NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092928

Metagenome / Metatranscriptome Family F092928

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092928
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 46 residues
Representative Sequence AAFEEMVLAQGLGDADRQAPRDEKGDRGAGAQVGRDHAPHLG
Number of Associated Samples 97
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.89 %
% of genes near scaffold ends (potentially truncated) 97.20 %
% of genes from short scaffolds (< 2000 bps) 90.65 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.131 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(10.280 % of family members)
Environment Ontology (ENVO) Unclassified
(17.757 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.925 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.86%    β-sheet: 0.00%    Coil/Unstructured: 77.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF04392ABC_sub_bind 3.74
PF02211NHase_beta 0.93
PF11578DUF3237 0.93
PF03060NMO 0.93
PF13545HTH_Crp_2 0.93
PF16868NMT1_3 0.93
PF00982Glyco_transf_20 0.93
PF02371Transposase_20 0.93
PF14487DarT 0.93
PF06724DUF1206 0.93
PF01227GTP_cyclohydroI 0.93
PF00211Guanylate_cyc 0.93
PF13546DDE_5 0.93
PF13384HTH_23 0.93
PF00166Cpn10 0.93
PF01965DJ-1_PfpI 0.93
PF13649Methyltransf_25 0.93
PF02518HATPase_c 0.93
PF02082Rrf2 0.93
PF13531SBP_bac_11 0.93
PF03306AAL_decarboxy 0.93
PF03466LysR_substrate 0.93
PF03641Lysine_decarbox 0.93
PF13185GAF_2 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 3.74
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.93
COG0380Trehalose-6-phosphate synthase, GT20 familyCarbohydrate transport and metabolism [G] 0.93
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.93
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 0.93
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 0.93
COG1611Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) familyNucleotide transport and metabolism [F] 0.93
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 0.93
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 0.93
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.93
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.93
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.93
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.93
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 0.93
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 0.93
COG3527Alpha-acetolactate decarboxylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.93
COG3547TransposaseMobilome: prophages, transposons [X] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.13 %
UnclassifiedrootN/A1.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000545|CNXas_1014026All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium574Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1022467All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1184Open in IMG/M
3300000679|JGI12586J11914_101540All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium517Open in IMG/M
3300000721|JGI12410J11868_105231All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium509Open in IMG/M
3300001305|C688J14111_10181934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium650Open in IMG/M
3300001394|JGI20191J14862_1050579All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium541Open in IMG/M
3300001396|JGI20175J14863_1042115All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium518Open in IMG/M
3300001545|JGI12630J15595_10110117All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium543Open in IMG/M
3300001545|JGI12630J15595_10124075All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium511Open in IMG/M
3300002899|JGIcombinedJ43975_10087103All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium560Open in IMG/M
3300002907|JGI25613J43889_10132418All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium636Open in IMG/M
3300002917|JGI25616J43925_10130539All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1016Open in IMG/M
3300003352|JGI26345J50200_1033336All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium566Open in IMG/M
3300003370|JGI26337J50220_1041343All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium526Open in IMG/M
3300003911|JGI25405J52794_10095100All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium662Open in IMG/M
3300004013|Ga0055465_10318508All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium538Open in IMG/M
3300004635|Ga0062388_102010598All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium598Open in IMG/M
3300005159|Ga0066808_1041919All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium500Open in IMG/M
3300005160|Ga0066820_1001735All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium996Open in IMG/M
3300005160|Ga0066820_1011248All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium604Open in IMG/M
3300005163|Ga0066823_10088295All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium619Open in IMG/M
3300005177|Ga0066690_11007192All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium523Open in IMG/M
3300005289|Ga0065704_10114990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1880Open in IMG/M
3300005294|Ga0065705_10734636All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium637Open in IMG/M
3300005330|Ga0070690_101724390All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium510Open in IMG/M
3300005331|Ga0070670_100552496All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1027Open in IMG/M
3300005331|Ga0070670_101526210All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium614Open in IMG/M
3300005332|Ga0066388_100800182All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1535Open in IMG/M
3300005332|Ga0066388_104519931All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium708Open in IMG/M
3300005332|Ga0066388_106784828All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium577Open in IMG/M
3300005332|Ga0066388_106833718All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium574Open in IMG/M
3300005340|Ga0070689_100760924All Organisms → cellular organisms → Bacteria → Proteobacteria849Open in IMG/M
3300005341|Ga0070691_10709862All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium604Open in IMG/M
3300005354|Ga0070675_101029048All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium756Open in IMG/M
3300005364|Ga0070673_101569424All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium621Open in IMG/M
3300005406|Ga0070703_10161476All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300005437|Ga0070710_11181884All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium565Open in IMG/M
3300005437|Ga0070710_11467024All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium512Open in IMG/M
3300005444|Ga0070694_100239730All Organisms → cellular organisms → Bacteria1367Open in IMG/M
3300005455|Ga0070663_101000929All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium727Open in IMG/M
3300005456|Ga0070678_100556809All Organisms → cellular organisms → Bacteria → Proteobacteria1018Open in IMG/M
3300005467|Ga0070706_101476655All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium621Open in IMG/M
3300005518|Ga0070699_100124740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2266Open in IMG/M
3300005518|Ga0070699_101332164All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium658Open in IMG/M
3300005518|Ga0070699_102196014All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium504Open in IMG/M
3300005536|Ga0070697_100161593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1892Open in IMG/M
3300005713|Ga0066905_101551593All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300005841|Ga0068863_101323479All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium727Open in IMG/M
3300005994|Ga0066789_10367050All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium601Open in IMG/M
3300006057|Ga0075026_100510532All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium693Open in IMG/M
3300006059|Ga0075017_100080428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2241Open in IMG/M
3300009553|Ga0105249_13350043All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium516Open in IMG/M
3300015373|Ga0132257_101889930All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium768Open in IMG/M
3300016270|Ga0182036_10107380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1910Open in IMG/M
3300016294|Ga0182041_11092808All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium724Open in IMG/M
3300016341|Ga0182035_10251909All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1426Open in IMG/M
3300016445|Ga0182038_10916737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria773Open in IMG/M
3300017821|Ga0187812_1174059All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium690Open in IMG/M
3300017924|Ga0187820_1002187All Organisms → cellular organisms → Bacteria4438Open in IMG/M
3300017934|Ga0187803_10400842All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium556Open in IMG/M
3300017943|Ga0187819_10200167All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1179Open in IMG/M
3300017995|Ga0187816_10551089All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium519Open in IMG/M
3300018015|Ga0187866_1296026All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium569Open in IMG/M
3300018021|Ga0187882_1248734All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium688Open in IMG/M
3300018024|Ga0187881_10270129All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium709Open in IMG/M
3300018067|Ga0184611_1146468All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium835Open in IMG/M
3300018067|Ga0184611_1343054All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium513Open in IMG/M
3300018476|Ga0190274_10567882All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1153Open in IMG/M
3300019356|Ga0173481_10084770All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300020065|Ga0180113_1344233All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium558Open in IMG/M
3300021168|Ga0210406_11018291All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium615Open in IMG/M
3300021474|Ga0210390_10019634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium5486Open in IMG/M
3300021560|Ga0126371_11649139All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium766Open in IMG/M
3300022518|Ga0224548_1011970All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium965Open in IMG/M
3300022880|Ga0247792_1106905All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium578Open in IMG/M
3300024037|Ga0233355_100481All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium878Open in IMG/M
3300025453|Ga0208455_1097804All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium561Open in IMG/M
3300025459|Ga0208689_1010101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3134Open in IMG/M
3300025507|Ga0208188_1067341All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium860Open in IMG/M
3300025509|Ga0208848_1014825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1658Open in IMG/M
3300025940|Ga0207691_11315053All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium597Open in IMG/M
3300026035|Ga0207703_11814032All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300026223|Ga0209840_1140315All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium511Open in IMG/M
3300027061|Ga0209729_1037002All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium613Open in IMG/M
3300027173|Ga0208097_1004337Not Available1440Open in IMG/M
3300027288|Ga0208525_1003301All Organisms → cellular organisms → Bacteria1643Open in IMG/M
3300027310|Ga0207983_1034487All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium642Open in IMG/M
3300027909|Ga0209382_10867219All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium954Open in IMG/M
3300028712|Ga0307285_10114679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium720Open in IMG/M
3300030659|Ga0316363_10036947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2438Open in IMG/M
3300031226|Ga0307497_10034803All Organisms → cellular organisms → Bacteria → Proteobacteria1671Open in IMG/M
3300031236|Ga0302324_100693875All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1438Open in IMG/M
3300031280|Ga0307428_1171437All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium536Open in IMG/M
3300031525|Ga0302326_10305340All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium2539Open in IMG/M
3300031718|Ga0307474_10144421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens1793Open in IMG/M
3300031724|Ga0318500_10729536All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium506Open in IMG/M
3300031744|Ga0306918_10712302All Organisms → cellular organisms → Bacteria → Proteobacteria785Open in IMG/M
3300031764|Ga0318535_10236520All Organisms → cellular organisms → Bacteria → Proteobacteria817Open in IMG/M
3300031768|Ga0318509_10809009All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium518Open in IMG/M
3300031890|Ga0306925_11351083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria705Open in IMG/M
3300031910|Ga0306923_10219186All Organisms → cellular organisms → Bacteria → Proteobacteria2176Open in IMG/M
3300031947|Ga0310909_10787428All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium786Open in IMG/M
3300032044|Ga0318558_10245381All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium880Open in IMG/M
3300032059|Ga0318533_10048760All Organisms → cellular organisms → Bacteria2813Open in IMG/M
3300033290|Ga0318519_10086159All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1663Open in IMG/M
3300033433|Ga0326726_12261659All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium528Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.28%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.54%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.74%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.74%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.80%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.80%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.80%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.80%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.87%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.87%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.87%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.93%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.93%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.93%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.93%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Quercus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000545Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_AssembledHost-AssociatedOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000679Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23EnvironmentalOpen in IMG/M
3300000721Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41EnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001394Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012EnvironmentalOpen in IMG/M
3300001396Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012EnvironmentalOpen in IMG/M
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300003352Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1EnvironmentalOpen in IMG/M
3300003370Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2EnvironmentalOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005159Soil and rhizosphere microbial communities from Laval, Canada - mgLPBEnvironmentalOpen in IMG/M
3300005160Soil and rhizosphere microbial communities from Laval, Canada - mgLMBEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020065Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022518Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300024037Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-Q75EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025459Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025509Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026223Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)EnvironmentalOpen in IMG/M
3300027061Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027173Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes)EnvironmentalOpen in IMG/M
3300027288Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes)EnvironmentalOpen in IMG/M
3300027310Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031280Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-240EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
CNXas_101402623300000545Quercus RhizosphereRRDDAGNALRSSAEHDAFKKMVLAQGVGHADRQAPRDEKGDRGARAPAGRDHAPHLG*
AF_2010_repII_A100DRAFT_102246713300000655Forest SoilVLAQGLGDEDRQASRDEEGDRGAGASVGRDHASRVG*
JGI12586J11914_10154013300000679Tropical Forest SoilVAQGLGDAGRQAPRHEESDCRAGPPVGGDHAPRLG*
JGI12410J11868_10523123300000721Tropical Forest SoilRRDDAHDALRSGPEHAVPFDKMVLAQGLGDEDRQASRDEEGGRGAGASLSRDHAPHLG*
C688J14111_1018193413300001305SoilMARDRSVMVLAQSLGDADRQASRDEKGDRGPGTPVGCDN
JGI20191J14862_105057923300001394Arctic Peat SoilHALRSSSEHAAFEEMVLAQGLGDADRQAARDEKGDRCAGAPARRNHAPHMG*
JGI20175J14863_104211513300001396Arctic Peat SoilDAFEEMVLAQGLGDADRQAPRNEKGDRGLGAPIGRDHAPHMG*
JGI12630J15595_1011011713300001545Forest SoilDDADDALRSSSEHDAFKKMVLAQGVGHADRQATRDEKGDRGPGSPVGRDHAPHLG*
JGI12630J15595_1012407523300001545Forest SoilDDADDALRSSSEHDAFKKMVLAQGVGHADRQAPRDEKGDRGAGTPIGRDHAPYLG*
JGIcombinedJ43975_1008710313300002899SoilSSEHAAVEEMVLAQSLGDADRQAPRDEKGDRGPGTPVGCDHAPHMG*
JGI25613J43889_1013241823300002907Grasslands SoilGPEHAGAFGKMVLAQGLGDKDRQASRDEEGDRGAGASVGRDHAPHVG*
JGI25616J43925_1013053913300002917Grasslands SoilCAFGEMVLAQGLGDEDRQASRDEEGDRRAGAAASGDHASHLG*
JGI26345J50200_103333623300003352Bog Forest SoilGHALRSSPEHDAFEEMVMAQGLGDADRQAAGDEKGDRGLGTAAGRDHAPHLG*
JGI26337J50220_104134323300003370Bog Forest SoilFGEMVLAQGLGDEDRQASRNEEGDRGAGATVGRDHAPHLG*
JGI25405J52794_1009510013300003911Tabebuia Heterophylla RhizosphereDDAGHALRGGADPADARNKMVLAQGLGDAGRQAPRDEKGDRRIGAPAGRDHAPRLD*
Ga0055465_1031850813300004013Natural And Restored WetlandsPRHQMVVAQGLGHEDRQVSRDEEGDRRPGPPVDRDHAPHLG*
Ga0062388_10201059823300004635Bog Forest SoilRDDADDALRSGPEHAVPFDKEVLAQGLGHEGRQAPRDEEGGRGAGAPPRRDHAPHLG*
Ga0066808_104191913300005159SoilAGHALRSSSEHAAVEEMVLAQSLGDADRQASRDEKGDRGPGTPIGCDYAPHMG*
Ga0066820_100173543300005160SoilGHALRSSSEHAAFEEMVVAQGLGDADRQAPWEEKSDRGPGASVGRDHAPHLG*
Ga0066820_101124813300005160SoilDDAGHALRSSSEHAAFEEMVVAQGLGDADRQAPWEEESDRGLGASVGRDHAPHLG*
Ga0066823_1008829513300005163SoilDAGHALRSSSEHAAFEEMVVAQGLGDADRQAPWEEESDRGLGASVGRDHAPHLG*
Ga0066690_1100719213300005177SoilITVRRRDDADDALRSGPEHAGAFGEMVLAQGLGDEDRQASRDEKGDRGAGASVGRDHAPRVG*
Ga0065704_1011499033300005289Switchgrass RhizosphereSKHVAFEEMVVAQGLGDADRQAPWDEKGDRGVGASAGRDHAPHVG*
Ga0065705_1073463613300005294Switchgrass RhizosphereLWRSDDAGHALRGGSEHDALEEMVMAQGLGNADRQAPRDEKGDRRAGPPVGRDHAPHLG*
Ga0070690_10172439013300005330Switchgrass RhizosphereAFEEMVMAQGLGDTDRQTPRHEEGNRGAGASIGRDPAPHMG*
Ga0070670_10055249613300005331Switchgrass RhizosphereAHDALRSCAEHDAFKKVVMAQGLGHADRQAPRNEEGDRGPGAPTGRHHAPDMG*
Ga0070670_10152621023300005331Switchgrass RhizosphereERQNIPLRRRDDAGHALRSSSEYAAFEEMVMAQGLGDTDRQTPRHEEGNRGAGAPIGRDPAPHMG*
Ga0066388_10080018243300005332Tropical Forest SoilSSEHVAVEEMVVAQGLGDADCQAPRDEKGDRSPSPSLGRDHAPHLG*
Ga0066388_10451993123300005332Tropical Forest SoilLEYVPFAKMVLAQGLGDEGRQAPRDEEGDRSPGTSVGRDHAPHLG*
Ga0066388_10678482813300005332Tropical Forest SoilAFEEMVLAQGLGDADRQAPRDEKGDRGLGTPVGRDHAPHMG*
Ga0066388_10683371813300005332Tropical Forest SoilGAFDEMVLAQGLGDEDRQASRDEKGDRGAGASAGRDHASHLG*
Ga0070689_10076092413300005340Switchgrass RhizosphereCSEHDAFKKMVLAQGVGHADRQAPRDEKGDRGLGTPARRDHASHMG*
Ga0070691_1070986213300005341Corn, Switchgrass And Miscanthus RhizosphereAFEEMVVAQGLGDADRQAPWDEKGDRGAGAPVGRDHAPDMG*
Ga0070675_10102904813300005354Miscanthus RhizosphereDALRGSAEHAAFEEMVVAQGLGDADRQAPWDEKGDRGAGASTGRDHAPHMG*
Ga0070673_10156942423300005364Switchgrass RhizosphereFEEMVVAQGLGDADRQAPWDEKGDRGAGAPVGRDHAPHVG*
Ga0070703_1016147613300005406Corn, Switchgrass And Miscanthus RhizosphereLRRRDDAGDALRGSSEHVAFEEMVVAQGLGDADRQAPWDEKGDRGVGASAGRDHAPHVG*
Ga0070710_1118188423300005437Corn, Switchgrass And Miscanthus RhizosphereEEMVLAQGLGDADRQAPRDEEGDRGPGTPVGRDHAPHLG*
Ga0070710_1146702423300005437Corn, Switchgrass And Miscanthus RhizosphereRDDADDALRSSSGHAAFKEMVVAQGLGDADRQAPWNEKGDRGAGPASGRGHAPHLG*
Ga0070694_10023973033300005444Corn, Switchgrass And Miscanthus RhizosphereNITLRRRDDAGDALRGSSEHAAFEEMVVAQGLGDADRQTPWDEKGDRGAGAPVGRDHAPHMG*
Ga0070663_10100092923300005455Corn RhizosphereAFEEMVLAQGLGDADRQAPRDEEGYCGVGTPASRDHASHMG*
Ga0070678_10055680923300005456Miscanthus RhizosphereHAAFEEMVLAQGLGDADRQAPRDEKGDRGAGAQVGRDHAPYLG*
Ga0070706_10147665513300005467Corn, Switchgrass And Miscanthus RhizosphereVRRRDDADDALRSGPEHAGAFDEMVLAQGLGNEGRQASRDEEGDRGAGASVGRDHAPRVG
Ga0070699_10012474013300005518Corn, Switchgrass And Miscanthus RhizosphereRSSSEHAAVEEMVLAQSLGEADRQAPRDEKGDRGPGTPVGCDHAPHMG*
Ga0070699_10133216413300005518Corn, Switchgrass And Miscanthus RhizosphereDAFDEMVLAQGLGDESRQASRDEEGDRGAGASVGRDHAPRVG*
Ga0070699_10219601413300005518Corn, Switchgrass And Miscanthus RhizosphereRRRDDAGHALRSSPEHAAFEEMVVAQGLGDADRQASRDEKGDRGAGASVSRDHAPHMG*
Ga0070697_10016159343300005536Corn, Switchgrass And Miscanthus RhizosphereDITVRRRDDADDALRSGPEHAGTFGEMVLAQGLGDEDRQASRDKEGDRGAGASVGRDHASHVG*
Ga0066905_10155159313300005713Tropical Forest SoilGAFDEMVLAQGLGDEGRQASRDEEGDRGAGASLGRDHAPHVD*
Ga0068863_10132347913300005841Switchgrass RhizosphereAQGLGNADRQAPRDEKGDRRAGPPVGRDHAPYLG*
Ga0066789_1036705023300005994SoilAAFEEMVLAQGLGDADRQAPRDEKGDRGAGAQVGRDHAPHLG*
Ga0075026_10051053213300006057WatershedsAGHALRSSSEHAAFEEMVVAQGLGDADRQAPWEEKSDRGLGASVGRDHAPHLG*
Ga0075017_10008042853300006059WatershedsDDAGDALRSSSEHDAFKEMVMAQGLGHADRQAPRDEEGDRGPGTPASRDHAPNMG*
Ga0105249_1335004313300009553Switchgrass RhizosphereEMVMAQGLSDTDRQTPRHEEGNRGAGAPIGRDPAPHMG*
Ga0132257_10188993023300015373Arabidopsis RhizosphereTFVKMVMAQGLGDEDCQAPRNEKGNRCTSATLGRHYAPHLD*
Ga0182036_1010738013300016270SoilHAGAFDEMVLAQGLGDEDRQASRDEKGDRGAGASVGRDHAPHVG
Ga0182041_1109280813300016294SoilAATFGKMVVAQGLGDEDRQAPRDEKGNRCTGSTVGRDYASRLD
Ga0182035_1025190913300016341SoilIGALDKMVLAQSLGDADRQAARHEKSDRRAGPPIGGDHAPHLG
Ga0182038_1091673713300016445SoilAALEEMVLAQGLGDADRQASGDEKGNRRPGATVGGDHAPHLG
Ga0187812_117405913300017821Freshwater SedimentEHAVFEEMVVAQGLGDADRQAPRDEKGDRGTGTPVGRDYAPHMG
Ga0187820_100218753300017924Freshwater SedimentMRRRDDAGHALRSSSKHAAFEEMIMAQGLGDAGHQALRNEKGDRRPGIPVGRHFAPFLG
Ga0187803_1040084223300017934Freshwater SedimentSEYDAFQEMVMAQGLGDADRQALRDEKGDRGAGAPIGRDHAPHLG
Ga0187819_1020016733300017943Freshwater SedimentAGAFNKMVLAQGLGDEDRPAPRGEKGNRGAGATAGCDHASHLG
Ga0187816_1055108913300017995Freshwater SedimentKHAAVEEMVLAQGLGDADRQAPRDKKGDRGLGTPVGRDHAPHMG
Ga0187866_129602613300018015PeatlandFEEMVVAQGLGDADRQAPRDEKGDRGPGTPVGRDHAPYLG
Ga0187882_124873413300018021PeatlandAFEEMVVAQGLGDADRQAPRDEKGDRGPGTPVGRDHAPHLG
Ga0187881_1027012913300018024PeatlandEMVVAQGLGDADRQAPRDEKGDRGPGTPVGRDHAPHLG
Ga0184611_114646823300018067Groundwater SedimentSPGRSASRGGSEHDALEVMVMAQGLGNADRQAARDEEGDRRADAQVGRDHAPHLG
Ga0184611_134305413300018067Groundwater SedimentGKMVMAQSLGDEDRQAPWAETIVGPGAPIGRDHAPHMG
Ga0190274_1056788213300018476SoilEEMVMAQGLGDADRQAPRDEKGDRGAGAPVGRDHAPHMG
Ga0173481_1008477013300019356SoilRSCAEHDAFKKVVMAQGLGHADRQAPRDEKGDRGLGTPARRDHASHMG
Ga0180113_134423313300020065Groundwater SedimentHAGAFGKMVLAQGLGDEDRQAPRAEKGDCGLGASIGRDHAPHMG
Ga0210406_1101829123300021168SoilDDANDALRSGADRAGAFDEMVLAQGLGDEDRQAPWDEEGDRGVGAAVGRNHAPHMG
Ga0210390_1001963493300021474SoilLRGRPEAGSFDEMVLVQGLGDEDRQASWDEKGDRGASAPIGRDYAPRLG
Ga0126371_1164913913300021560Tropical Forest SoilMVVAQGLGDADRQTPRDEEGHCRAGTTAGRDPAPHLG
Ga0224548_101197013300022518SoilDMVMAQGLGDADRQASRNEEGDCGAGAPIGRDHALHMG
Ga0247792_110690513300022880SoilEEMVLAQGLGDAGRQAPWDEKGDRGPGAPVGCDHAPHMG
Ga0233355_10048113300024037SoilAAFEEMVLAQGLGDADREAPRDEEGDRGPGAPAGRDHAPHMG
Ga0208455_109780423300025453PeatlandFEEMVLAQGLGDADRQAPWEEKGDRGAGTPVGRDHASHMG
Ga0208689_101010113300025459PeatlandALRSSSEYAAFEEMVLAQGLGDADRQAPRDEKGDRGPGAPVGRDHAPHMG
Ga0208188_106734143300025507PeatlandMVLAQGLGDADRQAPRDEKGDRGAGTPVSRDHAPHLG
Ga0208848_101482523300025509Arctic Peat SoilAAFEEMVLAQGLGDADRQASRDEEGDRGPGAPAGRDHAPHMG
Ga0207691_1131505313300025940Miscanthus RhizosphereRQNITLRRRDDAGDALRGSAEHAAFEEMVVAQGLSDADRQTPWDEKGDRGAGAPVGRDHAPHMG
Ga0207703_1181403213300026035Switchgrass RhizosphereMARDRSVMVLAQSLGDADRQASRDEKGDRGPGTPVGC
Ga0209840_114031513300026223SoilMVMAQGLGDADRQAPRDEKGDRGPGAPIGRDHAPYMG
Ga0209729_103700213300027061Forest SoilPDSSDAFDTMVMAQGLGDAGRQASREKEGHRRPGATVSRDPAPHLG
Ga0208097_100433723300027173Forest SoilHAAFEEMVLAQGLGHADRQTPRDEKGDRGPGAPVGRDHAPYVDRWH
Ga0208525_100330123300027288SoilMVLAQSLGDADRQASRDEKGDRGPGTPVGCDNAPHMG
Ga0207983_103448713300027310SoilHAAFEEMVLAQGLGDADRQAPRGKKSDRGPGTPVGCDHAPYLG
Ga0209382_1086721913300027909Populus RhizosphereEEMVVAQGLGDADRQAPWDEKGDRGAGAPVGRDHAPDLG
Ga0307285_1011467913300028712SoilMARDRSVMVLAQSLGDADRQASRDEKGDRGPGTPVGCD
Ga0316363_1003694733300030659Peatlands SoilAGAFGEVVLAQGLGHEDRQAPRDEEGDRGAGAPVSGDHAPHLG
Ga0307497_1003480333300031226SoilLRSGSGHVAFKEMVLAQGLGHEDRQAPRDEEGNRGPGAPVGRDHAPHLG
Ga0302324_10069387513300031236PalsaGSSEHAAVEEMVVAQGLGDADRQATRHEKSDRGPGSQVGRDPAPHLG
Ga0307428_117143713300031280Salt MarshSSPEHAAFEEMVLAQGLGDADRQASRDEKGDRSPGAPIGRHHAPHMG
Ga0302326_1030534033300031525PalsaEMVVAQGLGDADRQATRHEKSDRGPGSQVGRDPAPHLG
Ga0318560_1043494523300031682SoilMVLAQGLGDEDRQAPRDEKGNRCTSATLGRHYASERP
Ga0307474_1014442113300031718Hardwood Forest SoilKMVLAQGLGDADCQASRDEEGGGGAGASLSRDHASHLG
Ga0318500_1072953613300031724SoilVPFDKMVLAQGLGDADRQASRDEEGGRGAGASLGRDHASHLG
Ga0306918_1071230233300031744SoilFDKMVLAQGLGDADRQASRDEEGGRGAGASLGRDHASHLG
Ga0318535_1023652023300031764SoilGHAATFGKMVVAQGLGDEDRQAPRDEKGNRCTGSTVGRDYASHLD
Ga0318509_1080900913300031768SoilGHAATFGKMVVAQGLGDEDRQAPRDEKGNRRTGSTVGRDYASHLD
Ga0306925_1135108313300031890SoilDEMVLAQGLGDEGRQASRDEEGDRGAGASVGRDHAPRVG
Ga0306923_1021918653300031910SoilALRSGPGHADPHQQVVMAQGLGSKDRQAPRDEEGDRGAGASASRDPAPHLG
Ga0310909_1078742813300031947SoilFNKVVLAQGLGDADRQTSRDEKGDRGLGTPDGRDHAPHMG
Ga0318558_1024538113300032044SoilADDAVRSGPEHVGAFGKMVLAQGLGDEDRQASRDEEGDRGAGASLGRDYASRVG
Ga0318533_1004876043300032059SoilEEMVLAQGLGYANRQAPRNEEGDRGPGASIGRDHASHLG
Ga0318519_1008615913300033290SoilIAVRRRDDADDALRSGPEHAGAFGEMVLAQGLGDEDRQASRDKEGDRGAGAPVGRDHAPHVGWRHRVPVD
Ga0326726_1226165913300033433Peat SoilLRSSSEYAAFEEMVLAQGLGDADRQTPRDEKGDRGAGAPVGRDHAPHMG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.