Metagenome / Metatranscriptome Family F084031

Basic Information
Family ID	F084031
Family Type	Metagenome / Metatranscriptome
Number of Sequences	112
Average Sequence Length	41 residues
Representative Sequence	VIRFVLARLLQSLVALAILSVVVFILARATGDPLHLILPMS
Number of Associated Samples	106
Number of Associated Scaffolds	112

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	55.36 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	93.75 %
Associated GOLD sequencing projects	102
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.54

Most Common Taxonomy
Group	Bacteria (99.107 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.857 % of family members)
Environment Ontology (ENVO)	Unclassified (29.464 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (41.071 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 112 Family Scaffolds
PF00496	SBP_bac_5	57.14
PF03928	HbpS-like	0.89
PF00135	COesterase	0.89

COG ID	Name	Functional Category	% Frequency in 112 Family Scaffolds
COG2272	Carboxylesterase type B	Lipid transport and metabolism [I]	0.89

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	99.11 %
Unclassified	root	N/A	0.89 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	99.11 %
Unclassified	root	N/A	0.89 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	99.11 %
Unclassified	root	N/A	0.89 %

Name	Rank	Taxonomy	Distribution
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	78.57 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	8.04 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.89 %
Unclassified	root	N/A	0.89 %

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	78.57 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.79 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.89 %
Unclassified	root	N/A	0.89 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	78.57 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.79 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	0.89 %
Unclassified	root	N/A	0.89 %

Name	Rank	Taxonomy	Distribution
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.79 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.89 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.89 %
Unclassified	root	N/A	0.89 %

Name	Rank	Taxonomy	Distribution
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.79 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.89 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.89 %
Unclassified	root	N/A	0.89 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2228664021\|ICCgaii200_c1000190	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	572	Open in IMG/M
3300000564\|RepKanNP_BrdU_F12BDRAFT_1000814	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1953	Open in IMG/M
3300001139\|JGI10220J13317_10196267	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300002558\|JGI25385J37094_10045475	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1492	Open in IMG/M
3300004479\|Ga0062595_100970340	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	726	Open in IMG/M
3300005167\|Ga0066672_10399601	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	899	Open in IMG/M
3300005174\|Ga0066680_10554700	All Organisms → cellular organisms → Bacteria	722	Open in IMG/M
3300005174\|Ga0066680_10587025	All Organisms → cellular organisms → Bacteria → Proteobacteria	699	Open in IMG/M
3300005184\|Ga0066671_10031008	All Organisms → cellular organisms → Bacteria	2510	Open in IMG/M
3300005444\|Ga0070694_100679752	All Organisms → cellular organisms → Bacteria	836	Open in IMG/M
3300005445\|Ga0070708_102042144	All Organisms → cellular organisms → Bacteria → Proteobacteria	530	Open in IMG/M
3300005468\|Ga0070707_100721457	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	960	Open in IMG/M
3300005536\|Ga0070697_100414957	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1169	Open in IMG/M
3300005540\|Ga0066697_10212853	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1148	Open in IMG/M
3300005544\|Ga0070686_100036888	All Organisms → cellular organisms → Bacteria	3029	Open in IMG/M
3300005545\|Ga0070695_101187494	All Organisms → cellular organisms → Bacteria → Proteobacteria	627	Open in IMG/M
3300005546\|Ga0070696_101936404	All Organisms → cellular organisms → Bacteria → Proteobacteria	511	Open in IMG/M
3300005555\|Ga0066692_10961993	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	523	Open in IMG/M
3300005558\|Ga0066698_10403574	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	939	Open in IMG/M
3300005558\|Ga0066698_11018387	All Organisms → cellular organisms → Bacteria → Proteobacteria	526	Open in IMG/M
3300005563\|Ga0068855_101092597	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	834	Open in IMG/M
3300005568\|Ga0066703_10077191	All Organisms → cellular organisms → Bacteria	1921	Open in IMG/M
3300005617\|Ga0068859_100387822	All Organisms → cellular organisms → Bacteria → Proteobacteria	1493	Open in IMG/M
3300005840\|Ga0068870_10195117	All Organisms → cellular organisms → Bacteria	1224	Open in IMG/M
3300006049\|Ga0075417_10376776	All Organisms → cellular organisms → Bacteria → Proteobacteria	699	Open in IMG/M
3300006791\|Ga0066653_10364667	All Organisms → cellular organisms → Bacteria	735	Open in IMG/M
3300006796\|Ga0066665_11561791	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	518	Open in IMG/M
3300006804\|Ga0079221_10136561	All Organisms → cellular organisms → Bacteria	1262	Open in IMG/M
3300007255\|Ga0099791_10538055	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	569	Open in IMG/M
3300009012\|Ga0066710_104161022	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	541	Open in IMG/M
3300009038\|Ga0099829_10376997	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1171	Open in IMG/M
3300009090\|Ga0099827_11983218	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	506	Open in IMG/M
3300009100\|Ga0075418_10639365	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1146	Open in IMG/M
3300009137\|Ga0066709_100767406	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1394	Open in IMG/M
3300009148\|Ga0105243_12270686	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	580	Open in IMG/M
3300009156\|Ga0111538_10163227	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	2830	Open in IMG/M
3300009156\|Ga0111538_12406225	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	661	Open in IMG/M
3300009162\|Ga0075423_10712327	Not Available	1060	Open in IMG/M
3300009797\|Ga0105080_1033651	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	590	Open in IMG/M
3300009815\|Ga0105070_1116456	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	535	Open in IMG/M
3300009818\|Ga0105072_1092880	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	600	Open in IMG/M
3300010046\|Ga0126384_10037848	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	3251	Open in IMG/M
3300010047\|Ga0126382_10638580	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	883	Open in IMG/M
3300010320\|Ga0134109_10453088	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	522	Open in IMG/M
3300010323\|Ga0134086_10160312	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	825	Open in IMG/M
3300010333\|Ga0134080_10221906	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	825	Open in IMG/M
3300010333\|Ga0134080_10396633	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	637	Open in IMG/M
3300010366\|Ga0126379_10855567	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1010	Open in IMG/M
3300010399\|Ga0134127_12508873	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	595	Open in IMG/M
3300010400\|Ga0134122_11906508	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	629	Open in IMG/M
3300011269\|Ga0137392_10561125	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	948	Open in IMG/M
3300011269\|Ga0137392_11048255	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	669	Open in IMG/M
3300011271\|Ga0137393_11627427	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	535	Open in IMG/M
3300011429\|Ga0137455_1187447	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	618	Open in IMG/M
3300012189\|Ga0137388_11893266	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	527	Open in IMG/M
3300012199\|Ga0137383_10392959	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1016	Open in IMG/M
3300012210\|Ga0137378_11070405	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	721	Open in IMG/M
3300012357\|Ga0137384_10308013	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1316	Open in IMG/M
3300012358\|Ga0137368_10843502	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300012362\|Ga0137361_11411488	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	619	Open in IMG/M
3300012363\|Ga0137390_11148916	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	725	Open in IMG/M
3300012923\|Ga0137359_10928610	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	749	Open in IMG/M
3300012927\|Ga0137416_12153221	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	512	Open in IMG/M
3300012930\|Ga0137407_10260913	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1573	Open in IMG/M
3300012930\|Ga0137407_12389182	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	505	Open in IMG/M
3300012971\|Ga0126369_12268888	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	630	Open in IMG/M
3300012975\|Ga0134110_10142945	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	985	Open in IMG/M
3300013306\|Ga0163162_11895743	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	682	Open in IMG/M
3300015054\|Ga0137420_1486460	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1979	Open in IMG/M
3300015241\|Ga0137418_10101637	All Organisms → cellular organisms → Bacteria	2586	Open in IMG/M
3300015358\|Ga0134089_10361403	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	613	Open in IMG/M
3300015371\|Ga0132258_10432828	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	3276	Open in IMG/M
3300015373\|Ga0132257_101741323	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	799	Open in IMG/M
3300016387\|Ga0182040_11294224	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	615	Open in IMG/M
3300017656\|Ga0134112_10276544	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	671	Open in IMG/M
3300018078\|Ga0184612_10133720	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1297	Open in IMG/M
3300019259\|Ga0184646_1360843	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1531	Open in IMG/M
3300019789\|Ga0137408_1209631	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1209	Open in IMG/M
3300020074\|Ga0194113_10491625	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	883	Open in IMG/M
3300021081\|Ga0210379_10533468	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	522	Open in IMG/M
3300023066\|Ga0247793_1035107	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	767	Open in IMG/M
3300025160\|Ga0209109_10367015	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	676	Open in IMG/M
3300025885\|Ga0207653_10120691	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	943	Open in IMG/M
3300025907\|Ga0207645_10774645	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	652	Open in IMG/M
3300025910\|Ga0207684_11472882	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	555	Open in IMG/M
3300025918\|Ga0207662_10199016	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1296	Open in IMG/M
3300025942\|Ga0207689_11529857	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	557	Open in IMG/M
3300025949\|Ga0207667_10849830	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	907	Open in IMG/M
3300026285\|Ga0209438_1097308	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	901	Open in IMG/M
3300026297\|Ga0209237_1053716	All Organisms → cellular organisms → Bacteria	2005	Open in IMG/M
3300026313\|Ga0209761_1223475	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	783	Open in IMG/M
3300026315\|Ga0209686_1203041	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	539	Open in IMG/M
3300026320\|Ga0209131_1112009	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1424	Open in IMG/M
3300026536\|Ga0209058_1131315	All Organisms → cellular organisms → Bacteria	1218	Open in IMG/M
3300026548\|Ga0209161_10539875	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	519	Open in IMG/M
3300026697\|Ga0207569_102222	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	529	Open in IMG/M
3300027169\|Ga0209897_1037947	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	696	Open in IMG/M
3300027546\|Ga0208984_1079940	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	706	Open in IMG/M
3300027821\|Ga0209811_10084393	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1125	Open in IMG/M
3300027874\|Ga0209465_10081154	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1579	Open in IMG/M
3300027909\|Ga0209382_11997594	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	556	Open in IMG/M
3300031114\|Ga0308187_10415616	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	535	Open in IMG/M
3300031720\|Ga0307469_10969639	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	792	Open in IMG/M
3300031944\|Ga0310884_10293993	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	903	Open in IMG/M
3300032002\|Ga0307416_101424119	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	799	Open in IMG/M
3300032003\|Ga0310897_10095660	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1171	Open in IMG/M
3300032060\|Ga0318505_10345136	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	703	Open in IMG/M
3300032174\|Ga0307470_10188807	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1304	Open in IMG/M
3300032179\|Ga0310889_10613798	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	562	Open in IMG/M
3300032180\|Ga0307471_103427009	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	561	Open in IMG/M
3300033551\|Ga0247830_10223647	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1415	Open in IMG/M
3300034115\|Ga0364945_0166043	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	666	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	84.82%
Host-Associated	Host-Associated	15.18%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	80.36%
Plants	Host-Associated → Plants	15.18%
Aquatic	Environmental → Aquatic	4.46%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	79.46%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.04%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.14%
Freshwater	Environmental → Aquatic → Freshwater	2.68%
Sediment	Environmental → Aquatic → Sediment	1.79%
Floodplain	Environmental → Terrestrial → Floodplain	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	63.39%
Loam	Environmental → Terrestrial → Soil → Loam	12.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.14%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.36%
Sand	Environmental → Terrestrial → Soil → Sand	3.57%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.79%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.79%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.79%
Lake	Environmental → Aquatic → Freshwater → Lake	0.89%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.89%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	32.14%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	19.64%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.93%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.14%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.36%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.46%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.57%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.57%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	3.57%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.79%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.79%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.79%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.79%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.79%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.89%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	17.86%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	13.39%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	7.14%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	6.25%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	6.25%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.36%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.57%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	3.57%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.68%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.79%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.79%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.79%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.79%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.79%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.79%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.89%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.89%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.89%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.89%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.89%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.89%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.89%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.89%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000564	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B	Environmental	Open in IMG/M
3300001139	Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil	Environmental	Open in IMG/M
3300002558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005174	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009797	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20	Environmental	Open in IMG/M
3300009815	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10	Environmental	Open in IMG/M
3300009818	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015	Environmental	Open in IMG/M
3300010323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300011429	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012975	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300015054	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015358	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300019259	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300020074	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300023066	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6	Environmental	Open in IMG/M
3300025160	Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026285	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)	Environmental	Open in IMG/M
3300026297	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026313	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026315	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)	Environmental	Open in IMG/M
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental	Open in IMG/M
3300026536	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)	Environmental	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300026697	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-12 (SPAdes)	Environmental	Open in IMG/M
3300027169	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes)	Environmental	Open in IMG/M
3300027546	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)	Environmental	Open in IMG/M
3300027821	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300031114	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032060	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032179	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M
3300034115	Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.54
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.54
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F084031

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICCgaii200_10001901	2228664021	Soil	VIRFVLSRLAQSLVALAILSVVVFILARATGDPLQLILPMSATAEDYAE
RepKanNP_BrdU_F12BDRAFT_10008141	3300000564	Soil	VARFVLARLVQSLVALAILSVVVFVLARATGDPLHLILPMSASEE
JGI10220J13317_101962672	3300001139	Soil	LIRFVVSRVLQSLVALAILSVVVFILARATGDPLQLI
JGI25385J37094_100454752	3300002558	Grasslands Soil	VARFVFTRLVQSLAALAILSVVVFILARATGDPLHLILPMSA
Ga0062595_1009703401	3300004479	Soil	MLRFVAARLLQSLVALAIISVVVFVLARATGDPLYLILPMSASQEDF
Ga0066672_103996011	3300005167	Soil	VARFVLTRLLQSLAALAILSVVVFVLARAAGDPLHLILPMSASEEDFAN
Ga0066680_105547001	3300005174	Soil	MLRFVLARLSQSAITLLLFSVVIFGLARATGDPLTLVLPMVATEE
Ga0066680_105870252	3300005174	Soil	VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMSASEEDYANAR
Ga0066671_100310081	3300005184	Soil	MLRFVFFRLLQSLIALAILSVVVFVLARATGDPLHMILPMNASEEDYA
Ga0070694_1006797521	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	VIRFVLARLLQSLVALAILSVVVFILARATGDPLHLILPMS
Ga0070708_1020421441	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MLRFVAARLVQSLVALAIISVVVFVLARATGDPLYLILPMSA
Ga0070707_1007214571	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MLRFVAARLLQSLIALAIVSVVVFVLARATGDPLYLILPMSASQ
Ga0070697_1004149572	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MLRFVFFRLLQSLIALAILSVVVFVLARATGDPLHMILPMNASE
Ga0066697_102128531	3300005540	Soil	VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMSASEEDYANA
Ga0070686_1000368884	3300005544	Switchgrass Rhizosphere	VIRFVLARFVQSLVALAILSVVVFILARATGDPLHLILPMS
Ga0070695_1011874942	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	MLRFVFFRLIQSLVALAILSIVVFVLARATGDPLHMILPMNAS
Ga0070696_1019364042	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	MIRFVCFRLLQSLIALAILSVVVFVLARATGDPLHMILPMNA
Ga0066692_109619932	3300005555	Soil	VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMSASEEDYA
Ga0066698_104035741	3300005558	Soil	VIRFVVSRLLQSLVALAILSVVVFILARATGDPLHLILPMSA
Ga0066698_110183872	3300005558	Soil	MVRFVVFRLLQSLVALAILSVVVFVLARATGDPLHMILPMNASEEDY
Ga0068855_1010925971	3300005563	Corn Rhizosphere	MLRFIATRLVQSLVALAIVSVVVFVLARATGDPLYLILPM
Ga0066703_100771911	3300005568	Soil	VLRFVLFRLLQSLVALAILSVVVFVLARATGDPLHMI
Ga0068859_1003878221	3300005617	Switchgrass Rhizosphere	VIRFVLARFVQSLVALAILSVVVFILARATGDPLHLILP
Ga0068870_101951172	3300005840	Miscanthus Rhizosphere	MIRFVLFRLLQSLIALAILSVVVFVLARATGDPLH
Ga0075417_103767761	3300006049	Populus Rhizosphere	MLRFVAVRLLQSVVTLALLSLVVFVLARTTGDPLHM
Ga0066653_103646671	3300006791	Soil	MLRFVVFRLLQSLVALAILSVVVFVLARATGDPLHMILPMNA
Ga0066665_115617911	3300006796	Soil	VIRFVVSRLLQSLVALAILSVVVFILARATGDPLH
Ga0079221_101365612	3300006804	Agricultural Soil	MLRFVAARLMQSLVALAIISVVVFVLARATGDSLYLI
Ga0099791_105380552	3300007255	Vadose Zone Soil	MLRFVAARLVQSLVALAIISVVVFVLARATGDPLYL
Ga0066710_1041610222	3300009012	Grasslands Soil	MLRFVLSRLVQSLVALAILSVVVFVLARTTGDPLHLILP
Ga0099829_103769972	3300009038	Vadose Zone Soil	LIRFILFRLLQSLVALAMLSVVVFVLARTTGDPLHMILPMN
Ga0099827_119832181	3300009090	Vadose Zone Soil	VLRFVLTRLAQSLAALAILSVVVFVLARATGDPLHLILPMSASEEDYANARQYL
Ga0075418_106393652	3300009100	Populus Rhizosphere	VIRFVLSRLAQSLVALAILSVVVFILARATGDPLQLILPMSA
Ga0066709_1007674062	3300009137	Grasslands Soil	MIRFVAVRLLQSLVALALLSIVVFVLARATGDPLT
Ga0105243_122706862	3300009148	Miscanthus Rhizosphere	VIRFVLARFLQSLVALAILSVVVFILARATGDPLHLILPMSA
Ga0111538_101632271	3300009156	Populus Rhizosphere	VARFVFARLVQSLVALVILSVVVFVLARATGDPLHLILPM
Ga0111538_124062251	3300009156	Populus Rhizosphere	MARFVFFRLLQSLIALAILSVVVFVLARATGDPLHMILPM
Ga0075423_107123271	3300009162	Populus Rhizosphere	VIRFVLSRLAQSLVALAILSVVVFILARATGDPLQL
Ga0105080_10336511	3300009797	Groundwater Sand	LLRFVFFRLLQSLVALAMLSVVVFVLARATGDPLHMILPMSATEE
Ga0105070_11164562	3300009815	Groundwater Sand	LIRFVFSRLVQSLVALAILSIVVFVLARTTGDPLHLILPMSATEED
Ga0105072_10928802	3300009818	Groundwater Sand	MIRFVLVRLLQSLVALAILSVVVFVLARTTGDPLHMILPMSATQE
Ga0126384_100378483	3300010046	Tropical Forest Soil	LVRFVLFRLLQSLVALAILSVVVFVLARTTGDPLH
Ga0126382_106385801	3300010047	Tropical Forest Soil	MQRYIVRRFLQSLLALIILSVVVFLLARATGDPLHLI
Ga0134109_104530882	3300010320	Grasslands Soil	MLRFVVFRLLQSLVALAILSVVVFILARATGDPLHMILPMNASEEDYA
Ga0134086_101603122	3300010323	Grasslands Soil	VIRFVLSRVLQSLVALAILSVVVFILARATGDPLHLIL
Ga0134080_102219062	3300010333	Grasslands Soil	VVRFVLARLLQSMVALAILSVVVFILARATGDPLHLILPMSASEE
Ga0134080_103966332	3300010333	Grasslands Soil	VARFVLARLVQSLVALAILSVVVFVLARATGDPLHLIL
Ga0126379_108555672	3300010366	Tropical Forest Soil	VARFVFARLVQSLVALAILSVVVFVLARATGDPLHL
Ga0134127_125088731	3300010399	Terrestrial Soil	VIRFVLARFLQSLVALAILSVVVFILARATGDPLHLILPMSATQEDYAEARRYL
Ga0134122_119065081	3300010400	Terrestrial Soil	MLRFIAARLLQSLIALAIVSVVVFVLARATGDPLYLILPMSASQED
Ga0137392_105611252	3300011269	Vadose Zone Soil	LIRFILFRLLQSLVALAMLSVVVFVLARTTGDPLHMILPMNASEEDYAN
Ga0137392_110482551	3300011269	Vadose Zone Soil	MLRFVAARLVQSLVALAIISVVVFVLARATGDPLYLI
Ga0137393_116274272	3300011271	Vadose Zone Soil	LIRFVLSRLLQSLVALAILSVVVFVLARATGDPLSLILPMGATEE
Ga0137455_11874471	3300011429	Soil	VIRFVFSRLLQSLAALAILSVVVFALARTTGDPLHLILPM
Ga0137388_118932662	3300012189	Vadose Zone Soil	MLRFLLTRLVQSAATLAILSVVVFLLARSTGDPLTL
Ga0137383_103929592	3300012199	Vadose Zone Soil	VLRFVLFRLLQSLVALAILSVVVFVLARATGDPLHMILPMNASEED
Ga0137378_110704051	3300012210	Vadose Zone Soil	VLRFVLFRLLQSLVALAILSVVVFLLARATGDPLHMILP
Ga0137384_103080132	3300012357	Vadose Zone Soil	VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMSA
Ga0137368_108435021	3300012358	Vadose Zone Soil	MIRFVLTRFAQSLIALAMLSVVVFILARATGDPLQMILPM
Ga0137361_114114881	3300012362	Vadose Zone Soil	VARFVLTRLLQSLAVLAILSVVVFVLARASGDPLHLILPMS
Ga0137390_111489162	3300012363	Vadose Zone Soil	VVRFILSRLLQSLVALAILSVVVFILARATGDPLHLILPMSASEEDYA
Ga0137359_109286101	3300012923	Vadose Zone Soil	VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMSASEEDYAN
Ga0137416_121532211	3300012927	Vadose Zone Soil	VIRFVLSRVLQSLVALAILSVVVFILARATGDPLHLI
Ga0137407_102609132	3300012930	Vadose Zone Soil	MLRFVFFRLLQSLIALAILSVVVFVLARATGDPLH
Ga0137407_123891821	3300012930	Vadose Zone Soil	VVRFVLARLLQSLVALAILSVVVFILARATGDPLHL
Ga0126369_122688882	3300012971	Tropical Forest Soil	MLRFVLFRVLQSLIALAILSVVVFVLARTTGDPLHLILP
Ga0134110_101429452	3300012975	Grasslands Soil	MLRFVFFRLLQSLIALAILSVVVFVLARATGDPLHMILPMNA
Ga0163162_118957432	3300013306	Switchgrass Rhizosphere	MRRFLLQRVVRALLTLAILSVVIFLLARATGDPLTLILPPEASAQ
Ga0137420_14864606	3300015054	Vadose Zone Soil	MLRFVFFRLLQSLIALAILSVVVFVLARATGDPCHMILPMNASEEDYAQRAALPRAR
Ga0137418_101016371	3300015241	Vadose Zone Soil	MLRFVLARLSQSAITLLLFSVVIFGLARATGDPLT
Ga0134089_103614031	3300015358	Grasslands Soil	VLRFVLFRVLQSLVALTLLSVVVFVLARTTGDPLHLILP
Ga0132258_104328283	3300015371	Arabidopsis Rhizosphere	VIRFVLARLGHSLIALALLSVVVFALARFTGDPLNLI
Ga0132257_1017413231	3300015373	Arabidopsis Rhizosphere	MLRFVAARLLQSLAALAIISVVVFVLARATGDPLYLIL
Ga0182040_112942241	3300016387	Soil	VARFVFTRLLQSLAALAILSVVVFVLARATGDPLHL
Ga0134112_102765442	3300017656	Grasslands Soil	VIRFVLSRVLQSLVALAILSVVVFILARATGDPLHL
Ga0184612_101337202	3300018078	Groundwater Sediment	LIRFVLSRLLQSLVALAILSVVVFVLARTTGDPLYLIL
Ga0184646_13608432	3300019259	Groundwater Sediment	MLRFVSFRLLQSLVALAMLSVVVFVLARTTGDPLHMILPMS
Ga0137408_12096311	3300019789	Vadose Zone Soil	VARFVLAFVLARLVQSLMALAILSVVVFVLARATGDPLHLIL
Ga0194113_104916252	3300020074	Freshwater Lake	LIRFVVVRLLQSLVALAILTIVVFILARATGDPLHMILPMS
Ga0210379_105334682	3300021081	Groundwater Sediment	VLRFIGARLLQSLVALAIISVVVFVLARTTGDPLYLILPMSA
Ga0247793_10351072	3300023066	Soil	MLRFIATRLVQSLVALAIVSVVVFVLARATGDPLYLILPMSASQ
Ga0209109_103670151	3300025160	Soil	MWRFGLSRALQSLVALAILSVVVFVLARATGDPLHLILPANA
Ga0207653_101206912	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	MLRFVAARLVQSLVALAIISVVVFVLARATGDPLYLILPM
Ga0207645_107746451	3300025907	Miscanthus Rhizosphere	VIRFVVSRLLQSLVALAILSVVVFILARATGDPLHLILPMSATK
Ga0207684_114728822	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	LIRFVVSRVLQSLVALAILSVVVFILARATGDPLQ
Ga0207662_101990161	3300025918	Switchgrass Rhizosphere	VIRFVLARFVQSLVALAILSVVVFILARATGDPLHLILPMSATQEDYAEARRYL
Ga0207689_115298571	3300025942	Miscanthus Rhizosphere	MIRFVLFRLLQSLIALAILSVVVFVLARATGDPLHMIMPMSAT
Ga0207667_108498302	3300025949	Corn Rhizosphere	MLRFIATRLVQSLVALAIVSVVVFVLARATGDPLYLILPMSAS
Ga0209438_10973082	3300026285	Grasslands Soil	VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLI
Ga0209237_10537162	3300026297	Grasslands Soil	VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMSASEEDYANARRYL
Ga0209761_12234751	3300026313	Grasslands Soil	VARFVLTRLVQSLAALAILSVVVFVLARATGDPLHLILP
Ga0209686_12030412	3300026315	Soil	MLRFVFFRLLQSLIALAILSVVVFVLARATGDPLHM
Ga0209131_11120092	3300026320	Grasslands Soil	MRRFLVQRVVRALLTLAILSVVIFLLARATGDPLTLILPPEASAQ
Ga0209058_11313152	3300026536	Soil	VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMSASEEDY
Ga0209161_105398752	3300026548	Soil	VARFVLTRLLQSLAALAILSVVVFVLARATGDPLHLILPMS
Ga0207569_1022221	3300026697	Soil	LIRFVVSRVLQSLVALAILSVVVFILARATGDPLQLIL
Ga0209897_10379471	3300027169	Groundwater Sand	LLRFVAARLVQSLVALAILSIVVFVLARATGDPLH
Ga0208984_10799402	3300027546	Forest Soil	MLRFVFFRLLQSLIALAILSVVVFALARATGDPLHMI
Ga0209811_100843931	3300027821	Surface Soil	VIRFVLARLFQSLVALAILSVVVFILARATGDPLHLILPMSATQ
Ga0209465_100811542	3300027874	Tropical Forest Soil	VARFVFTRLLQSLAALAILSVVVFVLARATGDPLHLILP
Ga0209382_119975941	3300027909	Populus Rhizosphere	VARFVLTRLVQSLAALAILSVVVFVLARATGDPLHLILPMSASE
Ga0308187_104156161	3300031114	Soil	MSVILRFVAVRLAQSLVALALLSIVVFILARATGDPL
Ga0307469_109696391	3300031720	Hardwood Forest Soil	VIRFILSRVFQSLVALAILSVVVFILARATGDPLHLILPMSASEE
Ga0310884_102939931	3300031944	Soil	VARFVLTRLLQSLAALAILSVVVFVLARATGDPLH
Ga0307416_1014241191	3300032002	Rhizosphere	MLRFISFRLLQSLIALAILSVVVFVLARATGDPLHMIL
Ga0310897_100956602	3300032003	Soil	MIRFVCFRLLQSLIALAILSVVVFVLARATGDPLHMILP
Ga0318505_103451361	3300032060	Soil	VARFVFTRLLQSLAALAILSVVVFVLARATGDPLHLIL
Ga0307470_101888071	3300032174	Hardwood Forest Soil	VIRFVVSRLLQSLVALAILSVVVFILARATGDPLHLILPMSATKED
Ga0310889_106137982	3300032179	Soil	MLRFVAARLLQSLVALAIISVVVFVLARATGDPLYLILPMSA
Ga0307471_1034270092	3300032180	Hardwood Forest Soil	VARFVLARLVQSLVALAILSVVVFVLARATGDPLHLILPMSA
Ga0247830_102236471	3300033551	Soil	MLRFVASRLLQSLVALAILSVVVFVLARATGDPLHMI
Ga0364945_0166043_531_665	3300034115	Sediment	VARFVLTRLIQSLAALALLSVVVFVLARATGDPLHLILPMSASEE

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign