NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087250

Metagenome / Metatranscriptome Family F087250

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087250
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 38 residues
Representative Sequence AGPQGSGAEAEFTSSSGSVRALSVNAKKGLSGEER
Number of Associated Samples 95
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 2.86 %
% of genes near scaffold ends (potentially truncated) 90.00 %
% of genes from short scaffolds (< 2000 bps) 95.45 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (97.273 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.454 % of family members)
Environment Ontology (ENVO) Unclassified
(21.818 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(60.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A97.27 %
All OrganismsrootAll Organisms2.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2209111013|DRAFT_Contig_113269Not Available501Open in IMG/M
2209111013|DRAFT_Contig_25580Not Available519Open in IMG/M
3300003505|JGIcombinedJ51221_10440572Not Available527Open in IMG/M
3300004100|Ga0058904_1031697Not Available561Open in IMG/M
3300004103|Ga0058903_1021072Not Available662Open in IMG/M
3300004103|Ga0058903_1030247Not Available649Open in IMG/M
3300004116|Ga0058885_1003451Not Available638Open in IMG/M
3300004116|Ga0058885_1005060Not Available724Open in IMG/M
3300004140|Ga0058894_1005660Not Available699Open in IMG/M
3300004966|Ga0072328_1197679Not Available671Open in IMG/M
3300005640|Ga0075035_1097744Not Available610Open in IMG/M
3300006378|Ga0075498_1390318Not Available649Open in IMG/M
3300006861|Ga0063777_1002641Not Available624Open in IMG/M
3300007304|Ga0102689_1047300Not Available574Open in IMG/M
3300007526|Ga0075022_1090426Not Available628Open in IMG/M
3300009225|Ga0103851_1110634All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium506Open in IMG/M
3300009243|Ga0103860_10115968Not Available590Open in IMG/M
3300009252|Ga0103863_10024028Not Available754Open in IMG/M
3300009252|Ga0103863_10034100Not Available668Open in IMG/M
3300009506|Ga0118657_12626311Not Available565Open in IMG/M
3300009579|Ga0115599_1137519Not Available522Open in IMG/M
3300009580|Ga0115596_1184554Not Available634Open in IMG/M
3300009581|Ga0115600_1112930Not Available669Open in IMG/M
3300009584|Ga0115597_1015672Not Available691Open in IMG/M
3300010063|Ga0127431_101017Not Available645Open in IMG/M
3300010071|Ga0127477_161411Not Available660Open in IMG/M
3300010080|Ga0127448_110608Not Available562Open in IMG/M
3300010081|Ga0127457_1023130Not Available703Open in IMG/M
3300010091|Ga0127485_1055512Not Available694Open in IMG/M
3300010098|Ga0127463_1045872Not Available532Open in IMG/M
3300010114|Ga0127460_1057012Not Available695Open in IMG/M
3300010114|Ga0127460_1098729Not Available640Open in IMG/M
3300010134|Ga0127484_1175875Not Available706Open in IMG/M
3300010136|Ga0127447_1174117Not Available656Open in IMG/M
3300010138|Ga0115595_1120195Not Available701Open in IMG/M
3300010140|Ga0127456_1001619Not Available651Open in IMG/M
3300010154|Ga0127503_10225468Not Available671Open in IMG/M
3300010858|Ga0126345_1079080Not Available700Open in IMG/M
3300010858|Ga0126345_1293991Not Available592Open in IMG/M
3300010861|Ga0126349_1018634Not Available573Open in IMG/M
3300010865|Ga0126346_1129634Not Available503Open in IMG/M
3300010867|Ga0126347_1355654Not Available713Open in IMG/M
3300010869|Ga0126359_1006949Not Available637Open in IMG/M
3300011066|Ga0138524_1114080Not Available625Open in IMG/M
3300011070|Ga0138567_1011891Not Available690Open in IMG/M
3300011073|Ga0138584_1002991Not Available647Open in IMG/M
3300011120|Ga0150983_10948190Not Available546Open in IMG/M
3300011340|Ga0151652_13559272Not Available557Open in IMG/M
3300011340|Ga0151652_13956679Not Available504Open in IMG/M
3300012393|Ga0134052_1216498Not Available585Open in IMG/M
3300012393|Ga0134052_1235039Not Available634Open in IMG/M
3300012395|Ga0134044_1223128Not Available617Open in IMG/M
3300012399|Ga0134061_1196503Not Available681Open in IMG/M
3300012409|Ga0134045_1254930Not Available704Open in IMG/M
3300012410|Ga0134060_1252377Not Available522Open in IMG/M
3300012469|Ga0150984_109793419Not Available728Open in IMG/M
3300013046|Ga0079038_117100Not Available578Open in IMG/M
3300019179|Ga0184593_122746Not Available647Open in IMG/M
3300019183|Ga0184601_136578Not Available541Open in IMG/M
3300019187|Ga0184584_116358Not Available635Open in IMG/M
3300019192|Ga0184603_143872Not Available638Open in IMG/M
3300019201|Ga0180032_1082534Not Available643Open in IMG/M
3300019234|Ga0172288_1092699Not Available714Open in IMG/M
3300019234|Ga0172288_1312265Not Available702Open in IMG/M
3300019241|Ga0187793_1279157Not Available577Open in IMG/M
3300019241|Ga0187793_1325852Not Available710Open in IMG/M
3300019244|Ga0180111_1382810Not Available528Open in IMG/M
3300019245|Ga0187791_1254658All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium595Open in IMG/M
3300019246|Ga0172287_1117152Not Available698Open in IMG/M
3300019250|Ga0187790_1489863Not Available725Open in IMG/M
3300019252|Ga0172286_1133108Not Available740Open in IMG/M
3300019265|Ga0187792_1012873Not Available637Open in IMG/M
3300020064|Ga0180107_1314297Not Available574Open in IMG/M
3300021151|Ga0179584_1291543Not Available597Open in IMG/M
3300021273|Ga0210340_1014726Not Available648Open in IMG/M
3300021333|Ga0210324_1167060Not Available593Open in IMG/M
3300021860|Ga0213851_1811525Not Available653Open in IMG/M
3300021861|Ga0213853_10482077Not Available643Open in IMG/M
3300021861|Ga0213853_11312236Not Available667Open in IMG/M
3300021967|Ga0213848_1139575Not Available516Open in IMG/M
3300022506|Ga0242648_1041430Not Available675Open in IMG/M
3300022506|Ga0242648_1049039Not Available639Open in IMG/M
3300022509|Ga0242649_1056274Not Available564Open in IMG/M
3300022522|Ga0242659_1063212Not Available677Open in IMG/M
3300022528|Ga0242669_1098975Not Available563Open in IMG/M
3300022531|Ga0242660_1129447Not Available644Open in IMG/M
3300022531|Ga0242660_1254774Not Available502Open in IMG/M
3300022708|Ga0242670_1018538Not Available812Open in IMG/M
3300022708|Ga0242670_1065069Not Available546Open in IMG/M
3300022711|Ga0242674_1067313Not Available519Open in IMG/M
3300022712|Ga0242653_1044567Not Available705Open in IMG/M
3300022717|Ga0242661_1094127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Micropepsales → Micropepsaceae → Rhizomicrobium619Open in IMG/M
3300024849|Ga0255230_1075745Not Available610Open in IMG/M
3300029701|Ga0222748_1129570Not Available516Open in IMG/M
3300030549|Ga0210257_10225092Not Available520Open in IMG/M
3300030790|Ga0138304_1333402Not Available527Open in IMG/M
3300030811|Ga0265735_103132Not Available701Open in IMG/M
3300030832|Ga0265752_110109Not Available508Open in IMG/M
3300030877|Ga0265777_126005Not Available503Open in IMG/M
3300030997|Ga0073997_10060882Not Available718Open in IMG/M
3300031024|Ga0265724_101667Not Available705Open in IMG/M
3300031081|Ga0308185_1023764Not Available717Open in IMG/M
3300031446|Ga0170820_10413808Not Available633Open in IMG/M
3300032072|Ga0326631_109727Not Available626Open in IMG/M
3300034653|Ga0316599_109154Not Available724Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil15.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.09%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland8.18%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil7.27%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil7.27%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland5.45%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds4.55%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.55%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water3.64%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.64%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.82%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland1.82%
Subtropical SoilEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Subtropical Soil1.82%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.91%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.91%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.91%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.91%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.91%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.91%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.91%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.91%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2209111013Subtropical soil microbial communities from Bundaberg Australia-rainforestEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004100Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF244 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004103Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004116Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF206 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004140Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF224 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004966Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 66 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005640Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006861Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007304Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007526Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaT_CSR_2012 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009225Microbial communities of water from Amazon river, Brazil - RCM4EnvironmentalOpen in IMG/M
3300009243Microbial communities of water from Amazon river, Brazil - RCM13EnvironmentalOpen in IMG/M
3300009252Microbial communities of water from Amazon river, Brazil - RCM16EnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009579Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009580Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009581Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009584Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010063Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010071Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010080Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010081Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010091Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010098Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010114Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010134Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010136Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010138Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010140Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010856Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010858Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010862Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010865Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011066Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011070Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011073Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011340Combined Assembly of Wetland MetatranscriptomesEnvironmentalOpen in IMG/M
3300012393Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012395Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012399Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012409Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300013046Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019179Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019183Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019187Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019192Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019201Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019234Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019241Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019244Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019245Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019246Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019250Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019252Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019265Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020064Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021151Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021273Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.386 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021297Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.669 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021333Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021967Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - AB:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022506Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022509Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022711Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024849Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030549Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030790Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030811Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030832Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030877Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030997Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031024Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031081Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300032072Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300034653Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_03R_16 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DRAFT_000529102209111013Subtropical SoilRLVGLAPLKAGSQGSGAEAEFTSSSGEVRASLVNAKKGLSNEER
DRAFT_004456002209111013Subtropical SoilAGSKGSGEEAEFTSSSGDVRASSVNPKKGLSDKGR
JGIcombinedJ51221_1044057223300003505Forest SoilLSQAGWLNPSETKPQGKVMEAVFTSSSGSVRALSVNAKKELSDEER*
Ga0058904_103169713300004100Forest SoilNPSETKPQGKVTEAEFTSSSGSVRALSVNAKKELSDKER*
Ga0058903_102107213300004103Forest SoilLSPSKTKPKGKVAEAEFTSSSGSVRALSVNAKKGLSDEER*
Ga0058903_103024723300004103Forest SoilLSQAGWFNPSETKPQGKVTEAEFTSSSGSVRALSVNAKKELSDKER*
Ga0058885_100345113300004116Forest SoilSPSKTKPKGKVAEAEFTSSSGSVRALSVNAKKGLSDEER*
Ga0058885_100506033300004116Forest SoilLSPSKTKPQGKVAEAEFTSSSGSVRALSVNANKGLSGEER*
Ga0058894_100566013300004140Forest SoilNPSQAGSKGPGAEAEFTSSSGGVRAPSVYAKRELSDEER*
Ga0072328_119767923300004966Peatlands SoilGWLGPSKAGSQGSGAEAEFTSSSGDVRASSVIANQELFGEGR*
Ga0075035_109774413300005640Permafrost SoilEPKGKVAEAEFTSSSGSVRALSVNAKKGLSGEER*
Ga0075498_139031813300006378AqueousGAQVPGAEAEFTSSSGNVRALPVNAKKELGGQER*
Ga0063777_100264113300006861Peatlands SoilKPQGKVAEAEFTSSSGGVRALSVNAKKGLSGEER*
Ga0102689_104730013300007304Freshwater LakeFNSSQAGPQGSGAEAGFTSSSGGVRAPSVNAKKELGIEER*
Ga0075022_109042623300007526WatershedsMKPKGIMAEAEFTSSSGGVRALSVNAKKELSDEER*
Ga0103851_111063423300009225River WaterSQAASQGAVAEAEFTSSSGDVRASSVNAKKGLSEEE*
Ga0103860_1011596813300009243River WaterQPLLAGPQGSGAEAEFTSSSGGVRAPSVIANKELGSEER*
Ga0103863_1002402813300009252River WaterSSQAEPQGAVAEAEFTSSSGSVRALPVNAKKELGGKT*
Ga0103863_1003410023300009252River WaterGPSQAEAKDSGAEAEFTSSSGGVRAPSVIANKGLGGEER*
Ga0118657_1262631123300009506Mangrove SedimentAGSQGSGAEAEFTSSSGGVRAPPVNAKKELGGQER*
Ga0115599_113751913300009579WetlandAGPQGSGAEAGFTSSSGGVRAPSVNANKELGGEER*
Ga0115596_118455413300009580WetlandAGSQGSVAEAEFTSSSGDVRASSVNAKKGLSDEER*
Ga0115600_111293013300009581WetlandAEAKDSGAEAEFTSSSGSVRALSVNANKELGGEER*
Ga0115597_101567213300009584WetlandSQAEAKDSGAEAEFTSSSGSVRALSVNANKELGGEER*
Ga0127431_10101713300010063Grasslands SoilGSQGPGAEAEFTSSSGGVRAPPVNAKKELGDEVR*
Ga0127477_16141113300010071Grasslands SoilAGAKVPGAEAGFTSSSGDVRASSVNANKELSDEER*
Ga0127448_11060813300010080Grasslands SoilKAGSQGSGTEAEFTSSSGEVRASLVNAKKGLSDEER*
Ga0127457_102313013300010081Grasslands SoilWLGPSKGGPQGWLAEAGFTSSSGGVRALSVNAKKELGGEER*
Ga0127485_105551223300010091Grasslands SoilLEAVSQGAAAEAEFTSSSGGVRAPSVNAKKELSGQER*
Ga0127463_104587213300010098Grasslands SoilAGSRGSGAEAEFTSSSGGVRAPSVNANQELSGEER*
Ga0127460_105701213300010114Grasslands SoilGWLIPSEIKPQGGVTEAEFTSSSGGVRAPSVHAKKGLSGKGR*
Ga0127460_109872913300010114Grasslands SoilNPSQAVPQGAGAEAEFTSSSGGVRASSVHAKKGLSDKER*
Ga0127484_117587513300010134Grasslands SoilPLEAASQGAAAEAEFTSSSGGVRAPSVNAKKELSGQER*
Ga0127447_117411713300010136Grasslands SoilSKGGSQGSWAEAGFTSSSGSVRALSVHAKKELGGEER*
Ga0115595_112019513300010138WetlandQAGPQGAVAEAEFTSSSGGVRAPSVNAKKELGGEGR*
Ga0127456_100161913300010140Grasslands SoilESGPQGLTEEAGFTSSSGGVRAPSVNAKKELGDKER*
Ga0127503_1022546823300010154SoilAGWRNPSEIKPQGKVTEAEFTSSSGGVRAPSVHAKKGLSGDV*
Ga0126358_118170613300010856Boreal Forest SoilPSKAKPQGGVAEAEFTSSSGGVRAPSGNAKKGLSG*
Ga0126345_107908013300010858Boreal Forest SoilAKPQGIVAEAEFTSSSGSVRALSVNAKKGLSGEG*
Ga0126345_129399113300010858Boreal Forest SoilTKPQGKVTEAEFTSSSGSVRALSVNAKKELSDEER*
Ga0126349_101863423300010861Boreal Forest SoilSQAGSQGSGAEAEFTSSSGSVRALSVNAKKGLSGEER*
Ga0126348_133448313300010862Boreal Forest SoilLQKPLQGGESEAEFTSSSGGVRAPSAYAKKGLSNEER*
Ga0126346_112963413300010865Boreal Forest SoilGWLSPSKTKPKGKVAEAEFTSSSGSVRALSVNAKKGLSG*
Ga0126347_135565413300010867Boreal Forest SoilGSQGSGAEAEFTSSSGSVRALSVNANKGLSGEER*
Ga0126359_100694913300010869Boreal Forest SoilEPKGEVAEAKFTSSSGSVRALSVNAKKGLSDEKR*
Ga0138524_111408013300011066Peatlands SoilGSQGSGAEAEFTSSSGGVRALSVHAKKGLSGEER*
Ga0138567_101189113300011070Peatlands SoilLNSSKAGSQGSGAEAEFTSSSGGVRALSVHAKKGLSGEER*
Ga0138584_100299113300011073Peatlands SoilGSQGSGAEAEFTSSSGDVRASSVIANQELFGEGR*
Ga0150983_1094819013300011120Forest SoilSKEKPQGGLAEAEFTSSSGSVRALSVNAKKGLSDEGR*
Ga0151652_1355927213300011340WetlandTRSQGQAAEAEFTSSSGGVRAPSVNAKKEQRGEER*
Ga0151652_1395667913300011340WetlandTGSQGAVAEAEFTSSSGSVRALSVNANQEPGSEER*
Ga0134052_121649813300012393Grasslands SoilAGSQGSGAEAEFTSSSGSVRALSVHAKKGLSGEER*
Ga0134052_123503913300012393Grasslands SoilGAKVPGAEAGFTSSSGDVRASSVNANKELSDEERGETVPS*
Ga0134044_122312813300012395Grasslands SoilSSQAGSQGSGAEAEFTSSSGSVRALSVNAKKGLSGEER*
Ga0134061_119650313300012399Grasslands SoilASQGAAAEAEFTSSSGGVRAPSVNAKKELSGQER*
Ga0134045_125493013300012409Grasslands SoilGSQGSGAEAEFTSSSGGVRAPSVNANQELSGEER*
Ga0134060_125237713300012410Grasslands SoilAGPQGSGAEAEFTSSSGSVRALSVNAKKGLSGEER*
Ga0150984_10979341913300012469Avena Fatua RhizosphereLGSSKAGSQGSGAEAEFTSSSGGVRAPSVNANQELSGEER*
Ga0079038_11710013300013046Freshwater WetlandsAGPQGAVAEAEFTSSSGGVRALSVNAKKELGGEER*
Ga0184593_12274613300019179SoilKMKPKGKVAEAEFTSSSGSVRALSVNAKKGLSGEER
Ga0184601_13657813300019183SoilMQPKGDAAEAEFTSSSGSVRALSVNAKKGLSGEER
Ga0184584_11635813300019187SoilTKPKGKVAEAEFTSSSGSVRALSVNAKKGLSDKER
Ga0184603_14387213300019192SoilKTKPKGKVAEAEFTSSSGSVRALSVNAKKGLSDKER
Ga0180032_108253413300019201EstuarineKTGPQGTEAEAGFTSSSGGVRAPSVNAKKELGSEER
Ga0172288_109269913300019234WetlandLGPSQAEAKDSGAEAEFTSSSGSVRALSVNANKELGGEER
Ga0172288_131226513300019234WetlandAGPQGSGAEAGFTSSSGGVRAPSVNANKELGGEER
Ga0187793_127915713300019241PeatlandNPSQAGPQGPGAEAEFTSSSDGVRAPSVNAKKGLSDEE
Ga0187793_132585213300019241PeatlandRLVGSNPSQAGPQGSGAEAEFTGSSGGVRALSVNAKKGLSDEE
Ga0180111_138281013300019244Groundwater SedimentSSQAGAQVSGAEAEFTSSSGDVRASSVYAKKELGDEVR
Ga0187791_125465813300019245PeatlandAASQGAVAEAEFTSSSGDVRASSVNAKKGLSEEER
Ga0172287_111715213300019246WetlandPSQAEAKDSGAEAEFTSSSGSVRALSVNANKELGGEER
Ga0187790_148986313300019250PeatlandAGSQGPGAEAEFTSSSGSVRALSVNAKKELGSEER
Ga0172286_113310813300019252WetlandWFNSSQAGPQGAVAEAGFTSSSGSVRALSVNAKKELGGEGR
Ga0187792_101287313300019265PeatlandKLRPQGPVAEAGFTSSSGGVRAPSVNAKKELGGEER
Ga0187792_118028113300019265PeatlandNPLKGRVAEAEFTSSSGDVRASSAHANQELCGKGR
Ga0180107_131429713300020064Groundwater SedimentSQAGAQVSGAEAEFTSSSGDVRASSVYAKKELGDEVR
Ga0179584_129154313300021151Vadose Zone SoilTKPQGKVTEAEFTSSSGSVRALSVNAKKELSDEER
Ga0210340_101472613300021273EstuarineGAPQGETEEAGFTSSSGDVRASSVNAKKELSGKGR
Ga0210369_107225923300021297EstuarineSKTGLQGAAAEAGFTSSSGGVRAPSVNAKKELGDEER
Ga0210324_116706013300021333EstuarineEVLPQGGMDEAEFTSSSGGVRAPSVNAKKELGGEER
Ga0213851_181152513300021860WatershedsSKGGSQGSRAEAEFTSSSGDVRASPVNAKKGLSGEER
Ga0213853_1048207713300021861WatershedsTKPKGKVAEAEFTSSSGSVRALSVNAKKGLSGEGR
Ga0213853_1131223613300021861WatershedsTRRKARVAEAEFTSSSGGVRAPSVNAKKGLSGQER
Ga0213848_113957523300021967WatershedsMKPQGIMAEAEFTSSSGGVRALSVNAKKELSDEER
Ga0242648_104143023300022506SoilGWLNPSQAGSKGPGAEAEFTSSSGGVRAPSVYAKRELSDEER
Ga0242648_104903913300022506SoilSPSKTKPQGKVAEAEFTSSSGSVRALSVNAKKGLSGEER
Ga0242649_105627413300022509SoilNPSETKPQGKVTEAEFTSSSGSVRALSVNAKKELSDKER
Ga0242659_106321223300022522SoilAGWLNPSQAGSKGPGAEAEFTSSSGGVRAPSVYAKRELSDEER
Ga0242669_109897513300022528SoilNPSETKPQGKVTEAEFTSSSGSVRALSVNAKKELSDEER
Ga0242660_112944713300022531SoilNSSQTKPKGKVAEAEFTSSSGGVRALSVNAKKELSDEGR
Ga0242660_125477413300022531SoilNPSKMKPQGIMAEAGFTSSSGGVRAPSVNAKKGLSGEE
Ga0242670_101853813300022708SoilMKPQGKVTEAEFTSSSGGVRAPSVNAKKELSGEEL
Ga0242670_106506913300022708SoilSPSKTKPKGKVAEAEFTSSSGSVRALSVNAKKGLSDEER
Ga0242674_106731313300022711SoilSETKPQGKVTEAEFTSSSGSVRALSVNAKKELSDKER
Ga0242653_104456713300022712SoilLGQAGWPIPSETKPQGKVTEAEFTSSSGSVRALSVNAKKELSDEER
Ga0242661_109412723300022717SoilGWLNPSETKPQGKVTEAEFTSSSGSVRALSVNAKKELSDEER
Ga0255230_107574513300024849FreshwaterAPLRRALQGACGEAEFTSSSGGRRGPSHAIEELGGEER
Ga0222748_112957013300029701SoilLSSSKRQPKGRMAEAEFTSSSGSVRALSVNAKKELSDEGR
Ga0210257_1022509213300030549SoilAPLKQPKGDAAEAEFTSSSGSVRALSVNAKKGLSGEER
Ga0265461_1197108223300030743SoilAGWLNSSQAGSQGSGAEAEFTSSSGDVRASSVHAKKELRG
Ga0138304_133340213300030790SoilGLSQAGWPNPSVAKPQGRVSEAGFTSSSGSVRALSVNAKKELSDEE
Ga0265735_10313213300030811SoilKGKPKGGTAEAGFTSSSGSVRALSVNAKKGLSDEGR
Ga0265752_11010913300030832SoilKTKPKGKVAEAEFTSSSGSVRALSVNAKKGLSDEER
Ga0265777_12600513300030877SoilAGWLSPTKTKPKGKVAEAEFTSSSGSVRALSVNAKKGLSDKER
Ga0073997_1006088233300030997SoilSSWSGSKGSQAEAEFTSSSGGVRAPSVYAKKGLRDEER
Ga0265724_10166713300031024SoilPSVTKPQGQVSEAEFTSSSGSVRALSVNAKKELSDEGR
Ga0308185_102376413300031081SoilGSSKAGSQGSGAEAEFTSSSGGVRAPSVNANQELSGEER
Ga0170820_1041380813300031446Forest SoilMKPKGKMAEAEFTSSSGGVRAPSVNAKKGLSGKGR
Ga0326631_10972713300032072SoilGWQGSSKIKPQGGMTEAEFTSSSGSVRALSVNAKKGLSDKER
Ga0316599_109154_3_1103300034653Untreated Peat SoilAGAQVPGAEAEFTSSSGDVRASSVYAKKELGDEER


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.