NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F079994

Metagenome Family F079994

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079994
Family Type Metagenome
Number of Sequences 115
Average Sequence Length 42 residues
Representative Sequence MEHLQQRLDALKQQEANLLMQLDEVRVLISAYENTLNKDDKGVG
Number of Associated Samples 84
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 47.83 %
% of genes near scaffold ends (potentially truncated) 36.52 %
% of genes from short scaffolds (< 2000 bps) 77.39 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (41.739 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(26.956 % of family members)
Environment Ontology (ENVO) Unclassified
(63.478 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(45.217 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 81.82%    β-sheet: 0.00%    Coil/Unstructured: 18.18%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF08291Peptidase_M15_3 16.52
PF01510Amidase_2 6.96
PF04860Phage_portal 3.48
PF14550Peptidase_S78_2 1.74
PF13692Glyco_trans_1_4 0.87
PF07460NUMOD3 0.87
PF13392HNH_3 0.87
PF08774VRR_NUC 0.87
PF09568RE_MjaI 0.87
PF04466Terminase_3 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG1783Phage terminase large subunitMobilome: prophages, transposons [X] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.26 %
UnclassifiedrootN/A41.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2043231003|sed1_GCH9ZVC02FNKC6Not Available503Open in IMG/M
3300002835|B570J40625_100120061All Organisms → Viruses → Predicted Viral3133Open in IMG/M
3300002835|B570J40625_101558756Not Available541Open in IMG/M
3300003277|JGI25908J49247_10024157All Organisms → Viruses → Predicted Viral1785Open in IMG/M
3300003277|JGI25908J49247_10084932Not Available775Open in IMG/M
3300003393|JGI25909J50240_1017715All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales1664Open in IMG/M
3300003394|JGI25907J50239_1014537All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Phyllobacterium → Phyllobacterium sophorae1810Open in IMG/M
3300003394|JGI25907J50239_1015921All Organisms → Viruses → Predicted Viral1712Open in IMG/M
3300003490|JGI25926J51410_1009898All Organisms → Viruses → Predicted Viral1977Open in IMG/M
3300003493|JGI25923J51411_1049783Not Available757Open in IMG/M
3300004481|Ga0069718_16111287All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300005580|Ga0049083_10087327All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1086Open in IMG/M
3300005581|Ga0049081_10287817Not Available569Open in IMG/M
3300005582|Ga0049080_10105971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. B2-1-2955Open in IMG/M
3300005805|Ga0079957_1087799All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1735Open in IMG/M
3300006637|Ga0075461_10094462All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage943Open in IMG/M
3300006802|Ga0070749_10174598All Organisms → cellular organisms → Bacteria1240Open in IMG/M
3300006802|Ga0070749_10201517All Organisms → Viruses → Predicted Viral1140Open in IMG/M
3300006802|Ga0070749_10376195Not Available786Open in IMG/M
3300006802|Ga0070749_10573927Not Available610Open in IMG/M
3300007363|Ga0075458_10019802All Organisms → Viruses2142Open in IMG/M
3300007541|Ga0099848_1279217Not Available578Open in IMG/M
3300007973|Ga0105746_1105655All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage927Open in IMG/M
3300008259|Ga0114841_1009303Not Available6386Open in IMG/M
3300008259|Ga0114841_1016958All Organisms → Viruses → Predicted Viral4693Open in IMG/M
3300008267|Ga0114364_1040266All Organisms → Viruses → Predicted Viral1750Open in IMG/M
3300008450|Ga0114880_1083988Not Available1264Open in IMG/M
3300008450|Ga0114880_1214828Not Available631Open in IMG/M
3300008450|Ga0114880_1224103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage609Open in IMG/M
3300009037|Ga0105093_10079572All Organisms → Viruses → Predicted Viral1545Open in IMG/M
3300009081|Ga0105098_10129440All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1116Open in IMG/M
3300009082|Ga0105099_10392417All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage827Open in IMG/M
3300009082|Ga0105099_10729172Not Available616Open in IMG/M
3300009082|Ga0105099_10845083Not Available575Open in IMG/M
3300009085|Ga0105103_10527899All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300009085|Ga0105103_10878227All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300009165|Ga0105102_10010418Not Available3552Open in IMG/M
3300010354|Ga0129333_10914089Not Available742Open in IMG/M
3300010368|Ga0129324_10366289Not Available559Open in IMG/M
3300011011|Ga0139556_1061136Not Available563Open in IMG/M
3300013005|Ga0164292_10010233Not Available7679Open in IMG/M
3300013005|Ga0164292_10170732All Organisms → Viruses → Predicted Viral1573Open in IMG/M
(restricted) 3300013126|Ga0172367_10059945All Organisms → Viruses → Predicted Viral2933Open in IMG/M
3300013941|Ga0117792_1030653All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage597Open in IMG/M
3300014257|Ga0075319_1124774All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300014309|Ga0075317_1067913Not Available739Open in IMG/M
3300017707|Ga0181363_1048686All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage763Open in IMG/M
3300017736|Ga0181365_1032958All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1307Open in IMG/M
3300017774|Ga0181358_1157253All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage772Open in IMG/M
3300017777|Ga0181357_1081250All Organisms → Viruses → Predicted Viral1239Open in IMG/M
3300017778|Ga0181349_1095656All Organisms → Viruses → Predicted Viral1117Open in IMG/M
3300017785|Ga0181355_1118401All Organisms → Viruses → Predicted Viral1085Open in IMG/M
3300017785|Ga0181355_1392594Not Available503Open in IMG/M
3300019783|Ga0181361_118724All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300019784|Ga0181359_1025083All Organisms → Viruses → Predicted Viral2278Open in IMG/M
3300019784|Ga0181359_1086946All Organisms → Viruses → Predicted Viral1164Open in IMG/M
3300020048|Ga0207193_1003607Not Available25832Open in IMG/M
3300020151|Ga0211736_10662513Not Available580Open in IMG/M
3300020183|Ga0194115_10020123All Organisms → Viruses5239Open in IMG/M
3300020498|Ga0208050_1011845All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage963Open in IMG/M
3300020530|Ga0208235_1006888Not Available1511Open in IMG/M
3300020543|Ga0208089_1000423Not Available11034Open in IMG/M
3300021962|Ga0222713_10248086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Lirvirus → Synechococcus virus SCBP31161Open in IMG/M
3300021963|Ga0222712_10001425Not Available29494Open in IMG/M
3300022179|Ga0181353_1041760Not Available1211Open in IMG/M
3300022190|Ga0181354_1244436Not Available514Open in IMG/M
3300022407|Ga0181351_1135918All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage903Open in IMG/M
3300025889|Ga0208644_1004425Not Available10606Open in IMG/M
3300027656|Ga0209357_1000110Not Available28170Open in IMG/M
3300027656|Ga0209357_1197414Not Available513Open in IMG/M
3300027656|Ga0209357_1197415Not Available513Open in IMG/M
3300027693|Ga0209704_1106637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage799Open in IMG/M
(restricted) 3300027728|Ga0247836_1065466All Organisms → Viruses → Predicted Viral1960Open in IMG/M
(restricted) 3300027728|Ga0247836_1098542All Organisms → Viruses → Predicted Viral1416Open in IMG/M
(restricted) 3300027730|Ga0247833_1220976Not Available692Open in IMG/M
3300027762|Ga0209288_10246645All Organisms → cellular organisms → Bacteria → FCB group589Open in IMG/M
3300027785|Ga0209246_10147941Not Available923Open in IMG/M
3300027798|Ga0209353_10371126Not Available593Open in IMG/M
3300027798|Ga0209353_10421360All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300027805|Ga0209229_10315658All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage687Open in IMG/M
3300027808|Ga0209354_10042732All Organisms → cellular organisms → Bacteria → Proteobacteria1821Open in IMG/M
3300031565|Ga0307379_11499808Not Available537Open in IMG/M
3300031566|Ga0307378_10317791All Organisms → Viruses → Predicted Viral1464Open in IMG/M
3300031578|Ga0307376_10335797All Organisms → Viruses → Predicted Viral1003Open in IMG/M
3300031578|Ga0307376_10441785All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300031673|Ga0307377_10354492All Organisms → Viruses → Predicted Viral1099Open in IMG/M
3300031673|Ga0307377_10392441All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300031857|Ga0315909_10273114Not Available1281Open in IMG/M
3300033978|Ga0334977_0328333All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage729Open in IMG/M
3300033978|Ga0334977_0358485Not Available688Open in IMG/M
3300033981|Ga0334982_0000288Not Available30709Open in IMG/M
3300033981|Ga0334982_0132149All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1287Open in IMG/M
3300033993|Ga0334994_0015024Not Available5237Open in IMG/M
3300033995|Ga0335003_0232801All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage862Open in IMG/M
3300034019|Ga0334998_0106133Not Available1858Open in IMG/M
3300034020|Ga0335002_0001471Not Available20570Open in IMG/M
3300034050|Ga0335023_0008491Not Available6053Open in IMG/M
3300034061|Ga0334987_0037798All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4138Open in IMG/M
3300034061|Ga0334987_0118333All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Lirvirus → Synechococcus virus SCBP32000Open in IMG/M
3300034061|Ga0334987_0426461Not Available831Open in IMG/M
3300034061|Ga0334987_0593365Not Available655Open in IMG/M
3300034061|Ga0334987_0770257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300034061|Ga0334987_0829123Not Available512Open in IMG/M
3300034062|Ga0334995_0078371All Organisms → Viruses → Predicted Viral2576Open in IMG/M
3300034062|Ga0334995_0101833All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2176Open in IMG/M
3300034062|Ga0334995_0400444Not Available859Open in IMG/M
3300034073|Ga0310130_0000499Not Available30968Open in IMG/M
3300034073|Ga0310130_0018568All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter → unclassified Mucilaginibacter → Mucilaginibacter sp. OK0982246Open in IMG/M
3300034092|Ga0335010_0375506All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage786Open in IMG/M
3300034101|Ga0335027_0048751All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3439Open in IMG/M
3300034102|Ga0335029_0368620All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage879Open in IMG/M
3300034111|Ga0335063_0001180All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15807Open in IMG/M
3300034118|Ga0335053_0456709All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage762Open in IMG/M
3300034166|Ga0335016_0256386All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300034272|Ga0335049_0512081Not Available762Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater26.96%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake23.48%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment8.70%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.96%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil5.22%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater4.35%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.48%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.61%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.74%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.74%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.74%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.74%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water1.74%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.87%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.87%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.87%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.87%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.87%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.87%
Epidermal MucusHost-Associated → Fish → Skin → Epidermal Mucus → Unclassified → Epidermal Mucus0.87%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2043231003Sediment 1EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003490Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300003493Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013941Epidermal mucus viral and microbial communities from European eel in Spain - water from Alfacada pond (Ebro delta)Host-AssociatedOpen in IMG/M
3300014257Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D1EnvironmentalOpen in IMG/M
3300014309Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D1EnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019783Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020530Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020543Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027656Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027728 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14mEnvironmentalOpen in IMG/M
3300027730 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8mEnvironmentalOpen in IMG/M
3300027762Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034050Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034166Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
sed1_8687702043231003MarineMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLKENDKGVG
B570J40625_10012006163300002835FreshwaterMEHLQQRLEQLKQQEASLLMQLDEVKVLINAYENALKPVASSDETI*
B570J40625_10155875613300002835FreshwaterPLMEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTINKDDKGVG*
JGI25908J49247_1002415713300003277Freshwater LakeLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLKENDKGISR*
JGI25908J49247_1008493223300003277Freshwater LakeMEHLQQRLDALKQQEANLLMQXDEVRVLVSAYENTLNKDDKGVXX*
JGI25909J50240_101771513300003393Freshwater LakeHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGEC*
JGI25907J50239_101453733300003394Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLKENDKGISG*
JGI25907J50239_101592143300003394Freshwater LakeLLMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVSG*
JGI25926J51410_100989843300003490Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGEC*
JGI25923J51411_104978313300003493Freshwater LakeQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGEC*
Ga0069718_1611128713300004481SedimentMEHLQQRLEQLKQQEASLLMQLDEIKVLINAYENTLKEKE*
Ga0049083_1008732733300005580Freshwater LenticMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVSG*
Ga0049081_1028781733300005581Freshwater LenticMEHLQQRLDALKQQEANLLMQLDEVRVLISAYENTLNKDDKGVG*
Ga0049080_1010597133300005582Freshwater LenticMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVS*
Ga0079957_108779943300005805LakeLGKNPMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLKENDKAVS*
Ga0075461_1009446223300006637AqueousMEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTINKDDKGVG*
Ga0070749_1017459813300006802AqueousMEHLTQRLEQLKQQESALIMQLDELRVLIQAYQNTLENDKGVG*
Ga0070749_1020151733300006802AqueousEQLKQQESALIMQLDELRVLIQAYQNTLENDKGVG*
Ga0070749_1037619523300006802AqueousMEHLQQRLDALKQQEANLLMQLDEVRVLIQAYENTLNKDDKGVG*
Ga0070749_1057392733300006802AqueousMEHLQSRLEQLKQQESALIMQLDELRVLIQAYQNTLENDKGVG*
Ga0075458_1001980243300007363AqueousMEHLQQRLEQLQQQQASLLMQLDEVKVLINAYENALKPVADEAPE*
Ga0099848_127921723300007541AqueousLKQQEANLLMQLDEVRVLIQAYENTLNKDDKGVG*
Ga0105746_110565513300007973Estuary WaterMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLKENDKGVS*
Ga0114841_100930353300008259Freshwater, PlanktonMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVG*
Ga0114841_101695873300008259Freshwater, PlanktonMEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTLNKDDKGVS*
Ga0114364_104026613300008267Freshwater, PlanktonALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVG*
Ga0114880_108398823300008450Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLKENDKAVS*
Ga0114880_121482813300008450Freshwater LakeLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVG*
Ga0114880_122410313300008450Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYDNTLNKDDKGVG*
Ga0105093_1007957253300009037Freshwater SedimentMEHLQQRLEALKQQEANLLMQLDEVRVLIQAYENTINKDEIPA*
Ga0105098_1012944023300009081Freshwater SedimentMEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTINKDEIPA*
Ga0105099_1039241723300009082Freshwater SedimentMEHLQQRLEQLKQQEASLLMQLDEVKVLINAYENTLKEKE*
Ga0105099_1072917233300009082Freshwater SedimentEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTINKDEIPA*
Ga0105099_1084508333300009082Freshwater SedimentMEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTINKDE*
Ga0105103_1052789923300009085Freshwater SedimentMENLQARLDQLKAQEAQVLMQLDELRVLISAYENTIKENDKGVG*
Ga0105103_1087822723300009085Freshwater SedimentMEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTLNKDDKGVG*
Ga0105102_10010418103300009165Freshwater SedimentLTQRLEALKQQEANLLMQLDEVRVLIQAYENTINQ*
Ga0129333_1091408923300010354Freshwater To Marine Saline GradientMEHLQQRLDALKQQEANLLMQLDEVRVLIQAYENTLNKDDKGVS*
Ga0129324_1036628913300010368Freshwater To Marine Saline GradientPMEHLQQRLDALKQQEANLLMQLDEVRVLIQAYDNTLNKDDKGVG*
Ga0139556_106113623300011011FreshwaterVEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLKENDKGISG*
Ga0164292_1001023313300013005FreshwaterHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVG*
Ga0164292_1017073233300013005FreshwaterMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGV
(restricted) Ga0172367_1005994563300013126FreshwaterMEHLQQRLDALKQQEANLLMQLDEVRVLIQAYENTLNNDKGVS*
Ga0117792_103065313300013941Epidermal MucusMEHLQQRLDALKQQEANLLMQLDEVRVLIQAYENTLKPDG
Ga0075319_112477433300014257Natural And Restored WetlandsMEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTINK*
Ga0075317_106791313300014309Natural And Restored WetlandsMEHLTQRLEALKEQEANLLMQLDEVRVLIQAYENTINKDDKGVG*
Ga0181363_104868623300017707Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLKENDKGISG
Ga0181365_103295813300017736Freshwater LakeVEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKG
Ga0181358_115725333300017774Freshwater LakeMEHLQQRLEQLKQQEASLLMQLDEVKVLINAYENTLKPLEAIDEAL
Ga0181357_108125043300017777Freshwater LakeLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVG
Ga0181349_109565633300017778Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLKEND
Ga0181355_111840113300017785Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLIQAYENTLNKDDKGVN
Ga0181355_139259413300017785Freshwater LakeLDALKQQEANLLMQLDEVRVLVSAYENTLKENDKGISG
Ga0181361_11872423300019783Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLKENDKGVS
Ga0181359_102508353300019784Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGEC
Ga0181359_108694623300019784Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLKENDKGVSG
Ga0207193_1003607413300020048Freshwater Lake SedimentMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVG
Ga0211736_1066251323300020151FreshwaterMEHLQQRLEQLQQQEAGLLMQLDEIKVLINAYENTLKEKE
Ga0194115_1002012373300020183Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLIQAYENTLNNDKGVS
Ga0208050_101184523300020498FreshwaterVEHLQQRLDALKQQEANLLMQLDEVRVLIQAYENTLNKDDKGVG
Ga0208235_100688833300020530FreshwaterMEQLQQRLEQLKQQEAGLLMQLDEVKVLINAYENTLKEKE
Ga0208089_1000423133300020543FreshwaterVEHLQQRLEALKQQEANLLMQLDEVRVLIQAYENTLNKDDKGVG
Ga0222713_1024808613300021962Estuarine WaterMEHLQQRLDALKQQEANILMQLDEVRVLIQAYENTINKDDKGVG
Ga0222712_10001425493300021963Estuarine WaterMEHLKQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVG
Ga0181353_104176013300022179Freshwater LakeMEHLQQRLEQLKQQEASLLMQLDEVKVLINAYENTIKEKK
Ga0181354_124443613300022190Freshwater LakeQGIKTLLMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVSG
Ga0181351_113591823300022407Freshwater LakeMENLQARLDQLKAQEAQVLMQLDELRVLISAYENTIKENDKGVG
Ga0208644_1004425103300025889AqueousMEHLTQRLEQLKQQESALIMQLDELRVLIQAYQNTLENDKGVG
Ga0209357_100011013300027656Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTL
Ga0209357_119741413300027656Freshwater LakeQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVG
Ga0209357_119741513300027656Freshwater LakeQQRLDALKQQEANLLMQLDEVRVLVSAYENTLKENDKGVS
Ga0209704_110663733300027693Freshwater SedimentMEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTINKDEIPA
(restricted) Ga0247836_106546613300027728FreshwaterMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENT
(restricted) Ga0247836_109854233300027728FreshwaterMEHLQQRLDALKQQEANLLMQLDEVRVLISAYENTLNNDKGVGX
(restricted) Ga0247833_122097623300027730FreshwaterYLLGKQNPMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNNDKGVG
Ga0209288_1024664523300027762Freshwater SedimentMEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTINQ
Ga0209246_1014794113300027785Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDD
Ga0209353_1037112623300027798Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLKENDKGEC
Ga0209353_1042136023300027798Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVSG
Ga0209229_1031565833300027805Freshwater And SedimentMEHLQQRLEALKQQEANLLMQLDEVRVLVSAYENTLNKDDKG
Ga0209354_1004273233300027808Freshwater LakeMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLKK
Ga0307379_1149980833300031565SoilHLQQRLDALKQQEANLLMQLDEVRVLIQAYENTLKENDKGVS
Ga0307378_1031779133300031566SoilMEHLQQRLDALKQQEANLLMQLDEVRVLIQAYENTLNKD
Ga0307376_1033579733300031578SoilMEHLQQRLDAFKQQEANLLMQLDEVRVLIQAYENTLKENDKGVS
Ga0307376_1044178533300031578SoilMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLKENDKGIS
Ga0307377_1035449223300031673SoilMEHLQQRLDAFKQQEANLLMQLDEVRVLVSAYENTLKENDKGVS
Ga0307377_1039244133300031673SoilQRLDALKQQEANLLMQLDEVRVLIQAYENTLNKDDKGVG
Ga0315909_1027311423300031857FreshwaterMEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTLNKDDKGVS
Ga0334977_0328333_36_1733300033978FreshwaterVEHLQQRLEALKQQEANLLMQLDEVRVLVAAYENTLKENDKGVSR
Ga0334977_0358485_336_4763300033978FreshwaterMEHLQQRLEQLKQQEASLLMQLDEVKVLINAYENALKPVASSDETI
Ga0334982_0000288_20561_206833300033981FreshwaterMEHLQQRLEQLKQQEASLLMQLDEIKVLINAYENTLKEKE
Ga0334982_0132149_545_6823300033981FreshwaterMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVSR
Ga0334994_0015024_1536_16703300033993FreshwaterMEHLLQRLDALKQQEANLLMQLDEVRVLIQAYENTLNKDDKGVG
Ga0335003_0232801_2_1273300033995FreshwaterMEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKG
Ga0334998_0106133_1085_12223300034019FreshwaterVEHLQQRLEALKQQEANLLMQLDEVCVLVAAYENTLKENDKGVSR
Ga0335002_0001471_18670_188043300034020FreshwaterMEHLHQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVG
Ga0335023_0008491_138_2723300034050FreshwaterMEHLQQRLDALKQQEANLLMQLDEVRVLIQAYENTLKENDKGVG
Ga0334987_0037798_1719_18563300034061FreshwaterMEHLQQRLEQLKQQEAGLLMQLDEVKVLINAYENALKPVADEAPE
Ga0334987_0118333_1643_17653300034061FreshwaterMEQLQQRLEQLKQQEASLLMQLDEVKVLINAYENTLKEKE
Ga0334987_0426461_10_1233300034061FreshwaterLEALKQQEANLLMQLDEVRVLIQAYENTINKDDKGVG
Ga0334987_0593365_194_3283300034061FreshwaterMEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTINKGDEGVS
Ga0334987_0770257_2_1243300034061FreshwaterMEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTINKDDK
Ga0334987_0829123_383_5113300034061FreshwaterHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTINKGDEGVG
Ga0334995_0078371_949_10833300034062FreshwaterMEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTINKDDKGVS
Ga0334995_0101833_2071_21753300034062FreshwaterMEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENT
Ga0334995_0400444_727_8583300034062FreshwaterEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTINKDDKGVG
Ga0310130_0000499_22_1563300034073Fracking WaterMEHLTQRLEVLKQQEANLLMQLDEVRVLIQAYENTINKDDKGVG
Ga0310130_0018568_2124_22463300034073Fracking WaterMEHLQSRLEQLKQQEASLIMQLDELRVLIQAYQNTLENDKG
Ga0335010_0375506_239_3733300034092FreshwaterMEHLQQRLDALKQQEANLIMQLDEVRVLVSAYENTLNKDDKGVG
Ga0335027_0048751_1470_15923300034101FreshwaterMEQLQQRLEQLKQQEAGLLMQLDEIKVLINAYENTLKEKE
Ga0335029_0368620_582_7163300034102FreshwaterVEHLQQRLDALKQQEANLLMQLDEVRVLVSAYENTLNKDDKGVG
Ga0335063_0001180_15618_157553300034111FreshwaterMEHLQQRLEQLKQQEASLLMQLDEVKVLINAYENALKPVADEAPE
Ga0335053_0456709_1_1203300034118FreshwaterMEHLTQRLEALKQQEANLLMQLDEVRVLIQAYENTINKDD
Ga0335016_0256386_980_10963300034166FreshwaterLDALKQQEANLLMQLDEVRVLVSAYENTLKENDKGECR
Ga0335049_0512081_2_1243300034272FreshwaterLTQRLEALKQQEANLLMQLDEVRVLIQAYENTLNNDKGVG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.