Basic Information | |
---|---|
Family ID | F092928 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 46 residues |
Representative Sequence | AAFEEMVLAQGLGDADRQAPRDEKGDRGAGAQVGRDHAPHLG |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.89 % |
% of genes near scaffold ends (potentially truncated) | 97.20 % |
% of genes from short scaffolds (< 2000 bps) | 90.65 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.131 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.280 % of family members) |
Environment Ontology (ENVO) | Unclassified (17.757 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.925 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.86% β-sheet: 0.00% Coil/Unstructured: 77.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 3.74 |
PF02211 | NHase_beta | 0.93 |
PF11578 | DUF3237 | 0.93 |
PF03060 | NMO | 0.93 |
PF13545 | HTH_Crp_2 | 0.93 |
PF16868 | NMT1_3 | 0.93 |
PF00982 | Glyco_transf_20 | 0.93 |
PF02371 | Transposase_20 | 0.93 |
PF14487 | DarT | 0.93 |
PF06724 | DUF1206 | 0.93 |
PF01227 | GTP_cyclohydroI | 0.93 |
PF00211 | Guanylate_cyc | 0.93 |
PF13546 | DDE_5 | 0.93 |
PF13384 | HTH_23 | 0.93 |
PF00166 | Cpn10 | 0.93 |
PF01965 | DJ-1_PfpI | 0.93 |
PF13649 | Methyltransf_25 | 0.93 |
PF02518 | HATPase_c | 0.93 |
PF02082 | Rrf2 | 0.93 |
PF13531 | SBP_bac_11 | 0.93 |
PF03306 | AAL_decarboxy | 0.93 |
PF03466 | LysR_substrate | 0.93 |
PF03641 | Lysine_decarbox | 0.93 |
PF13185 | GAF_2 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.74 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.93 |
COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.93 |
COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.93 |
COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.93 |
COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.93 |
COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.93 |
COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.93 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.93 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.93 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.93 |
COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.93 |
COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.93 |
COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.93 |
COG3527 | Alpha-acetolactate decarboxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.13 % |
Unclassified | root | N/A | 1.87 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000545|CNXas_1014026 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 574 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1022467 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1184 | Open in IMG/M |
3300000679|JGI12586J11914_101540 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 517 | Open in IMG/M |
3300000721|JGI12410J11868_105231 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 509 | Open in IMG/M |
3300001305|C688J14111_10181934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
3300001394|JGI20191J14862_1050579 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 541 | Open in IMG/M |
3300001396|JGI20175J14863_1042115 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 518 | Open in IMG/M |
3300001545|JGI12630J15595_10110117 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 543 | Open in IMG/M |
3300001545|JGI12630J15595_10124075 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 511 | Open in IMG/M |
3300002899|JGIcombinedJ43975_10087103 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 560 | Open in IMG/M |
3300002907|JGI25613J43889_10132418 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 636 | Open in IMG/M |
3300002917|JGI25616J43925_10130539 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1016 | Open in IMG/M |
3300003352|JGI26345J50200_1033336 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 566 | Open in IMG/M |
3300003370|JGI26337J50220_1041343 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 526 | Open in IMG/M |
3300003911|JGI25405J52794_10095100 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 662 | Open in IMG/M |
3300004013|Ga0055465_10318508 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 538 | Open in IMG/M |
3300004635|Ga0062388_102010598 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 598 | Open in IMG/M |
3300005159|Ga0066808_1041919 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 500 | Open in IMG/M |
3300005160|Ga0066820_1001735 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 996 | Open in IMG/M |
3300005160|Ga0066820_1011248 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 604 | Open in IMG/M |
3300005163|Ga0066823_10088295 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 619 | Open in IMG/M |
3300005177|Ga0066690_11007192 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 523 | Open in IMG/M |
3300005289|Ga0065704_10114990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1880 | Open in IMG/M |
3300005294|Ga0065705_10734636 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 637 | Open in IMG/M |
3300005330|Ga0070690_101724390 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 510 | Open in IMG/M |
3300005331|Ga0070670_100552496 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1027 | Open in IMG/M |
3300005331|Ga0070670_101526210 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 614 | Open in IMG/M |
3300005332|Ga0066388_100800182 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1535 | Open in IMG/M |
3300005332|Ga0066388_104519931 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 708 | Open in IMG/M |
3300005332|Ga0066388_106784828 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 577 | Open in IMG/M |
3300005332|Ga0066388_106833718 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 574 | Open in IMG/M |
3300005340|Ga0070689_100760924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 849 | Open in IMG/M |
3300005341|Ga0070691_10709862 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 604 | Open in IMG/M |
3300005354|Ga0070675_101029048 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 756 | Open in IMG/M |
3300005364|Ga0070673_101569424 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 621 | Open in IMG/M |
3300005406|Ga0070703_10161476 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300005437|Ga0070710_11181884 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 565 | Open in IMG/M |
3300005437|Ga0070710_11467024 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 512 | Open in IMG/M |
3300005444|Ga0070694_100239730 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
3300005455|Ga0070663_101000929 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 727 | Open in IMG/M |
3300005456|Ga0070678_100556809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1018 | Open in IMG/M |
3300005467|Ga0070706_101476655 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 621 | Open in IMG/M |
3300005518|Ga0070699_100124740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2266 | Open in IMG/M |
3300005518|Ga0070699_101332164 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 658 | Open in IMG/M |
3300005518|Ga0070699_102196014 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 504 | Open in IMG/M |
3300005536|Ga0070697_100161593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1892 | Open in IMG/M |
3300005713|Ga0066905_101551593 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300005841|Ga0068863_101323479 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 727 | Open in IMG/M |
3300005994|Ga0066789_10367050 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 601 | Open in IMG/M |
3300006057|Ga0075026_100510532 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 693 | Open in IMG/M |
3300006059|Ga0075017_100080428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2241 | Open in IMG/M |
3300009553|Ga0105249_13350043 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 516 | Open in IMG/M |
3300015373|Ga0132257_101889930 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 768 | Open in IMG/M |
3300016270|Ga0182036_10107380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1910 | Open in IMG/M |
3300016294|Ga0182041_11092808 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 724 | Open in IMG/M |
3300016341|Ga0182035_10251909 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1426 | Open in IMG/M |
3300016445|Ga0182038_10916737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 773 | Open in IMG/M |
3300017821|Ga0187812_1174059 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 690 | Open in IMG/M |
3300017924|Ga0187820_1002187 | All Organisms → cellular organisms → Bacteria | 4438 | Open in IMG/M |
3300017934|Ga0187803_10400842 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 556 | Open in IMG/M |
3300017943|Ga0187819_10200167 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1179 | Open in IMG/M |
3300017995|Ga0187816_10551089 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 519 | Open in IMG/M |
3300018015|Ga0187866_1296026 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 569 | Open in IMG/M |
3300018021|Ga0187882_1248734 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 688 | Open in IMG/M |
3300018024|Ga0187881_10270129 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 709 | Open in IMG/M |
3300018067|Ga0184611_1146468 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 835 | Open in IMG/M |
3300018067|Ga0184611_1343054 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 513 | Open in IMG/M |
3300018476|Ga0190274_10567882 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1153 | Open in IMG/M |
3300019356|Ga0173481_10084770 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300020065|Ga0180113_1344233 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 558 | Open in IMG/M |
3300021168|Ga0210406_11018291 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 615 | Open in IMG/M |
3300021474|Ga0210390_10019634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5486 | Open in IMG/M |
3300021560|Ga0126371_11649139 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 766 | Open in IMG/M |
3300022518|Ga0224548_1011970 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 965 | Open in IMG/M |
3300022880|Ga0247792_1106905 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 578 | Open in IMG/M |
3300024037|Ga0233355_100481 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 878 | Open in IMG/M |
3300025453|Ga0208455_1097804 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 561 | Open in IMG/M |
3300025459|Ga0208689_1010101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3134 | Open in IMG/M |
3300025507|Ga0208188_1067341 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 860 | Open in IMG/M |
3300025509|Ga0208848_1014825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1658 | Open in IMG/M |
3300025940|Ga0207691_11315053 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 597 | Open in IMG/M |
3300026035|Ga0207703_11814032 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300026223|Ga0209840_1140315 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 511 | Open in IMG/M |
3300027061|Ga0209729_1037002 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 613 | Open in IMG/M |
3300027173|Ga0208097_1004337 | Not Available | 1440 | Open in IMG/M |
3300027288|Ga0208525_1003301 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
3300027310|Ga0207983_1034487 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 642 | Open in IMG/M |
3300027909|Ga0209382_10867219 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 954 | Open in IMG/M |
3300028712|Ga0307285_10114679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 720 | Open in IMG/M |
3300030659|Ga0316363_10036947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2438 | Open in IMG/M |
3300031226|Ga0307497_10034803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1671 | Open in IMG/M |
3300031236|Ga0302324_100693875 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1438 | Open in IMG/M |
3300031280|Ga0307428_1171437 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 536 | Open in IMG/M |
3300031525|Ga0302326_10305340 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2539 | Open in IMG/M |
3300031718|Ga0307474_10144421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 1793 | Open in IMG/M |
3300031724|Ga0318500_10729536 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 506 | Open in IMG/M |
3300031744|Ga0306918_10712302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 785 | Open in IMG/M |
3300031764|Ga0318535_10236520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 817 | Open in IMG/M |
3300031768|Ga0318509_10809009 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 518 | Open in IMG/M |
3300031890|Ga0306925_11351083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 705 | Open in IMG/M |
3300031910|Ga0306923_10219186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2176 | Open in IMG/M |
3300031947|Ga0310909_10787428 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 786 | Open in IMG/M |
3300032044|Ga0318558_10245381 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 880 | Open in IMG/M |
3300032059|Ga0318533_10048760 | All Organisms → cellular organisms → Bacteria | 2813 | Open in IMG/M |
3300033290|Ga0318519_10086159 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1663 | Open in IMG/M |
3300033433|Ga0326726_12261659 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 528 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.28% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.54% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.54% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.74% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.74% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.80% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.80% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.80% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.80% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.87% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.87% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.87% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.87% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.93% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.93% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Host-Associated | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000679 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 | Environmental | Open in IMG/M |
3300000721 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001394 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 | Environmental | Open in IMG/M |
3300001396 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 | Environmental | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005159 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB | Environmental | Open in IMG/M |
3300005160 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB | Environmental | Open in IMG/M |
3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022518 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24 | Environmental | Open in IMG/M |
3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
3300024037 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-Q75 | Environmental | Open in IMG/M |
3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031280 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-240 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
CNXas_10140262 | 3300000545 | Quercus Rhizosphere | RRDDAGNALRSSAEHDAFKKMVLAQGVGHADRQAPRDEKGDRGARAPAGRDHAPHLG* |
AF_2010_repII_A100DRAFT_10224671 | 3300000655 | Forest Soil | VLAQGLGDEDRQASRDEEGDRGAGASVGRDHASRVG* |
JGI12586J11914_1015401 | 3300000679 | Tropical Forest Soil | VAQGLGDAGRQAPRHEESDCRAGPPVGGDHAPRLG* |
JGI12410J11868_1052312 | 3300000721 | Tropical Forest Soil | RRDDAHDALRSGPEHAVPFDKMVLAQGLGDEDRQASRDEEGGRGAGASLSRDHAPHLG* |
C688J14111_101819341 | 3300001305 | Soil | MARDRSVMVLAQSLGDADRQASRDEKGDRGPGTPVGCDN |
JGI20191J14862_10505792 | 3300001394 | Arctic Peat Soil | HALRSSSEHAAFEEMVLAQGLGDADRQAARDEKGDRCAGAPARRNHAPHMG* |
JGI20175J14863_10421151 | 3300001396 | Arctic Peat Soil | DAFEEMVLAQGLGDADRQAPRNEKGDRGLGAPIGRDHAPHMG* |
JGI12630J15595_101101171 | 3300001545 | Forest Soil | DDADDALRSSSEHDAFKKMVLAQGVGHADRQATRDEKGDRGPGSPVGRDHAPHLG* |
JGI12630J15595_101240752 | 3300001545 | Forest Soil | DDADDALRSSSEHDAFKKMVLAQGVGHADRQAPRDEKGDRGAGTPIGRDHAPYLG* |
JGIcombinedJ43975_100871031 | 3300002899 | Soil | SSEHAAVEEMVLAQSLGDADRQAPRDEKGDRGPGTPVGCDHAPHMG* |
JGI25613J43889_101324182 | 3300002907 | Grasslands Soil | GPEHAGAFGKMVLAQGLGDKDRQASRDEEGDRGAGASVGRDHAPHVG* |
JGI25616J43925_101305391 | 3300002917 | Grasslands Soil | CAFGEMVLAQGLGDEDRQASRDEEGDRRAGAAASGDHASHLG* |
JGI26345J50200_10333362 | 3300003352 | Bog Forest Soil | GHALRSSPEHDAFEEMVMAQGLGDADRQAAGDEKGDRGLGTAAGRDHAPHLG* |
JGI26337J50220_10413432 | 3300003370 | Bog Forest Soil | FGEMVLAQGLGDEDRQASRNEEGDRGAGATVGRDHAPHLG* |
JGI25405J52794_100951001 | 3300003911 | Tabebuia Heterophylla Rhizosphere | DDAGHALRGGADPADARNKMVLAQGLGDAGRQAPRDEKGDRRIGAPAGRDHAPRLD* |
Ga0055465_103185081 | 3300004013 | Natural And Restored Wetlands | PRHQMVVAQGLGHEDRQVSRDEEGDRRPGPPVDRDHAPHLG* |
Ga0062388_1020105982 | 3300004635 | Bog Forest Soil | RDDADDALRSGPEHAVPFDKEVLAQGLGHEGRQAPRDEEGGRGAGAPPRRDHAPHLG* |
Ga0066808_10419191 | 3300005159 | Soil | AGHALRSSSEHAAVEEMVLAQSLGDADRQASRDEKGDRGPGTPIGCDYAPHMG* |
Ga0066820_10017354 | 3300005160 | Soil | GHALRSSSEHAAFEEMVVAQGLGDADRQAPWEEKSDRGPGASVGRDHAPHLG* |
Ga0066820_10112481 | 3300005160 | Soil | DDAGHALRSSSEHAAFEEMVVAQGLGDADRQAPWEEESDRGLGASVGRDHAPHLG* |
Ga0066823_100882951 | 3300005163 | Soil | DAGHALRSSSEHAAFEEMVVAQGLGDADRQAPWEEESDRGLGASVGRDHAPHLG* |
Ga0066690_110071921 | 3300005177 | Soil | ITVRRRDDADDALRSGPEHAGAFGEMVLAQGLGDEDRQASRDEKGDRGAGASVGRDHAPRVG* |
Ga0065704_101149903 | 3300005289 | Switchgrass Rhizosphere | SKHVAFEEMVVAQGLGDADRQAPWDEKGDRGVGASAGRDHAPHVG* |
Ga0065705_107346361 | 3300005294 | Switchgrass Rhizosphere | LWRSDDAGHALRGGSEHDALEEMVMAQGLGNADRQAPRDEKGDRRAGPPVGRDHAPHLG* |
Ga0070690_1017243901 | 3300005330 | Switchgrass Rhizosphere | AFEEMVMAQGLGDTDRQTPRHEEGNRGAGASIGRDPAPHMG* |
Ga0070670_1005524961 | 3300005331 | Switchgrass Rhizosphere | AHDALRSCAEHDAFKKVVMAQGLGHADRQAPRNEEGDRGPGAPTGRHHAPDMG* |
Ga0070670_1015262102 | 3300005331 | Switchgrass Rhizosphere | ERQNIPLRRRDDAGHALRSSSEYAAFEEMVMAQGLGDTDRQTPRHEEGNRGAGAPIGRDPAPHMG* |
Ga0066388_1008001824 | 3300005332 | Tropical Forest Soil | SSEHVAVEEMVVAQGLGDADCQAPRDEKGDRSPSPSLGRDHAPHLG* |
Ga0066388_1045199312 | 3300005332 | Tropical Forest Soil | LEYVPFAKMVLAQGLGDEGRQAPRDEEGDRSPGTSVGRDHAPHLG* |
Ga0066388_1067848281 | 3300005332 | Tropical Forest Soil | AFEEMVLAQGLGDADRQAPRDEKGDRGLGTPVGRDHAPHMG* |
Ga0066388_1068337181 | 3300005332 | Tropical Forest Soil | GAFDEMVLAQGLGDEDRQASRDEKGDRGAGASAGRDHASHLG* |
Ga0070689_1007609241 | 3300005340 | Switchgrass Rhizosphere | CSEHDAFKKMVLAQGVGHADRQAPRDEKGDRGLGTPARRDHASHMG* |
Ga0070691_107098621 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | AFEEMVVAQGLGDADRQAPWDEKGDRGAGAPVGRDHAPDMG* |
Ga0070675_1010290481 | 3300005354 | Miscanthus Rhizosphere | DALRGSAEHAAFEEMVVAQGLGDADRQAPWDEKGDRGAGASTGRDHAPHMG* |
Ga0070673_1015694242 | 3300005364 | Switchgrass Rhizosphere | FEEMVVAQGLGDADRQAPWDEKGDRGAGAPVGRDHAPHVG* |
Ga0070703_101614761 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LRRRDDAGDALRGSSEHVAFEEMVVAQGLGDADRQAPWDEKGDRGVGASAGRDHAPHVG* |
Ga0070710_111818842 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | EEMVLAQGLGDADRQAPRDEEGDRGPGTPVGRDHAPHLG* |
Ga0070710_114670242 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | RDDADDALRSSSGHAAFKEMVVAQGLGDADRQAPWNEKGDRGAGPASGRGHAPHLG* |
Ga0070694_1002397303 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | NITLRRRDDAGDALRGSSEHAAFEEMVVAQGLGDADRQTPWDEKGDRGAGAPVGRDHAPHMG* |
Ga0070663_1010009292 | 3300005455 | Corn Rhizosphere | AFEEMVLAQGLGDADRQAPRDEEGYCGVGTPASRDHASHMG* |
Ga0070678_1005568092 | 3300005456 | Miscanthus Rhizosphere | HAAFEEMVLAQGLGDADRQAPRDEKGDRGAGAQVGRDHAPYLG* |
Ga0070706_1014766551 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRRDDADDALRSGPEHAGAFDEMVLAQGLGNEGRQASRDEEGDRGAGASVGRDHAPRVG |
Ga0070699_1001247401 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RSSSEHAAVEEMVLAQSLGEADRQAPRDEKGDRGPGTPVGCDHAPHMG* |
Ga0070699_1013321641 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | DAFDEMVLAQGLGDESRQASRDEEGDRGAGASVGRDHAPRVG* |
Ga0070699_1021960141 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RRRDDAGHALRSSPEHAAFEEMVVAQGLGDADRQASRDEKGDRGAGASVSRDHAPHMG* |
Ga0070697_1001615934 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | DITVRRRDDADDALRSGPEHAGTFGEMVLAQGLGDEDRQASRDKEGDRGAGASVGRDHASHVG* |
Ga0066905_1015515931 | 3300005713 | Tropical Forest Soil | GAFDEMVLAQGLGDEGRQASRDEEGDRGAGASLGRDHAPHVD* |
Ga0068863_1013234791 | 3300005841 | Switchgrass Rhizosphere | AQGLGNADRQAPRDEKGDRRAGPPVGRDHAPYLG* |
Ga0066789_103670502 | 3300005994 | Soil | AAFEEMVLAQGLGDADRQAPRDEKGDRGAGAQVGRDHAPHLG* |
Ga0075026_1005105321 | 3300006057 | Watersheds | AGHALRSSSEHAAFEEMVVAQGLGDADRQAPWEEKSDRGLGASVGRDHAPHLG* |
Ga0075017_1000804285 | 3300006059 | Watersheds | DDAGDALRSSSEHDAFKEMVMAQGLGHADRQAPRDEEGDRGPGTPASRDHAPNMG* |
Ga0105249_133500431 | 3300009553 | Switchgrass Rhizosphere | EMVMAQGLSDTDRQTPRHEEGNRGAGAPIGRDPAPHMG* |
Ga0132257_1018899302 | 3300015373 | Arabidopsis Rhizosphere | TFVKMVMAQGLGDEDCQAPRNEKGNRCTSATLGRHYAPHLD* |
Ga0182036_101073801 | 3300016270 | Soil | HAGAFDEMVLAQGLGDEDRQASRDEKGDRGAGASVGRDHAPHVG |
Ga0182041_110928081 | 3300016294 | Soil | AATFGKMVVAQGLGDEDRQAPRDEKGNRCTGSTVGRDYASRLD |
Ga0182035_102519091 | 3300016341 | Soil | IGALDKMVLAQSLGDADRQAARHEKSDRRAGPPIGGDHAPHLG |
Ga0182038_109167371 | 3300016445 | Soil | AALEEMVLAQGLGDADRQASGDEKGNRRPGATVGGDHAPHLG |
Ga0187812_11740591 | 3300017821 | Freshwater Sediment | EHAVFEEMVVAQGLGDADRQAPRDEKGDRGTGTPVGRDYAPHMG |
Ga0187820_10021875 | 3300017924 | Freshwater Sediment | MRRRDDAGHALRSSSKHAAFEEMIMAQGLGDAGHQALRNEKGDRRPGIPVGRHFAPFLG |
Ga0187803_104008422 | 3300017934 | Freshwater Sediment | SEYDAFQEMVMAQGLGDADRQALRDEKGDRGAGAPIGRDHAPHLG |
Ga0187819_102001673 | 3300017943 | Freshwater Sediment | AGAFNKMVLAQGLGDEDRPAPRGEKGNRGAGATAGCDHASHLG |
Ga0187816_105510891 | 3300017995 | Freshwater Sediment | KHAAVEEMVLAQGLGDADRQAPRDKKGDRGLGTPVGRDHAPHMG |
Ga0187866_12960261 | 3300018015 | Peatland | FEEMVVAQGLGDADRQAPRDEKGDRGPGTPVGRDHAPYLG |
Ga0187882_12487341 | 3300018021 | Peatland | AFEEMVVAQGLGDADRQAPRDEKGDRGPGTPVGRDHAPHLG |
Ga0187881_102701291 | 3300018024 | Peatland | EMVVAQGLGDADRQAPRDEKGDRGPGTPVGRDHAPHLG |
Ga0184611_11464682 | 3300018067 | Groundwater Sediment | SPGRSASRGGSEHDALEVMVMAQGLGNADRQAARDEEGDRRADAQVGRDHAPHLG |
Ga0184611_13430541 | 3300018067 | Groundwater Sediment | GKMVMAQSLGDEDRQAPWAETIVGPGAPIGRDHAPHMG |
Ga0190274_105678821 | 3300018476 | Soil | EEMVMAQGLGDADRQAPRDEKGDRGAGAPVGRDHAPHMG |
Ga0173481_100847701 | 3300019356 | Soil | RSCAEHDAFKKVVMAQGLGHADRQAPRDEKGDRGLGTPARRDHASHMG |
Ga0180113_13442331 | 3300020065 | Groundwater Sediment | HAGAFGKMVLAQGLGDEDRQAPRAEKGDCGLGASIGRDHAPHMG |
Ga0210406_110182912 | 3300021168 | Soil | DDANDALRSGADRAGAFDEMVLAQGLGDEDRQAPWDEEGDRGVGAAVGRNHAPHMG |
Ga0210390_100196349 | 3300021474 | Soil | LRGRPEAGSFDEMVLVQGLGDEDRQASWDEKGDRGASAPIGRDYAPRLG |
Ga0126371_116491391 | 3300021560 | Tropical Forest Soil | MVVAQGLGDADRQTPRDEEGHCRAGTTAGRDPAPHLG |
Ga0224548_10119701 | 3300022518 | Soil | DMVMAQGLGDADRQASRNEEGDCGAGAPIGRDHALHMG |
Ga0247792_11069051 | 3300022880 | Soil | EEMVLAQGLGDAGRQAPWDEKGDRGPGAPVGCDHAPHMG |
Ga0233355_1004811 | 3300024037 | Soil | AAFEEMVLAQGLGDADREAPRDEEGDRGPGAPAGRDHAPHMG |
Ga0208455_10978042 | 3300025453 | Peatland | FEEMVLAQGLGDADRQAPWEEKGDRGAGTPVGRDHASHMG |
Ga0208689_10101011 | 3300025459 | Peatland | ALRSSSEYAAFEEMVLAQGLGDADRQAPRDEKGDRGPGAPVGRDHAPHMG |
Ga0208188_10673414 | 3300025507 | Peatland | MVLAQGLGDADRQAPRDEKGDRGAGTPVSRDHAPHLG |
Ga0208848_10148252 | 3300025509 | Arctic Peat Soil | AAFEEMVLAQGLGDADRQASRDEEGDRGPGAPAGRDHAPHMG |
Ga0207691_113150531 | 3300025940 | Miscanthus Rhizosphere | RQNITLRRRDDAGDALRGSAEHAAFEEMVVAQGLSDADRQTPWDEKGDRGAGAPVGRDHAPHMG |
Ga0207703_118140321 | 3300026035 | Switchgrass Rhizosphere | MARDRSVMVLAQSLGDADRQASRDEKGDRGPGTPVGC |
Ga0209840_11403151 | 3300026223 | Soil | MVMAQGLGDADRQAPRDEKGDRGPGAPIGRDHAPYMG |
Ga0209729_10370021 | 3300027061 | Forest Soil | PDSSDAFDTMVMAQGLGDAGRQASREKEGHRRPGATVSRDPAPHLG |
Ga0208097_10043372 | 3300027173 | Forest Soil | HAAFEEMVLAQGLGHADRQTPRDEKGDRGPGAPVGRDHAPYVDRWH |
Ga0208525_10033012 | 3300027288 | Soil | MVLAQSLGDADRQASRDEKGDRGPGTPVGCDNAPHMG |
Ga0207983_10344871 | 3300027310 | Soil | HAAFEEMVLAQGLGDADRQAPRGKKSDRGPGTPVGCDHAPYLG |
Ga0209382_108672191 | 3300027909 | Populus Rhizosphere | EEMVVAQGLGDADRQAPWDEKGDRGAGAPVGRDHAPDLG |
Ga0307285_101146791 | 3300028712 | Soil | MARDRSVMVLAQSLGDADRQASRDEKGDRGPGTPVGCD |
Ga0316363_100369473 | 3300030659 | Peatlands Soil | AGAFGEVVLAQGLGHEDRQAPRDEEGDRGAGAPVSGDHAPHLG |
Ga0307497_100348033 | 3300031226 | Soil | LRSGSGHVAFKEMVLAQGLGHEDRQAPRDEEGNRGPGAPVGRDHAPHLG |
Ga0302324_1006938751 | 3300031236 | Palsa | GSSEHAAVEEMVVAQGLGDADRQATRHEKSDRGPGSQVGRDPAPHLG |
Ga0307428_11714371 | 3300031280 | Salt Marsh | SSPEHAAFEEMVLAQGLGDADRQASRDEKGDRSPGAPIGRHHAPHMG |
Ga0302326_103053403 | 3300031525 | Palsa | EMVVAQGLGDADRQATRHEKSDRGPGSQVGRDPAPHLG |
Ga0318560_104349452 | 3300031682 | Soil | MVLAQGLGDEDRQAPRDEKGNRCTSATLGRHYASERP |
Ga0307474_101444211 | 3300031718 | Hardwood Forest Soil | KMVLAQGLGDADCQASRDEEGGGGAGASLSRDHASHLG |
Ga0318500_107295361 | 3300031724 | Soil | VPFDKMVLAQGLGDADRQASRDEEGGRGAGASLGRDHASHLG |
Ga0306918_107123023 | 3300031744 | Soil | FDKMVLAQGLGDADRQASRDEEGGRGAGASLGRDHASHLG |
Ga0318535_102365202 | 3300031764 | Soil | GHAATFGKMVVAQGLGDEDRQAPRDEKGNRCTGSTVGRDYASHLD |
Ga0318509_108090091 | 3300031768 | Soil | GHAATFGKMVVAQGLGDEDRQAPRDEKGNRRTGSTVGRDYASHLD |
Ga0306925_113510831 | 3300031890 | Soil | DEMVLAQGLGDEGRQASRDEEGDRGAGASVGRDHAPRVG |
Ga0306923_102191865 | 3300031910 | Soil | ALRSGPGHADPHQQVVMAQGLGSKDRQAPRDEEGDRGAGASASRDPAPHLG |
Ga0310909_107874281 | 3300031947 | Soil | FNKVVLAQGLGDADRQTSRDEKGDRGLGTPDGRDHAPHMG |
Ga0318558_102453811 | 3300032044 | Soil | ADDAVRSGPEHVGAFGKMVLAQGLGDEDRQASRDEEGDRGAGASLGRDYASRVG |
Ga0318533_100487604 | 3300032059 | Soil | EEMVLAQGLGYANRQAPRNEEGDRGPGASIGRDHASHLG |
Ga0318519_100861591 | 3300033290 | Soil | IAVRRRDDADDALRSGPEHAGAFGEMVLAQGLGDEDRQASRDKEGDRGAGAPVGRDHAPHVGWRHRVPVD |
Ga0326726_122616591 | 3300033433 | Peat Soil | LRSSSEYAAFEEMVLAQGLGDADRQTPRDEKGDRGAGAPVGRDHAPHMG |
⦗Top⦘ |