NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F088270

Metagenome Family F088270

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088270
Family Type Metagenome
Number of Sequences 109
Average Sequence Length 40 residues
Representative Sequence MIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILF
Number of Associated Samples 34
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.71 %
% of genes near scaffold ends (potentially truncated) 16.51 %
% of genes from short scaffolds (< 2000 bps) 71.56 %
Associated GOLD sequencing projects 30
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.807 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment
(29.358 % of family members)
Environment Ontology (ENVO) Unclassified
(42.202 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(33.028 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.33%    β-sheet: 0.00%    Coil/Unstructured: 91.67%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF14437MafB19-deam 1.83
PF05016ParE_toxin 1.83
PF00155Aminotran_1_2 1.83
PF01609DDE_Tnp_1 1.83
PF00005ABC_tran 1.83
PF01850PIN 1.83
PF05036SPOR 1.83
PF01182Glucosamine_iso 1.83
PF04011LemA 0.92
PF01925TauE 0.92
PF10543ORF6N 0.92
PF04365BrnT_toxin 0.92
PF00072Response_reg 0.92
PF01555N6_N4_Mtase 0.92
PF00196GerE 0.92
PF00731AIRC 0.92
PF01106NifU 0.92
PF01943Polysacc_synt 0.92
PF00923TAL_FSA 0.92
PF00175NAD_binding_1 0.92
PF13183Fer4_8 0.92
PF01661Macro 0.92
PF01596Methyltransf_3 0.92
PF01743PolyA_pol 0.92
PF12732YtxH 0.92
PF01041DegT_DnrJ_EryC1 0.92
PF02754CCG 0.92
PF00173Cyt-b5 0.92
PF00909Ammonium_transp 0.92
PF00535Glycos_transf_2 0.92
PF16363GDP_Man_Dehyd 0.92
PF01402RHH_1 0.92
PF13620CarboxypepD_reg 0.92
PF11737DUF3300 0.92
PF07238PilZ 0.92
PF01842ACT 0.92
PF05496RuvB_N 0.92
PF02954HTH_8 0.92
PF07724AAA_2 0.92
PF02806Alpha-amylase_C 0.92
PF05175MTS 0.92
PF16983MFS_MOT1 0.92
PF00528BPD_transp_1 0.92
PF03446NAD_binding_2 0.92
PF16360GTP-bdg_M 0.92
PF09699Paired_CXXCH_1 0.92
PF01061ABC2_membrane 0.92
PF02749QRPTase_N 0.92
PF07998Peptidase_M54 0.92
PF13185GAF_2 0.92
PF02656DUF202 0.92
PF04909Amidohydro_2 0.92
PF13633Obsolete Pfam Family 0.92
PF02594DUF167 0.92
PF00330Aconitase 0.92
PF04216FdhE 0.92
PF00990GGDEF 0.92
PF09723Zn-ribbon_8 0.92
PF13632Glyco_trans_2_3 0.92
PF08352oligo_HPY 0.92
PF00227Proteasome 0.92
PF02518HATPase_c 0.92
PF13447Multi-haem_cyto 0.92
PF02416TatA_B_E 0.92
PF02576RimP_N 0.92
PF03720UDPG_MGDP_dh_C 0.92
PF13353Fer4_12 0.92
PF03466LysR_substrate 0.92
PF12441CopG_antitoxin 0.92
PF02361CbiQ 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG03636-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminaseCarbohydrate transport and metabolism [G] 1.83
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 1.83
COG3293TransposaseMobilome: prophages, transposons [X] 1.83
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 1.83
COG5421TransposaseMobilome: prophages, transposons [X] 1.83
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 1.83
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 1.83
COG0004Ammonia channel protein AmtBInorganic ion transport and metabolism [P] 0.92
COG0157Nicotinate-nucleotide pyrophosphorylaseCoenzyme transport and metabolism [H] 0.92
COG0176Transaldolase/fructose-6-phosphate aldolaseCarbohydrate transport and metabolism [G] 0.92
COG0247Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcFEnergy production and conversion [C] 0.92
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 0.92
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 0.92
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.92
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.92
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.92
COG0617tRNA nucleotidyltransferase/poly(A) polymeraseTranslation, ribosomal structure and biogenesis [J] 0.92
COG0619ECF-type transporter transmembrane protein EcfTCoenzyme transport and metabolism [H] 0.92
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.92
COG063820S proteasome, alpha and beta subunitsPosttranslational modification, protein turnover, chaperones [O] 0.92
COG0694Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domainPosttranslational modification, protein turnover, chaperones [O] 0.92
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.92
COG0779Ribosome maturation factor RimPTranslation, ribosomal structure and biogenesis [J] 0.92
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.92
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.92
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.92
COG1488Nicotinic acid phosphoribosyltransferaseCoenzyme transport and metabolism [H] 0.92
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 0.92
COG1704Magnetosome formation protein MamQ, lipoprotein antigen LemA familyCell wall/membrane/envelope biogenesis [M] 0.92
COG1826Twin-arginine protein secretion pathway components TatA and TatBIntracellular trafficking, secretion, and vesicular transport [U] 0.92
COG1872Uncharacterized conserved protein YggU, UPF0235/DUF167 familyFunction unknown [S] 0.92
COG1913Predicted Zn-dependent proteaseGeneral function prediction only [R] 0.92
COG2048Heterodisulfide reductase, subunit BEnergy production and conversion [C] 0.92
COG2110O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domainTranslation, ribosomal structure and biogenesis [J] 0.92
COG2149Uncharacterized membrane protein YidH, DUF202 familyFunction unknown [S] 0.92
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.92
COG2255Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvBReplication, recombination and repair [L] 0.92
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.92
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.92
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 0.92
COG3058Formate dehydrogenase maturation protein FdhEPosttranslational modification, protein turnover, chaperones [O] 0.92
COG3484Predicted proteasome-type proteasePosttranslational modification, protein turnover, chaperones [O] 0.92
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.92
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 0.92
COG5405ATP-dependent protease HslVU (ClpYQ), peptidase subunitPosttranslational modification, protein turnover, chaperones [O] 0.92

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.81 %
UnclassifiedrootN/A31.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000229|TB_LI09_3DRAFT_1124062Not Available529Open in IMG/M
3300007959|Ga0079306_1187908All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria523Open in IMG/M
3300009053|Ga0105095_10025138All Organisms → cellular organisms → Bacteria3207Open in IMG/M
3300009053|Ga0105095_10026875All Organisms → cellular organisms → Bacteria3098Open in IMG/M
3300009053|Ga0105095_10030738All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS22891Open in IMG/M
3300009053|Ga0105095_10043713All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_82410Open in IMG/M
3300009053|Ga0105095_10054933All Organisms → cellular organisms → Bacteria2142Open in IMG/M
3300009053|Ga0105095_10105085All Organisms → cellular organisms → Bacteria1533Open in IMG/M
3300009053|Ga0105095_10107442Not Available1515Open in IMG/M
3300009053|Ga0105095_10125362All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_81397Open in IMG/M
3300009053|Ga0105095_10127371All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300009053|Ga0105095_10184708Not Available1141Open in IMG/M
3300009053|Ga0105095_10202601Not Available1087Open in IMG/M
3300009053|Ga0105095_10286522Not Available905Open in IMG/M
3300009053|Ga0105095_10320364All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300009053|Ga0105095_10387902All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300009053|Ga0105095_10662074All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300009053|Ga0105095_10685785All Organisms → cellular organisms → Bacteria → Nitrospirae571Open in IMG/M
3300009075|Ga0105090_10327664All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300009078|Ga0105106_10541845All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300009087|Ga0105107_10375146Not Available992Open in IMG/M
3300009153|Ga0105094_10488016Not Available716Open in IMG/M
3300009153|Ga0105094_10542512Not Available677Open in IMG/M
3300009166|Ga0105100_10497048All Organisms → cellular organisms → Bacteria → Nitrospirae743Open in IMG/M
3300009166|Ga0105100_10513388All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8731Open in IMG/M
3300009171|Ga0105101_10068443All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_81724Open in IMG/M
3300009171|Ga0105101_10194411All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria982Open in IMG/M
3300009171|Ga0105101_10286114Not Available797Open in IMG/M
3300009171|Ga0105101_10314674Not Available758Open in IMG/M
3300009171|Ga0105101_10372627Not Available694Open in IMG/M
3300010391|Ga0136847_10286551All Organisms → cellular organisms → Bacteria7123Open in IMG/M
3300010391|Ga0136847_11081095All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8918Open in IMG/M
3300010391|Ga0136847_12644746All Organisms → cellular organisms → Bacteria18195Open in IMG/M
3300010391|Ga0136847_12875189All Organisms → cellular organisms → Bacteria7089Open in IMG/M
3300012152|Ga0137347_1092348All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8540Open in IMG/M
3300012931|Ga0153915_10068494All Organisms → cellular organisms → Bacteria3688Open in IMG/M
3300012931|Ga0153915_10075037All Organisms → cellular organisms → Bacteria3531Open in IMG/M
3300012931|Ga0153915_10146655All Organisms → cellular organisms → Bacteria → Nitrospirae2554Open in IMG/M
3300012931|Ga0153915_10334057Not Available1700Open in IMG/M
3300012931|Ga0153915_10663083All Organisms → cellular organisms → Bacteria → Nitrospirae1203Open in IMG/M
3300012931|Ga0153915_10744692Not Available1134Open in IMG/M
3300012931|Ga0153915_11184700All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_41_22892Open in IMG/M
3300012931|Ga0153915_11248213Not Available868Open in IMG/M
3300012931|Ga0153915_11472664Not Available796Open in IMG/M
3300012931|Ga0153915_11995253All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_41_22679Open in IMG/M
3300012931|Ga0153915_12633918All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8588Open in IMG/M
3300012931|Ga0153915_12868856Not Available562Open in IMG/M
3300012931|Ga0153915_13170362All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8534Open in IMG/M
3300012931|Ga0153915_13245261Not Available528Open in IMG/M
3300012931|Ga0153915_13481207All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300012931|Ga0153915_13556667All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8504Open in IMG/M
3300012964|Ga0153916_10217006All Organisms → cellular organisms → Bacteria1914Open in IMG/M
3300012964|Ga0153916_10520071All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_81262Open in IMG/M
3300012964|Ga0153916_10615360Not Available1163Open in IMG/M
3300012964|Ga0153916_10850002All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8993Open in IMG/M
3300012964|Ga0153916_11827045All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8680Open in IMG/M
3300012964|Ga0153916_12750968All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8555Open in IMG/M
3300014324|Ga0075352_1243088Not Available551Open in IMG/M
3300018070|Ga0184631_10095129All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_81155Open in IMG/M
3300025164|Ga0209521_10385702All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300025167|Ga0209642_10049689All Organisms → cellular organisms → Bacteria2432Open in IMG/M
3300027713|Ga0209286_1313342All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8544Open in IMG/M
3300027731|Ga0209592_1143632All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8858Open in IMG/M
3300027731|Ga0209592_1235315All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8638Open in IMG/M
3300027740|Ga0214474_1080444All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300030613|Ga0299915_10018344All Organisms → cellular organisms → Bacteria → Proteobacteria5232Open in IMG/M
3300030613|Ga0299915_10063955All Organisms → cellular organisms → Bacteria → Nitrospirae2714Open in IMG/M
3300030613|Ga0299915_10187522All Organisms → cellular organisms → Bacteria1466Open in IMG/M
3300030613|Ga0299915_10812691All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8581Open in IMG/M
3300030613|Ga0299915_10816777Not Available580Open in IMG/M
3300031834|Ga0315290_10109035All Organisms → cellular organisms → Bacteria2344Open in IMG/M
3300031873|Ga0315297_10050512Not Available3149Open in IMG/M
3300031873|Ga0315297_10197881Not Available1653Open in IMG/M
3300031873|Ga0315297_11609141All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300032156|Ga0315295_10147737Not Available2333Open in IMG/M
3300032156|Ga0315295_11035191Not Available813Open in IMG/M
3300032163|Ga0315281_10115689All Organisms → cellular organisms → Bacteria3085Open in IMG/M
3300032163|Ga0315281_10177392All Organisms → cellular organisms → Bacteria2392Open in IMG/M
3300032163|Ga0315281_10179226Not Available2378Open in IMG/M
3300032342|Ga0315286_10708502Not Available1027Open in IMG/M
3300032401|Ga0315275_10098985All Organisms → cellular organisms → Bacteria3194Open in IMG/M
3300032516|Ga0315273_10023013All Organisms → cellular organisms → Bacteria8236Open in IMG/M
3300032516|Ga0315273_10116667All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_47_93653Open in IMG/M
3300033486|Ga0316624_10015104All Organisms → cellular organisms → Bacteria4138Open in IMG/M
3300033486|Ga0316624_10020501All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3710Open in IMG/M
3300033486|Ga0316624_10104042All Organisms → cellular organisms → Bacteria2008Open in IMG/M
3300033486|Ga0316624_10123919All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium1875Open in IMG/M
3300033486|Ga0316624_10152256All Organisms → cellular organisms → Bacteria → Nitrospirae1726Open in IMG/M
3300033486|Ga0316624_10277036All Organisms → cellular organisms → Bacteria1347Open in IMG/M
3300033486|Ga0316624_10375087All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae1181Open in IMG/M
3300033486|Ga0316624_11126928All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300033486|Ga0316624_11337481Not Available655Open in IMG/M
3300033486|Ga0316624_11739656Not Available576Open in IMG/M
3300033489|Ga0299912_10159463All Organisms → cellular organisms → Bacteria1958Open in IMG/M
3300033489|Ga0299912_10239635Not Available1545Open in IMG/M
3300033489|Ga0299912_10249452All Organisms → cellular organisms → Bacteria1507Open in IMG/M
3300033489|Ga0299912_11340275All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12515Open in IMG/M
3300033513|Ga0316628_100267060All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2107Open in IMG/M
3300033513|Ga0316628_100382995All Organisms → cellular organisms → Bacteria1782Open in IMG/M
3300033513|Ga0316628_100543778All Organisms → cellular organisms → Bacteria1506Open in IMG/M
3300033513|Ga0316628_100889261All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300033513|Ga0316628_101062964All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300033513|Ga0316628_101357488All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300034388|Ga0373907_090267Not Available724Open in IMG/M
3300034414|Ga0373905_041093All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8688Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment29.36%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands20.18%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil14.68%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment12.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil5.50%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment3.67%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry1.83%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater0.92%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.92%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.92%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000229Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_3EnvironmentalOpen in IMG/M
3300007959Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanotroph_Enrichment_5EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300012152Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300018070Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1EnvironmentalOpen in IMG/M
3300025164Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027713Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027731Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027740Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeqEnvironmentalOpen in IMG/M
3300027811Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeqEnvironmentalOpen in IMG/M
3300030613Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033489Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034388Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B3A4.2EngineeredOpen in IMG/M
3300034414Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A4.3EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
TB_LI09_3DRAFT_112406213300000229GroundwaterPLTLALSLRGRGDYNWFLPLEGGGLGEGEMSILF*
Ga0079306_118790813300007959Deep SubsurfaceMIPLTLALSLRGRGDYSWFLPIEVRLRRLVRTQADSPRRAEERGGLGEGEMSILFCDR*
Ga0105095_1002513853300009053Freshwater SedimentMIPLTLALSLRGRGDCSWFLPLEGGGLGEGEMSILF*
Ga0105095_1002687533300009053Freshwater SedimentMIPLTLAPSLQGRGDYSWFLPLEGGALREGEMSILF*
Ga0105095_1003073853300009053Freshwater SedimentMIPLTLALSLRGRGDYSWVLPLEGGGLGEGEISILF*
Ga0105095_1004371333300009053Freshwater SedimentMIPLTLALSLRGRGDFSWFLPLEGGGLGEGEISILF*
Ga0105095_1005493333300009053Freshwater SedimentMIPLTLPLSLQGRGDYSCFLPLEGGGLGEGEISILF*
Ga0105095_1010508513300009053Freshwater SedimentMIPLTLALSLRGRGDYSWFLPLEGGGLGEGEISILF
Ga0105095_1010744213300009053Freshwater SedimentMIPLTLALSLRGRGDYSLFLPLEGGGLGEGEMSILF*
Ga0105095_1012536243300009053Freshwater SedimentMIPLTLALSLQGRGDYNWFLPLEGGGLGEGEISILL*
Ga0105095_1012737133300009053Freshwater SedimentMIPLTLALSLRGRGDYSWFLPLEGRLRRLVRTQADSPRRAEERGGL
Ga0105095_1018470823300009053Freshwater SedimentMIPLTLALSLRGRGDYSWFLPHEGRLKRLAEERGGLGEGEISILF*
Ga0105095_1020260113300009053Freshwater SedimentMIPLTLALSLQGRGDYSWFLPVEGRLKRLAGERGGLGEGEISILF*
Ga0105095_1028652213300009053Freshwater SedimentMIPLTLPLSLQGRGDYSWSLPLEGGGLGEGEISILF*
Ga0105095_1032036413300009053Freshwater SedimentMIPLTLALSLQGRGEYSWFLPLEGGGLGEGEISILL*
Ga0105095_1035179723300009053Freshwater SedimentMIPLTLALSLRGRGDYSWFLSIEGSLKRLVRTQAASPRRAEE*
Ga0105095_1038790223300009053Freshwater SedimentMIPLTLALSLRGRGDYGCFLPLEGRLRRLAEERGGLEEGEMSILF*
Ga0105095_1066207423300009053Freshwater SedimentMIPLTLALSLQGRGDYSWFLPLEGGGLGEGEISILL*
Ga0105095_1068578523300009053Freshwater SedimentMSPLTLALSLRGRGDYNWFLPLEGGGLGEGEMSILF*
Ga0105090_1032766413300009075Freshwater SedimentMNPLTLALSRKGRGDCSWFLPLEGGGLGEGETIPLLH*
Ga0105106_1054184513300009078Freshwater SedimentMIPLTLALSLRGRGDYSWFLPLEGGGLGEGEISILFLDC*
Ga0105107_1037514623300009087Freshwater SedimentMIPLTLALSLHGRGDYSWLLPLEGGGLGEGEISILF*
Ga0105094_1048801613300009153Freshwater SedimentMIPLTLALSLRERGDYSWFLPLEGGGLGEGEMSILF*
Ga0105094_1054251223300009153Freshwater SedimentMIPLTLALSLRGRGDYSWLLPLEGGGLGEGEMSIYFETVNN
Ga0105100_1049704813300009166Freshwater SedimentMIPLTLALSLRGEGIIAGSSPLGGGRMGEGEMSILF*
Ga0105100_1051338823300009166Freshwater SedimentMIPLTLALSLRGRGDYSWFLPLEGGGLGEGEISILV*
Ga0105101_1006844323300009171Freshwater SedimentMIPLTLALSLQGRGDFSWFLPLEGRLRRLVRTQADSPRRAEERGGLGEGEMSILF*
Ga0105101_1019441113300009171Freshwater SedimentMIPLTLALSLRGRGDYSWFLPLEGGGLGEGEISILF*
Ga0105101_1028611423300009171Freshwater SedimentPLTLALSLQGRGDYSWFLPLEGGGLGEGEISILL*
Ga0105101_1031467423300009171Freshwater SedimentMISLTLALSLQGRGDYSWFLPLEGGGLGEGEISILF*
Ga0105101_1037262723300009171Freshwater SedimentMIPLTLALSLQGRGDYSWFLPLEGGGLGEGEMSILF*
Ga0136847_1028655123300010391Freshwater SedimentMIPLTLPLSLQGRGDYSWFLPLEGGGLGEGEMSILF*
Ga0136847_1108109523300010391Freshwater SedimentMIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILFWDR*
Ga0136847_1264474673300010391Freshwater SedimentMIPLTLALSLRGRGDYSSFLPIEGGGLGEGEMSILF*
Ga0136847_1287518913300010391Freshwater SedimentMIPLTLALSLRGRGDYIWFFPLEGRLRRLVRTQADSPRRAEERRGLGEGEMSMLF*
Ga0137347_109234813300012152SoilMIPLTLALSLRGRRDYSWFLPLEGGGLGEGELSILF*
Ga0153915_1006849423300012931Freshwater WetlandsMIPLTLALSLQGRGNYGWFLPLEGGGAGEGEISILF*
Ga0153915_1007503733300012931Freshwater WetlandsMIPLTLALSLRGRGDYNWFLPLGGGLGEGEMSILF*
Ga0153915_1014665523300012931Freshwater WetlandsMIPLTLALSLRGRGDYSWFLTLEEGGLGEGEISILF*
Ga0153915_1033405723300012931Freshwater WetlandsMIPLTLALSLQGRGDYSWFLPLEGGGLGEGEISILF*
Ga0153915_1066308323300012931Freshwater WetlandsMIPLTLALSLRGRGDYSWFLPHEGGGLGEGEMLILF*
Ga0153915_1074469223300012931Freshwater WetlandsMIPLTLALSLRGRGDYSLFLPLEGGGLGEGEMSILL*
Ga0153915_1118470013300012931Freshwater WetlandsIPLTLALSLQGRGDYSWFLPLEGGGLGEGEISILF*
Ga0153915_1124821313300012931Freshwater WetlandsMIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILFWNRY*
Ga0153915_1147266423300012931Freshwater WetlandsMIPLTLALSLQGRWDYSWFLPLEGGGLGEGEISTLF*
Ga0153915_1199525323300012931Freshwater WetlandsPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILF*
Ga0153915_1263391813300012931Freshwater WetlandsMSPLTLALSLRGRWDYSWFLALEGRLRRLAEERRGLGEGEMSILL*
Ga0153915_1286885613300012931Freshwater WetlandsTLALSLQGRGDYSWFLPLEGRLRRLAEERGGLGEGEISILL*
Ga0153915_1317036213300012931Freshwater WetlandsMIPLTLALSLRGRGDYSWFLALEGGGLGEGENVNTSLRLLICSVIPLY
Ga0153915_1324526113300012931Freshwater WetlandsLQGRGDYSWFLPLEGRLRRLAEERGGLGEGEISILF*
Ga0153915_1348120723300012931Freshwater WetlandsMIPLTLALSLRGRGDYSWFLPLEGGGLGEVEMTILF*
Ga0153915_1355666713300012931Freshwater WetlandsMIPLTLALSLRGRGDYNWFLPLEGRGLGEGEMSILF*
Ga0153916_1021700613300012964Freshwater WetlandsMIPLTLALSLQGRGDYSWFLPLEGRLRRLAEERGGLGEGEISILF*
Ga0153916_1052007113300012964Freshwater WetlandsMIPLTLALSLRGRGDYSCFLPLEGGGLGEGEMSILF*
Ga0153916_1061536013300012964Freshwater WetlandsMIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILFWNR*
Ga0153916_1085000223300012964Freshwater WetlandsMIPLTLALSLRGRGDYSWFLTLEGGGLGEGEISILF*
Ga0153916_1182704513300012964Freshwater WetlandsMIPLTLALSLRGRGDYSWFLPLEGRLRRLVRTQADSPRRAEERGGLGEGEMSILF*
Ga0153916_1275096813300012964Freshwater WetlandsMIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILF*
Ga0075352_124308823300014324Natural And Restored WetlandsVNLSIPLTLALSLQGRGDYSWFLPLEGGGLGEGEMSILF*
Ga0184631_1009512923300018070Groundwater SedimentMIPLTLALSLQGRGDYRWFLPIEGRLRRLAKERGGLGEGEMSILF
Ga0209521_1038570213300025164SoilMIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILF
Ga0209642_1004968923300025167SoilMIPLTLALSLRGRGDYRWFLPLEGGALGEGEMSILF
Ga0209286_131334233300027713Freshwater SedimentMIPLTLALSLQGRGDYSWFLPLEGGGLGEGEISILF
Ga0209592_114363223300027731Freshwater SedimentMIPLTLALSLQGRGEYSWFLPLEGGGLGEGEISILL
Ga0209592_123531523300027731Freshwater SedimentMIPLTLALSLRGRGDFSWFLPLEGGGLGEGEISILF
Ga0214474_108044413300027740SoilMIPLTLALSLQGRGDYSWLLPFEGRLRRLAEERGGLGEGEMSILFWNR
Ga0256868_1014313413300027811SoilGRGDYSWFLPLEGRLRRLVRTQADSPRRAEERGGLREGEMSILF
Ga0299915_1001834433300030613SoilMIPLTLALSSPGERDYSWSLPLEGRLRRLVRTQADSPRRAEERGGLGEGKMSILF
Ga0299915_1006395533300030613SoilMIPLTLALSLQGRGDYSWLLPFEGRLRRLAEERGGLGEGEMSILF
Ga0299915_1018752213300030613SoilMIPLIFALSLQGRGDYSWLLPLEGRLRRLAEERGGLGEGEMSILF
Ga0299915_1081269113300030613SoilMIPLTLALSLQGRGDYSWFLPLEGRLRRLVRTQADSPRRAEERGGLREGKMSI
Ga0299915_1081677723300030613SoilMIPLTLALSLRVRVDYSWFLPIEGRLRRLVRTQADSPRRAEERGGLGEGGMSILF
Ga0315290_1010903543300031834SedimentMIPLTLALSLQGRGDYIWSLPLEGGGLGKGEMSILF
Ga0315297_1005051243300031873SedimentMIPLTLALSLRGRGDYSWLLPLEGGGLGEGEMSILF
Ga0315297_1019788113300031873SedimentMITLTLALSLRGRGDYSWFLPIEGGGLGEGEMSILF
Ga0315297_1160914123300031873SedimentMTPLTLALSLQGRGDYSWFLPLEGGGLGEGEMSILF
Ga0315295_1014773713300032156SedimentMIPLTLALSLRGRGDYSWFLLIEGGGLGEGKMSILF
Ga0315295_1103519123300032156SedimentMIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSLLL
Ga0315281_1011568923300032163SedimentMIPLTLALSLRGRGGYSWFLPLEGGGLGEGKMSILF
Ga0315281_1017739243300032163SedimentMIPLTLALSLQGRGDYGWFLPLEGGGLGEGEMSILF
Ga0315281_1017922613300032163SedimentMIPLTLALSLRGRGDYIWFLPLDGGGLGEGEMSILF
Ga0315286_1070850223300032342SedimentMIPLPLALSLQGRGDYIWSLPLEGGGLGEGEMSILF
Ga0315275_1009898533300032401SedimentMIPLTLALSLRGRGYYNRFLPPERGGLGEGEMSILF
Ga0315273_1002301313300032516SedimentMIPLTLPLSLQGRGNYSWLLPLEGGGLGEGEMSILF
Ga0315273_1011666743300032516SedimentMIPLTLALSLQGRGDYNWFLPLEGRLRRLVRTQADSPRRAEERGGLGEGEMSILF
Ga0315273_1027804813300032516SedimentWFLPLEGSLRRLVRTQADSPRRAEERGGLGEGEMSILF
Ga0316624_1001510443300033486SoilMIPLTLALSLRGRGDYSWFLPLEGRLKRLAEERGGLGEGEISMLF
Ga0316624_1002050153300033486SoilMIPLTLALSLSLRGRGDYGWFLPLEGGGLGEGEMSILF
Ga0316624_1010404233300033486SoilMIPLTLALSLQGRGDYSWFLPLEGGGLGEGEMSILF
Ga0316624_1012391913300033486SoilMIPLTLALSLRGRGDYSWFLTLEEGGLGEGEISILF
Ga0316624_1015225623300033486SoilMIPLTLALSLQGRWDYSWFLPLEGGGLGEGEISTLF
Ga0316624_1027703623300033486SoilMIPLTLALSLRGRGDYSWFLPLEGGGLGEGEMSILFWNRY
Ga0316624_1037508713300033486SoilVSPLTLALSLQGRGDYSWFLPLEGRLRRLAEERGGLGEGEMSILF
Ga0316624_1112692813300033486SoilMIPLTLALSLQGRGDYSWFLPLEGRLRRLAEERGGLGEGEISILF
Ga0316624_1133748113300033486SoilMIPLTRALSLRGRGDYSWFLPLEGRLRRLAEERGGLGEG
Ga0316624_1173965613300033486SoilMIPLTLALSLRGRGDYRWFLPLEGGGLGEGEMSILF
Ga0299912_1015946353300033489SoilMEMNINSLIIEKTEMIPLTLALSLQGRGDYSWFLPLEGRLRRLAEERGGLREGKMSILF
Ga0299912_1023963513300033489SoilVIIHLTLALSLQGRGDYSWFLPLEGRLRRLAEERGGLGEGEMSI
Ga0299912_1024945223300033489SoilMILLTLALSLRGRVDYSWFLPIEGRLRRLVRTQADSPRRAEERGGLGEGGMSILF
Ga0299912_1129933923300033489SoilRGDYSWFLPLDGRLRRLARTQADSPRRAEERGGLGEAEMSILF
Ga0299912_1134027513300033489SoilIPLIFALSLQGRGDYSWLLPLEGRLRRLAEERGGLGEGEMSILF
Ga0316628_10026706033300033513SoilMIPLTLALSLRGRGDYSWFLPHEGGGLGEGEMLILFLDR
Ga0316628_10038299523300033513SoilMIPLTLALSLQGRGNYGWFLPLEGGGLGEGEMSILF
Ga0316628_10054377823300033513SoilMIPLTLALSLQGRGDYSWFLPLERGGLGEGEISILF
Ga0316628_10088926133300033513SoilMIPLTLALSLRGRGDYSWFLPHEGGGLGEGEMLILF
Ga0316628_10106296433300033513SoilVSPLTLALSLQGRGDYSWFLPLEGRLRRLAEERGGLGEGEMSI
Ga0316628_10135748823300033513SoilMIPLTLALSLQGRGDYNWFLPLKGGGLGEGEMSILFFETVNN
Ga0373907_090267_433_5703300034388Sediment SlurryMIPLTLALSLQGRGDYSWFLPLEGRLRRLAEERGGLGEGEMSILF
Ga0373905_041093_494_6673300034414Sediment SlurryMIPLTLALSLRGRGDYRWFLPLEGRLRRLAEERGGLGEGEMSYYFETVNKCITRNRT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.