLYPDLLHDADDMRYINFRYTDAKVTPEPITGYYPHDHMHYAPFLNKKEDNTFRNMA
Ga0209598_1035736713300027760Freshwater LakeMAGRHFEGKDDLHVFWYSDTNYPDMLHDEEDMRYINFRYTDAKVSPDPITGYYPYDHLKYGKFLDKKGSQYLPTKDLPHV
Ga0209175_1010636413300027781Wastewater EffluentMTKLLASMVVRHWQGKDDLHYFWYYDTLYPDMFHDEEDMRYINFRYTDNKVVPDPLTGYYPYDNLKYGKFLDKKGDSYDTNPYKY
Ga0209175_1011128513300027781Wastewater EffluentMSKLMVTMIVRHWQGKDDLHYTWYYDTLYPDMFHDEEDMRYINFRYTDNKVVPDPLTGYYPYDNLKYGKFLDKKGDAYSSGQNPYRYRE
Ga0209229_1041500713300027805Freshwater And SedimentMIKRHWEGNDDPHYFWFYDTAYPDMILDADDMKPINFRYTDNQVSPDALNGYYPYSHLRYGDFLKKKEDT
Ga0209990_1025944713300027816Freshwater LakeMILKHWEGKDDLHYYWYNDSNFPDMLHDEEDMRYINFRYTDQKVSPDPLTGYYPYDHLKYGKWLDKKGDQYHGTKENHGY
Ga0256412_127017913300028137SeawaterMTKRHWAGKDDPHYFWFYDTLYPDLLHDADDMRYINFRYTDNKVTPDPMTGYYPHDNMRYGDFLNKKEDNRF
Ga0272440_114567413300028595Marine SedimentMTKRHWLGKDDAHYTWFNDTNYPDLLHDADDQRYINFRYSDQRVVPENFTGFYPHAFLRYGKWLNKKEDTLFTPREKNDPLAPIV
Ga0311369_1050301213300029910PalsaMLRPIFWGYIAARMTRFLFYMIVRHYQGKDDLHYFWYYDTNYPDMFHDAEDMRYINFRYTDAKVVPDALNGYYPQDNMKYGK
Ga0210256_1021590023300030564SoilMIVRHYEGKDDLHYFWYYDTNYPDMFHDEEDMRYINFRYTDAKVVPDPLTGYYPHEHMKYGNFLNKKVENLPIRENY
Ga0247655_1012947813300030621SoilMIRRHWEGKDDLHYFWYYDTLYPDMFFDEEDMRYINFRYSDAKVVPDALTGYYPFENLKYGDFLNKKKDLPTVPYS
Ga0210259_1143185013300030625SoilMIKNHWQGKDDLHYFWYYDTLYPDMFFDEEDMRYINFRYSDNKVAPDPLIGYYPYDNLKYGKFLNKKEENQFIRTRSIDQ
Ga0265459_1130762723300030741SoilMIIRHYEGKDDLHYFWYYDTNYPDMFHDEEDMRYINFRYTDAKVVPDPLTGYYPHEHMKYGNFLNKKVENLPIRENY
Ga0265459_1134034923300030741SoilMIKRHWEGKDDLHYFWYYDTLYPDMFHDEEDMRYINFRYTDNKVVPDPLIGYYPHENLKYGKFLNKKEENLPNFRMNNVGPM
Ga0265459_1213836613300030741SoilMTIRHWEGKDELHYFWYYDTNYPDMFHDEDDMRYINFRYTDAKVVPDALTGYFPHDDNKYGAFLNKKRENLPIRSDWN
Ga0265459_1293323623300030741SoilMYYMVKRHWEGKDDLHYFWYYDTLYPDMFHDEEDMRYINFRYTDNKVVPDPLVGYYPHEHMKYGRFLNKKEENLGLAPKNTNVI
Ga0075402_1181691713300030777SoilMILRHWEGKDDLHYFWYYDTLYPDMIHDEEDMRYINFRYTDNKVVPDPLTGYYPYDNMKYGEFLNKKEENLPIRNKFGEXSTHLLY
Ga0074020_1001995813300030840SoilMISNHWQGKDDLHYFWYYDTLYPDMLFDEDDMRYINFRYTDAKVAPDPLTGYYPYDNLKYGKFLNKKEDN
Ga0170824_10313636323300031231Forest SoilLEGKDDLHYFWYYDTLYPDMFHDEEDMRYINFRYTDAKVVPDPLTGYYPYENMKYGAFLNKKEENLPIGGYR
Ga0170820_1275611413300031446Forest SoilMFWIYICARMTRFLGQMILRHWEGKDDLHYFWYYDTLYPDMIHDEEDMRYINFRYTDNKVVPDPLTGYYPYDNMKYGEFLNKKEENLPIRNKFGE
Ga0315905_1119186213300032092FreshwaterMTKFMYFMVKRHWEGKDDQHYFWYYDTLYPDLLHDEDDMRYINFRYTDQKVSPDPMTGFYPYQHMRYEKFLNKKEDSTYSNRPTQXMVSECTSIVYI
Ga0334989_0052242_1950_22073300033984FreshwaterMTKFLYFMIKRHWEGKDDQHYFWYYDTLYPDLLHDEDDMRYINFRYTDQKVSPDPMTGYYPYQNIRYGDFLNKKEDNTYTSRPKE
Ga0334989_0210573_353_5983300033984FreshwaterMYFMVKRHWEGKDDQHYFWYYDTLYPDLLHDEDDMRYINFRYTDQKVSPDPMTGFYPYQHMRYEKFLNKKEDSTYSNRPAQ
Ga0334989_0285801_505_7503300033984FreshwaterMYFMVKRHWEGKDDQHYFWYYDTLYPDLLHDEDDMRYINFRYTDQKVSPDPMTGFYPYQHMRYEKFLNKKEDSTYSNRPTQ
Ga0334989_0303290_492_7433300033984FreshwaterMIKRHWEGKDDPHYTWYYDTLYPDLLHDAEDMRYINFRYTDNKVTPEPMTGYYPHDNMRYGDFLNKKENNLFNNRVIATQQVK
Ga0335005_0339203_542_7963300034022FreshwaterMTKKHWAGKDDPHYTWFYDTLYPDLFHDADDMRYINFRYTDAKVTPDAMTGYYPHDNMRYGDFLNKKEDNTFTSYRTAKAQLKD
Ga0335001_0365488_61_3093300034064FreshwaterMYFMVKRHWEGKDDQHYFWYYDTLYPDLVHDEEDMRYINFRYTDQKVSPDAMTGYYPYQQMRYGEFLDKKEDSTYTTRANIV
Ga0334990_0618841_3_2153300034068FreshwaterKDDQHYFWYYDTLYPDLLHDEDDMRYINFRYTDQKVSPDPMTGYYPYQNVRYGDFLNKKEDNTFVNRPKQ
Ga0335035_0362698_584_8293300034105FreshwaterMYFMVKRHWEGKDDQHYFWYYDTLYPDLLHDEDDMRYINFRYTDQKVSPDPMTGYYPYQNVRYGDFLNKKEDNTYVNRPKE
Ga0335039_0220839_172_4323300034355FreshwaterMVWTYVFYRMTKLLGAMIIRHYQGKDDLHYFWYYDTLYPDMLHDEDDMRYINFRYTDQKVSPDPMTGYYPYDHLKYGKFLNKKDNR
Ga0335039_0624539_285_5243300034355FreshwaterMYFMVKRHWEGKDDQHYFWYYDTLYPDLVHDEEDMRYINFRYTDQKVSPDAMTGYYPYQQMRYGEFLDKKEDSTYTTRAN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.