NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F088748

Metagenome Family F088748

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088748
Family Type Metagenome
Number of Sequences 109
Average Sequence Length 46 residues
Representative Sequence MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCL
Number of Associated Samples 101
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 12.84 %
% of genes near scaffold ends (potentially truncated) 97.25 %
% of genes from short scaffolds (< 2000 bps) 85.32 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (57.798 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(18.349 % of family members)
Environment Ontology (ENVO) Unclassified
(33.945 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(44.954 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.47%    β-sheet: 13.16%    Coil/Unstructured: 72.37%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF01510Amidase_2 26.61
PF08123DOT1 6.42
PF13385Laminin_G_3 5.50
PF05105Phage_holin_4_1 4.59
PF04860Phage_portal 1.83
PF01844HNH 1.83
PF05732RepL 1.83
PF13539Peptidase_M15_4 0.92
PF13847Methyltransf_31 0.92
PF03382DUF285 0.92
PF09374PG_binding_3 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG4824Phage-related holin (Lysis protein)Mobilome: prophages, transposons [X] 4.59


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.91 %
UnclassifiedrootN/A10.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2236876001|none_p093445All Organisms → Viruses527Open in IMG/M
3300000115|DelMOSum2011_c10065302All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1344Open in IMG/M
3300000928|OpTDRAFT_10393594All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage589Open in IMG/M
3300000949|BBAY94_10039755All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1314Open in IMG/M
3300000949|BBAY94_10045848All Organisms → Viruses1216Open in IMG/M
3300001963|GOS2229_1035608All Organisms → Viruses1884Open in IMG/M
3300001965|GOS2243_1058264All Organisms → Viruses759Open in IMG/M
3300002098|JGI24219J26650_1014121All Organisms → Viruses → Predicted Viral1210Open in IMG/M
3300002161|JGI24766J26685_10015443All Organisms → Viruses → Predicted Viral1983Open in IMG/M
3300002408|B570J29032_109870826All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1819Open in IMG/M
3300003277|JGI25908J49247_10003954All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4733Open in IMG/M
3300005527|Ga0068876_10034498All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3139Open in IMG/M
3300005581|Ga0049081_10145205All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage870Open in IMG/M
3300005581|Ga0049081_10340208All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium510Open in IMG/M
3300005824|Ga0074474_1611057All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage910Open in IMG/M
3300005825|Ga0074476_1769662All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage922Open in IMG/M
3300006734|Ga0098073_1011690All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1461Open in IMG/M
3300006802|Ga0070749_10702164All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage541Open in IMG/M
3300006919|Ga0070746_10008703All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR1-KM17-C1015830Open in IMG/M
3300007545|Ga0102873_1082357All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage977Open in IMG/M
3300007560|Ga0102913_1279642All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
3300007593|Ga0102918_1155088All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage691Open in IMG/M
3300007618|Ga0102896_1097606All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage957Open in IMG/M
3300007621|Ga0102872_1163835All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage588Open in IMG/M
3300007981|Ga0102904_1006555All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2496Open in IMG/M
3300008261|Ga0114336_1218416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage786Open in IMG/M
3300008448|Ga0114876_1217716All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage627Open in IMG/M
3300008450|Ga0114880_1172178Not Available756Open in IMG/M
3300009037|Ga0105093_10154544All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1153Open in IMG/M
3300009085|Ga0105103_10695855All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300009135|Ga0118736_10091457All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR1-KM17-C101826Open in IMG/M
3300009169|Ga0105097_10411933All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage752Open in IMG/M
3300009170|Ga0105096_10147775All Organisms → Viruses → Predicted Viral1181Open in IMG/M
3300009488|Ga0114925_10591025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage785Open in IMG/M
3300009593|Ga0115011_11454134All Organisms → Viruses603Open in IMG/M
3300009790|Ga0115012_11962329All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300010312|Ga0102883_1139104All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage696Open in IMG/M
3300010389|Ga0136549_10414470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M
3300014811|Ga0119960_1017454Not Available868Open in IMG/M
3300017714|Ga0181412_1062789All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.919Open in IMG/M
3300017729|Ga0181396_1117988Not Available546Open in IMG/M
3300017776|Ga0181394_1089367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage992Open in IMG/M
3300017778|Ga0181349_1100369All Organisms → Viruses1084Open in IMG/M
3300017779|Ga0181395_1235980Not Available562Open in IMG/M
3300017785|Ga0181355_1384093All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium510Open in IMG/M
3300019784|Ga0181359_1205780All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium630Open in IMG/M
3300020151|Ga0211736_10351513All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage567Open in IMG/M
3300020220|Ga0194119_10692348All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium616Open in IMG/M
3300020450|Ga0211641_10540052All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage553Open in IMG/M
3300021365|Ga0206123_10439888All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage530Open in IMG/M
3300022198|Ga0196905_1194070All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage511Open in IMG/M
3300022407|Ga0181351_1271506All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium515Open in IMG/M
(restricted) 3300022913|Ga0233404_10137574Not Available590Open in IMG/M
(restricted) 3300023112|Ga0233411_10062847All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1165Open in IMG/M
(restricted) 3300023112|Ga0233411_10160496All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage735Open in IMG/M
(restricted) 3300023276|Ga0233410_10030038All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1577Open in IMG/M
(restricted) 3300024062|Ga0255039_10015339All Organisms → Viruses → Predicted Viral2675Open in IMG/M
3300024334|Ga0228671_1151025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300024343|Ga0244777_10315260All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage985Open in IMG/M
(restricted) 3300024519|Ga0255046_10020271All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium2352Open in IMG/M
(restricted) 3300024519|Ga0255046_10245760All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.824Open in IMG/M
(restricted) 3300024528|Ga0255045_10006588All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.3107Open in IMG/M
(restricted) 3300024528|Ga0255045_10420908Not Available549Open in IMG/M
3300025099|Ga0208669_1011359Not Available2470Open in IMG/M
3300025732|Ga0208784_1225773All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium542Open in IMG/M
3300027084|Ga0208443_1000792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8685Open in IMG/M
3300027121|Ga0255074_1006792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1571Open in IMG/M
3300027127|Ga0255071_1024107All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium943Open in IMG/M
3300027142|Ga0255065_1016371All Organisms → Viruses → Predicted Viral1485Open in IMG/M
3300027151|Ga0255063_1021164All Organisms → Viruses → Predicted Viral1362Open in IMG/M
3300027151|Ga0255063_1071530All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage643Open in IMG/M
3300027156|Ga0255078_1005799All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3024Open in IMG/M
3300027217|Ga0208928_1011042All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1499Open in IMG/M
3300027217|Ga0208928_1026278All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage931Open in IMG/M
3300027219|Ga0208167_1033119All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage915Open in IMG/M
3300027220|Ga0208927_1046255All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage789Open in IMG/M
3300027226|Ga0208309_1000895All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3558Open in IMG/M
3300027235|Ga0208804_1011295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage929Open in IMG/M
3300027244|Ga0208173_1057822All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage689Open in IMG/M
3300027258|Ga0208558_1002351All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2604Open in IMG/M
3300027259|Ga0208178_1023076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1156Open in IMG/M
3300027261|Ga0208933_1027888All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage930Open in IMG/M
3300027525|Ga0208437_1002224All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5481Open in IMG/M
3300027582|Ga0208971_1066417All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium924Open in IMG/M
3300027659|Ga0208975_1019871All Organisms → Viruses → Predicted Viral2214Open in IMG/M
3300027732|Ga0209442_1281338Not Available582Open in IMG/M
3300027762|Ga0209288_10306623All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300027792|Ga0209287_10369014All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage552Open in IMG/M
(restricted) 3300027861|Ga0233415_10204247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage912Open in IMG/M
(restricted) 3300027861|Ga0233415_10239884All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.844Open in IMG/M
3300027899|Ga0209668_10870237All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage607Open in IMG/M
(restricted) 3300027996|Ga0233413_10164936All Organisms → Viruses921Open in IMG/M
(restricted) 3300028045|Ga0233414_10076802All Organisms → Viruses → Predicted Viral1414Open in IMG/M
3300028129|Ga0228634_1029525All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1551Open in IMG/M
3300029306|Ga0135212_1011817Not Available790Open in IMG/M
3300029308|Ga0135226_1015705Not Available659Open in IMG/M
3300029345|Ga0135210_1042373All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300029635|Ga0135217_108930All Organisms → Viruses622Open in IMG/M
3300029753|Ga0135224_1036986Not Available537Open in IMG/M
3300031746|Ga0315293_10292657All Organisms → Viruses → Predicted Viral1309Open in IMG/M
3300031758|Ga0315907_10395144All Organisms → Viruses → Predicted Viral1116Open in IMG/M
3300031951|Ga0315904_10967992All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300031963|Ga0315901_11100314All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300032088|Ga0315321_10072375All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium TMED2142376Open in IMG/M
3300032277|Ga0316202_10100989All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1337Open in IMG/M
3300033557|Ga0316617_101818930All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300034101|Ga0335027_0100443All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2209Open in IMG/M
3300034167|Ga0335017_0475973All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium665Open in IMG/M
3300034374|Ga0348335_063000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1346Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine18.35%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater8.26%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater7.34%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake6.42%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment5.50%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater5.50%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.59%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor4.59%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine3.67%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.75%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.75%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.83%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.83%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.83%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface1.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.92%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.92%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic0.92%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.92%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.92%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.92%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic0.92%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.92%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.92%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.92%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine0.92%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.92%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.92%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.92%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.92%
Marine SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment0.92%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment0.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.92%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2236876001Marine microbial communities from Columbia River, CM, sample from CR-7km from mouth, GS312-0p1-CR7-chlmaxEnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001963Marine microbial communities from Nags Head, North Carolina, USA - GS013EnvironmentalOpen in IMG/M
3300001965Marine microbial communities from Coastal Floreana, Equador - GS028EnvironmentalOpen in IMG/M
3300002098Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenomeEnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005824Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBCEnvironmentalOpen in IMG/M
3300005825Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBBEnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007560Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02EnvironmentalOpen in IMG/M
3300007593Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3EnvironmentalOpen in IMG/M
3300007618Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02EnvironmentalOpen in IMG/M
3300007621Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3EnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009135Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsfEnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009488Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaGEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010312Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02EnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300020450Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022913 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MGEnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024334Seawater microbial communities from Monterey Bay, California, United States - 89DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300024528 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027084Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027121Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027127Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8hEnvironmentalOpen in IMG/M
3300027142Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300027151Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300027156Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027217Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027219Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027220Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027226Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027235Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027244Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027258Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027259Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027261Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027582Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027762Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027792Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028129Seawater microbial communities from Monterey Bay, California, United States - 42DEnvironmentalOpen in IMG/M
3300029306Marine harbor viral communities from the Indian Ocean - SCH3EnvironmentalOpen in IMG/M
3300029308Marine harbor viral communities from the Indian Ocean - SRB2EnvironmentalOpen in IMG/M
3300029345Marine harbor viral communities from the Indian Ocean - SCH1EnvironmentalOpen in IMG/M
3300029635Marine harbor viral communities from the Indian Ocean - SMH2EnvironmentalOpen in IMG/M
3300029753Marine harbor viral communities from the Indian Ocean - SRH3EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034167Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
none_09344522236876001Marine EstuarineNIHELRLEGTHAKIAMMSDLHWDNPKCDWKQLKQDLDYCLKESIPYYD
DelMOSum2011_1006530243300000115MarineMKIEQHEKNVHVLKLEGNKCQIAMLSDLHWDNPKCDW
OpTDRAFT_1039359413300000928Freshwater And MarineMIVKKHAKNIHEIQLEGELVKIAMLSDLHWDNPKSDWKILKRDLDY
BBAY94_1003975513300000949Macroalgal SurfaceMILKKHAKNIHEIQMDGKQVKIAMLSDIHWDNPKCDWRLLKRDL
BBAY94_1004584833300000949Macroalgal SurfaceMEIIKHASNIHELKLIGSRAKIAMLSDIHWDNPKCNWDLLKNDLNYCLKESIP
GOS2229_103560813300001963MarineMKLIKHADNIHELKLDGTRAKIAMLSDIHWDNPKCDWKLLKNDLDFCLDNSIP
GOS2243_105826413300001965MarineMKLIKHADNIHELKLAGTKARIAMFSDLHWDNPKCDWKLLKKDLDYCVKESIPIH
JGI24219J26650_101412133300002098LenticMNLIKHXKNIHELRVEGSSFRMGMFSDIHWDNPKCDWNLLKRDLDYCLKN
JGI24766J26685_1001544313300002161Freshwater And SedimentMNIVKHAKNIHEIQVKGCKAKIAMLSDIHWDNPKCDWNLLKRDLDYCVSENIPIM
B570J29032_10987082653300002408FreshwaterMLIKHSKNIHELQLTGKNVQIAMMSDLHWDNPKCDWDLLKRDFDYCLENDIK
JGI25908J49247_1000395493300003277Freshwater LakeMLKKHSKNIHELHIDGATVQLAMMSDLHWDNPKCDWDLLKRDFDYCLENDIK
Ga0068876_1003449873300005527Freshwater LakeMNVIKYAKNVHEIKLEGYNARIAMLSDIHWDNPKCDWDLLKKHLDYCVSE
Ga0049081_1014520513300005581Freshwater LenticMKVTKHTKNIHELCLEGKHVQVAMLSDIHWDNPKCDWDYLKRHLDYCVKE
Ga0049081_1034020823300005581Freshwater LenticMNLIKHAKNIHELRVEGSSFRMGMFSDIHWDNPKCDWNLLKHDLDYCLN
Ga0074474_161105713300005824Sediment (Intertidal)MILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKL
Ga0074476_176966213300005825Sediment (Intertidal)MILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKL
Ga0098073_101169013300006734MarineMTIIEHAENIHELQIDGTKTKIAMLSDIHWDNPKCDWKLLKKDLDYCLQE
Ga0070749_1070216423300006802AqueousMNLIKHAKNVHELKVEGPEFRMAMLSDLHWDNPKCDWNLLKKDLDYCVSE
Ga0070746_1000870313300006919AqueousMKLIKHAKNIHEVKLEGTHAKIAMLSDLHWDNPKCDWKLLKQDLDYC
Ga0102873_108235733300007545EstuarineMILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIPVMIN
Ga0102913_127964223300007560EstuarineMILKKHSKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIP
Ga0102918_115508833300007593EstuarineMILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLL
Ga0102896_109760633300007618EstuarineMILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEH
Ga0102872_116383523300007621EstuarineMILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLL
Ga0102904_100655513300007981EstuarineMILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYC
Ga0114336_121841613300008261Freshwater, PlanktonMILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNI
Ga0114876_121771633300008448Freshwater LakeMILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRD
Ga0114880_117217813300008450Freshwater LakeMLTKISKNVHVLKTQGKEIKIAMLSDIHWDNPKCDWDY
Ga0105093_1015454433300009037Freshwater SedimentMILKKHAKNIHELQLEGNLVKIAMLSDIHWDNPKSDWNILKRD
Ga0105103_1069585513300009085Freshwater SedimentMKVTKSTKNIHVLSLQGKHVEIAMLSDIHWDNPKCDWNYL
Ga0118736_1009145713300009135Marine SedimentMKLITHATNIHELKLQGTRAKIAMLSDIHWDNPKCDWKLLKNDLD
Ga0105097_1041193313300009169Freshwater SedimentMNVIKHAKNIHEIKLEGMDVKIAMLSDLHWDNPKCDW
Ga0105096_1014777553300009170Freshwater SedimentMNLIKHSKNVHELKVEGPEFRMAMLSDLHWDNPKCDWDLL
Ga0114925_1059102543300009488Deep SubsurfaceMKLIKHADNIHELKLDGTRAKIAMLSDIHWDNPKCDRKLLKNDL
Ga0115011_1145413413300009593MarineMKIIEHARNIHQLRLEGTHAKIAMLSDIHWDNPKCDWKQLKKDLNYCVK*
Ga0115012_1196232923300009790MarineMKLIKHAKNIHELKLEGTQAKIAMMSDLHWDNPKCDWKQLKQDLDYCKIRIN*
Ga0102883_113910413300010312EstuarineMILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIP
Ga0136549_1041447023300010389Marine Methane Seep SedimentMEIIKHAENIHEIKVDGTKTRIAMLSDIHWDNPKCDWKLLK
Ga0119960_101745433300014811AquaticMELIKHAKNIHELKITGTKVKIGMFSDIHWDNPK*
Ga0181412_106278933300017714SeawaterMEIIKHASNIHELKLSGTKAKIAMLSDIHWDNPKCNWDLLKNDLNYCLKESIPIHING
Ga0181396_111798823300017729SeawaterMEIIKHASNIHELKLTGSRAKIAMLSDIHWDNPKCNWD
Ga0181394_108936713300017776SeawaterMKLIKHASNIHELRLEGTHAKIAMMSDLHWDNPKCDWKQL
Ga0181349_110036933300017778Freshwater LakeMNLIKHEKNIHELRVEGSSFRMGMFSDIHWDNPKCDWNLLKHDLDYC
Ga0181395_123598033300017779SeawaterMKLIKHAGNIHELRLEGTHAKIAMMSDLHWDNPKCDWKQLKQ
Ga0181355_138409313300017785Freshwater LakeMNLIKHEKNIHELRVEGSSFRMGMFSDIHWDNPKCDWNLLKHDLDFCLKNEIPIMFN
Ga0181359_120578013300019784Freshwater LakeMNLIKHAKNIHELRVEGSSFRMGMFSDIHWDNPKCDWNLLKHDLDYCL
Ga0211736_1035151333300020151FreshwaterMTVKKHAKNIHELNLIGKKVKIAMLSDIHWDNPKCDWNQLKK
Ga0194119_1069234823300020220Freshwater LakeMNLIKHANNIHELRVDGTLFKLGMFSDIHWDNPKCDWAL
Ga0211641_1054005213300020450MarineMRELKKINMKLIEHANNIHELKLEGNKARIAMFSDIHWDNPKCDWKLLKKDLDYCIK
Ga0206123_1043988813300021365SeawaterMEITKHAKNIHELKLVGTHAKIAMLSDLHWDNPKCDWT
Ga0196905_119407013300022198AqueousMIVKKHAKNIHEIQLDGKQVKIAMLSDIHWDNPKCDWKLLKRDLDYCVDNQI
Ga0181351_127150613300022407Freshwater LakeMNLIKHEKNIHELRVEGSSFRMGMFSDIHWDNPKCDWNLLKHDLDYCL
(restricted) Ga0233404_1013757433300022913SeawaterMKLIKHAKNIHELKLEGTHAKIAMFSDIHWDNPKCDWSILKKDLD
(restricted) Ga0233411_1006284713300023112SeawaterMKLIKHAKNIHELKLDGTHAKIAMLSDLHWDNPKCDWKILKKDLDYCVKES
(restricted) Ga0233411_1016049623300023112SeawaterMKLEQHEKNVHVLKLEGNKCQIAMLSDLHWDNPKCDWKLL
(restricted) Ga0233410_1003003813300023276SeawaterMKLTKHAKNIHELKLEGTHAKIAMFSDIHWDNPKCDWSILKK
(restricted) Ga0255039_1001533913300024062SeawaterMKLIKHAKNIHELKLEGTHAKIAMLSDLHWDNPKCDWKLL
Ga0228671_115102533300024334SeawaterMKLIKHANNIHELRLVGTHVKIAMMSDLHWDNPKCDWKQLKKDLD
Ga0244777_1031526013300024343EstuarineMILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIPVMING
(restricted) Ga0255046_1002027133300024519SeawaterMEIIKHAKNIHELKLEGTHAKIAMFSDIHWDNPKCDWSILKKDLDY
(restricted) Ga0255046_1024576013300024519SeawaterMKLTKHAKNIHELKLEGTHAKIAMFSDIHWDNPKCDWSILKKDLDY
(restricted) Ga0255045_1000658813300024528SeawaterMKLIKHAGNIHELKLEGTHAKIAMFSDLHWDNPKCDWKILKKDL
(restricted) Ga0255045_1042090813300024528SeawaterMKLIKHAKNIHELKLEGSHVKIGMFSDIHWDNPKCDWTIL
Ga0208669_101135913300025099MarineMKIKAHAANIHEIKLEGTKARIAMLSDIHWDNPKC
Ga0208784_122577313300025732AqueousMNLIKHAKNIHELRVEGTSFRMGMFSDIHWDNPKCDWNL
Ga0208443_1000792143300027084EstuarineMILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIPVMIN
Ga0255074_100679213300027121FreshwaterMILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIPVM
Ga0255071_102410713300027127FreshwaterMNLIKHAKNIHELRVEGSSFRMGMFSDIHWDNPKCDWNLLKHDLDYCLNNEIPIMFN
Ga0255065_101637143300027142FreshwaterMNLIKHAKNIHELRVDGTSFRMGMFSDIHWDNPKCDWNLLKHDLDYCLNNEIPIMFNGDT
Ga0255063_102116443300027151FreshwaterMNLIKHAKNIHELRVDGTSFRMGMFSDIHWDNPKCDWNLLK
Ga0255063_107153013300027151FreshwaterMILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLE
Ga0255078_100579963300027156FreshwaterMILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLK
Ga0208928_101104243300027217EstuarineMILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIPVMIT
Ga0208928_102627833300027217EstuarineMILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIP
Ga0208167_103311913300027219EstuarineMILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCL
Ga0208927_104625513300027220EstuarineMILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIPV
Ga0208309_100089513300027226EstuarineMILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHN
Ga0208804_101129533300027235EstuarineMILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLE
Ga0208173_105782213300027244EstuarineMILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLEHNIPV
Ga0208558_100235113300027258EstuarineMILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDW
Ga0208178_102307633300027259EstuarineMILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLKR
Ga0208933_102788813300027261EstuarineMILKKHAKNIHELQLDGNLVKIAMLSDVHWDNPKSDWKLLK
Ga0208437_1002224113300027525EstuarineMIVKKHAKNIHEIQLEGELVKIAMLSDLHWDNPKSDWKILK
Ga0208971_106641713300027582MarineMKLIKHAKNIHELKLEGSHAKIAMFSDIHWDNPKCDWTIL
Ga0208975_101987153300027659Freshwater LenticMNLIKHAKNIHELRVDGTSFRMGMFSDIHWDNPKCDWNLLKHDLDYCLNNEIPIMFNGD
Ga0209442_128133823300027732Freshwater LakeMELIKHSKNVHELLLEGKKVQLAVLSDLHWDNPKCDWKLLQKDLDYCLDKKIPV
Ga0209288_1030662313300027762Freshwater SedimentMILKKHAKNIHELQLDGNLVKIAMLSDLHWDNPKSDWKI
Ga0209287_1036901413300027792Freshwater SedimentMILKKHAKNIHEIQLEGELVKIAMLSDLHWDNPKSDWKLLK
(restricted) Ga0233415_1020424713300027861SeawaterMEIIKHAKNIHELKLEGTHAKIAMFSDIHWDNPKCDWSILKKD
(restricted) Ga0233415_1023988433300027861SeawaterMKLTKHAKNIHELKLEGTHAKIAMFSDIHWDNPKCDWS
Ga0209668_1087023723300027899Freshwater Lake SedimentMELIKHSKNVHVLKLHGKSVKIAMLSDIHWDNPKCD
(restricted) Ga0233413_1016493613300027996SeawaterMKVIRHAKNVHEIQLEGKYAEMAMLSDLHWDNPKCDQDLLK
(restricted) Ga0233414_1007680213300028045SeawaterMKLIKHAKNIHELKLEGTHAKIAMLSDLHWDNPKCDWKLLKKDLDYCLK
Ga0228634_102952513300028129SeawaterMKLIKHAGNIHELKLQGTHAKIAMFSDLHWDNPKCDWTILK
Ga0135212_101181713300029306Marine HarborMEIVKHEENIHEIKLHGTHTKIAMLSDIHWDNLDAIVTGK
Ga0135226_101570513300029308Marine HarborMKLIKHADNIHELKLDGTRAKIAMLSDIHWDNPKQIVTGK
Ga0135210_104237323300029345Marine HarborMKLIKHSENIHELKLDGTRAKIAMLSDIHWDNPKCDWKLFLF
Ga0135217_10893023300029635Marine HarborMEIVKHEENIHEIKLHGTHTKIAMLSDIHWDNPKCDWELLKKDLDYCVQESIPIMINA
Ga0135224_103698613300029753Marine HarborMKLIKHADNIHELKLDGTRAKIAMLSDIHWDTPDRDWE
Ga0315293_1029265733300031746SedimentMNLIKHEKNIHELRVDGSSFRMGMFSDIHWDNPKCDWNLLKHDLDYCLKNEIPIMFNGD
Ga0315907_1039514433300031758FreshwaterMNLIKHAKNIHELRVDGTSFRMGMFSDIHWDNPKCDWNLLKHDLDYCLKN
Ga0315904_1096799213300031951FreshwaterMIFKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKRDLDYCLENNIPVMI
Ga0315901_1110031413300031963FreshwaterMNVIKHAKNIHEIKLEGTKASIAMLSDIHWDNPKCDWNLLKKHLDYCVSEN
Ga0315321_1007237513300032088SeawaterMEIIKHAKNIHELRLIGTHAKIAMFSDIHWDNPKC
Ga0316202_1010098913300032277Microbial MatMKIEQHEKNVHVLKLKGNKCQIAMLSDLHWDNPKCDWKL
Ga0316617_10181893023300033557SoilMKIIKHAKNVHELKVEGPEFRMAMLSDLHWDNPKCDWDLLKKDLDYC
Ga0335027_0100443_2083_22083300034101FreshwaterMILKKHAKNIHELQLEGNLVKIAMLSDVHWDNPKSDWKLLKR
Ga0335017_0475973_2_1333300034167FreshwaterMNLIKHEKNIHELRVEGSSFRMGMFSDIHWDNPKCDWGLLKHDL
Ga0348335_063000_1216_13443300034374AqueousMTITKHADNIHELHLDGTKTRIAMLSDIHWDNPKCDWKLLKKD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.