NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079618

Metagenome / Metatranscriptome Family F079618

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079618
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 73 residues
Representative Sequence SPSVLFLFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Number of Associated Samples 107
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 53.91 %
% of genes from short scaffolds (< 2000 bps) 71.30 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.391 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(40.870 % of family members)
Environment Ontology (ENVO) Unclassified
(40.870 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(46.087 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 71.05%    β-sheet: 0.00%    Coil/Unstructured: 28.95%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF03401TctC 15.65
PF01738DLH 11.30
PF00903Glyoxalase 9.57
PF04471Mrr_cat 7.83
PF14235DUF4337 2.61
PF12681Glyoxalase_2 1.74
PF13964Kelch_6 1.74
PF13193AMP-binding_C 0.87
PF08546ApbA_C 0.87
PF05362Lon_C 0.87
PF07646Kelch_2 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 15.65
COG0466ATP-dependent Lon protease, bacterial typePosttranslational modification, protein turnover, chaperones [O] 0.87
COG1067Predicted ATP-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 0.87
COG1750Predicted archaeal serine protease, S18 familyGeneral function prediction only [R] 0.87
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.87
COG3055N-acetylneuraminic acid mutarotaseCell wall/membrane/envelope biogenesis [M] 0.87
COG3480Predicted secreted protein YlbL, contains PDZ domainSignal transduction mechanisms [T] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.39 %
UnclassifiedrootN/A2.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000269|M3P_1019953All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales888Open in IMG/M
3300000929|NpDRAFT_10089936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2472Open in IMG/M
3300002302|B570J29635_1007304All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales727Open in IMG/M
3300002350|B570J29583_1018094All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales519Open in IMG/M
3300002835|B570J40625_100001712All Organisms → cellular organisms → Bacteria40376Open in IMG/M
3300003431|JGI25913J50563_1001598All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim284569Open in IMG/M
3300003493|JGI25923J51411_1055903All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales703Open in IMG/M
3300004790|Ga0007758_10099498All Organisms → cellular organisms → Bacteria → Proteobacteria2167Open in IMG/M
3300005581|Ga0049081_10031484All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2015Open in IMG/M
3300005583|Ga0049085_10006494All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4632Open in IMG/M
3300005584|Ga0049082_10038724All Organisms → cellular organisms → Bacteria → Proteobacteria1670Open in IMG/M
3300005585|Ga0049084_10007928All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim284419Open in IMG/M
3300007547|Ga0102875_1154920All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales719Open in IMG/M
3300007548|Ga0102877_1021453All Organisms → cellular organisms → Bacteria → Proteobacteria1900Open in IMG/M
3300007549|Ga0102879_1013361All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim282810Open in IMG/M
3300007550|Ga0102880_1018563All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1900Open in IMG/M
3300007553|Ga0102819_1074244All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300007561|Ga0102914_1221276All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300007585|Ga0102916_1023845All Organisms → cellular organisms → Bacteria → Proteobacteria1540Open in IMG/M
3300007593|Ga0102918_1120581All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales785Open in IMG/M
3300007597|Ga0102919_1016812All Organisms → cellular organisms → Bacteria → Proteobacteria2214Open in IMG/M
3300007603|Ga0102921_1165565All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales799Open in IMG/M
3300007617|Ga0102897_1020314All Organisms → cellular organisms → Bacteria → Proteobacteria2114Open in IMG/M
3300007622|Ga0102863_1045855All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1272Open in IMG/M
3300007627|Ga0102869_1220760All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300007632|Ga0102894_1129297All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales668Open in IMG/M
3300007639|Ga0102865_1109124All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → unclassified Rhodanobacteraceae → Rhodanobacteraceae bacterium828Open in IMG/M
3300007639|Ga0102865_1154410All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales687Open in IMG/M
3300007692|Ga0102823_1083816All Organisms → cellular organisms → Bacteria → Proteobacteria846Open in IMG/M
3300007708|Ga0102859_1132479All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → unclassified Rhodanobacteraceae → Rhodanobacteraceae bacterium727Open in IMG/M
3300007862|Ga0105737_1029168All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans1297Open in IMG/M
3300007863|Ga0105744_1138959All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300007962|Ga0102907_1114379All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300008261|Ga0114336_1134802All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.1113Open in IMG/M
3300008995|Ga0102888_1107738All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales570Open in IMG/M
3300008999|Ga0102816_1015294All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2192Open in IMG/M
3300008999|Ga0102816_1170230All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales677Open in IMG/M
3300009049|Ga0102911_1108602All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales793Open in IMG/M
3300009051|Ga0102864_1042266All Organisms → cellular organisms → Bacteria → Proteobacteria1228Open in IMG/M
3300009057|Ga0102892_1002258All Organisms → cellular organisms → Bacteria → Proteobacteria3964Open in IMG/M
3300009058|Ga0102854_1006855All Organisms → cellular organisms → Bacteria → Proteobacteria3311Open in IMG/M
3300009059|Ga0102830_1086109All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales935Open in IMG/M
3300009080|Ga0102815_10017040All Organisms → cellular organisms → Bacteria → Proteobacteria4066Open in IMG/M
3300009152|Ga0114980_10159484All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1336Open in IMG/M
3300009160|Ga0114981_10010126All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales5621Open in IMG/M
3300009181|Ga0114969_10110188All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1764Open in IMG/M
3300010309|Ga0102890_1005357All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2656Open in IMG/M
3300011009|Ga0129318_10037307All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1191Open in IMG/M
3300012727|Ga0157531_1067471All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales725Open in IMG/M
3300012766|Ga0138282_1056371All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales743Open in IMG/M
3300012772|Ga0138287_1260108All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales722Open in IMG/M
3300012774|Ga0138283_1212083All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales636Open in IMG/M
3300012779|Ga0138284_1366896All Organisms → cellular organisms → Bacteria → Proteobacteria2347Open in IMG/M
3300018815|Ga0187845_1123318All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales855Open in IMG/M
3300018815|Ga0187845_1209151All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales625Open in IMG/M
3300019093|Ga0187843_10141354All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300020167|Ga0194035_1007105All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim284898Open in IMG/M
3300020492|Ga0208483_1023346All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → unclassified Rhodanobacteraceae → Rhodanobacteraceae bacterium690Open in IMG/M
3300020501|Ga0208590_1034077All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales551Open in IMG/M
3300020507|Ga0208697_1012700All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → unclassified Rhodanobacteraceae → Rhodanobacteraceae bacterium1077Open in IMG/M
3300020542|Ga0208857_1004154All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae2489Open in IMG/M
3300020564|Ga0208719_1017685All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1494Open in IMG/M
3300021962|Ga0222713_10143483All Organisms → cellular organisms → Bacteria → Proteobacteria1656Open in IMG/M
3300023184|Ga0214919_10009285All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae12706Open in IMG/M
3300023184|Ga0214919_10038592All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim284797Open in IMG/M
3300024346|Ga0244775_10036807All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4323Open in IMG/M
3300024348|Ga0244776_10057418All Organisms → cellular organisms → Bacteria → Proteobacteria3013Open in IMG/M
3300024348|Ga0244776_10305852All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1084Open in IMG/M
3300024348|Ga0244776_10850766All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales545Open in IMG/M
3300024485|Ga0256318_1026103All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.1224Open in IMG/M
3300024566|Ga0256309_1169043All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales534Open in IMG/M
3300024571|Ga0256302_1131400All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales589Open in IMG/M
3300027127|Ga0255071_1038773All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales703Open in IMG/M
3300027130|Ga0255089_1044420All Organisms → cellular organisms → Bacteria → Proteobacteria705Open in IMG/M
3300027132|Ga0255110_1063088All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales576Open in IMG/M
3300027141|Ga0255076_1062894All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales621Open in IMG/M
3300027144|Ga0255102_1019577All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim281205Open in IMG/M
3300027147|Ga0255113_1030404All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans1108Open in IMG/M
3300027148|Ga0255115_1003353All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. 103DPR24087Open in IMG/M
3300027193|Ga0208800_1003115All Organisms → cellular organisms → Bacteria → Proteobacteria2047Open in IMG/M
3300027206|Ga0208023_1006242All Organisms → cellular organisms → Bacteria → Proteobacteria2161Open in IMG/M
3300027212|Ga0208554_1000579All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans6246Open in IMG/M
3300027212|Ga0208554_1053692All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales635Open in IMG/M
3300027214|Ga0208306_1012471All Organisms → cellular organisms → Bacteria → Proteobacteria1611Open in IMG/M
3300027218|Ga0208165_1008491All Organisms → cellular organisms → Bacteria → Proteobacteria1557Open in IMG/M
3300027222|Ga0208024_1065036All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales657Open in IMG/M
3300027231|Ga0208172_1061480All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales649Open in IMG/M
3300027240|Ga0208444_1000791All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans5901Open in IMG/M
3300027246|Ga0208931_1025003All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans1218Open in IMG/M
3300027254|Ga0208177_1011614All Organisms → cellular organisms → Bacteria → Proteobacteria1560Open in IMG/M
3300027260|Ga0208027_1008367All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans2153Open in IMG/M
3300027367|Ga0208801_1009237All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans1711Open in IMG/M
3300027488|Ga0255084_1015461All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans1511Open in IMG/M
3300027579|Ga0255068_134453All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → unclassified Rhodanobacteraceae → Rhodanobacteraceae bacterium524Open in IMG/M
3300027581|Ga0209651_1032838All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans1594Open in IMG/M
3300027588|Ga0255101_1029288All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales777Open in IMG/M
3300027593|Ga0255118_1028852All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1000Open in IMG/M
3300027644|Ga0209356_1145401All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → unclassified Rhodanobacteraceae → Rhodanobacteraceae bacterium665Open in IMG/M
3300027720|Ga0209617_10063263All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans1534Open in IMG/M
3300027754|Ga0209596_1148083All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1048Open in IMG/M
3300027764|Ga0209134_10107187All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales957Open in IMG/M
3300028113|Ga0255234_1181001All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales552Open in IMG/M
(restricted) 3300028581|Ga0247840_10534582All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales540Open in IMG/M
3300031786|Ga0315908_10208126All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae1623Open in IMG/M
3300031786|Ga0315908_11410293All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300032092|Ga0315905_10413609All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans1263Open in IMG/M
3300032116|Ga0315903_10568996All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales878Open in IMG/M
3300033984|Ga0334989_0155726All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae1267Open in IMG/M
3300034167|Ga0335017_0381927All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → unclassified Rhodanobacteraceae → Rhodanobacteraceae bacterium767Open in IMG/M
3300034280|Ga0334997_0007198All Organisms → cellular organisms → Bacteria → Proteobacteria7800Open in IMG/M
3300034284|Ga0335013_0812959All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria522Open in IMG/M
3300034356|Ga0335048_0132087All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1455Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine40.87%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater13.04%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.83%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake7.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater6.09%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake5.22%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic3.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.61%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.74%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.87%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.87%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.87%
LoticEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic0.87%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.87%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.87%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.87%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.87%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000269Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 7, Mississippi HeadwatersEnvironmentalOpen in IMG/M
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300002302Freshwater microbial communities from Lake Mendota, WI - 05MAR2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002350Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003431Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300003493Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300004790Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005583Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRFEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005585Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRFEnvironmentalOpen in IMG/M
3300007547Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02EnvironmentalOpen in IMG/M
3300007548Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3EnvironmentalOpen in IMG/M
3300007549Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02EnvironmentalOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300007553Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007585Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3EnvironmentalOpen in IMG/M
3300007593Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3EnvironmentalOpen in IMG/M
3300007597Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02EnvironmentalOpen in IMG/M
3300007603Estuarine microbial communities from the Columbia River estuary - metaG 1568-02EnvironmentalOpen in IMG/M
3300007617Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02EnvironmentalOpen in IMG/M
3300007622Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02EnvironmentalOpen in IMG/M
3300007627Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02EnvironmentalOpen in IMG/M
3300007632Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3EnvironmentalOpen in IMG/M
3300007636Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3EnvironmentalOpen in IMG/M
3300007639Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007962Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02EnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008995Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009051Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02EnvironmentalOpen in IMG/M
3300009057Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3EnvironmentalOpen in IMG/M
3300009058Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300011009Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNAEnvironmentalOpen in IMG/M
3300012727Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES016 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012766Freshwater microbial communities from Lake Montjoie, Canada - M_140807_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012772Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012774Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012779Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018815Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68EnvironmentalOpen in IMG/M
3300019093Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43EnvironmentalOpen in IMG/M
3300020167Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20mEnvironmentalOpen in IMG/M
3300020492Freshwater microbial communities from Lake Mendota, WI - 01JUN2011 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020501Freshwater microbial communities from Lake Mendota, WI - 27SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020507Freshwater microbial communities from Lake Mendota, WI - 12SEP2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020542Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020564Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024485Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024566Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024571Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027127Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8hEnvironmentalOpen in IMG/M
3300027130Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8dEnvironmentalOpen in IMG/M
3300027132Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8hEnvironmentalOpen in IMG/M
3300027141Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8hEnvironmentalOpen in IMG/M
3300027144Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300027147Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027148Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8hEnvironmentalOpen in IMG/M
3300027193Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)EnvironmentalOpen in IMG/M
3300027206Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027212Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027214Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027218Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027222Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027231Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027240Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027246Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027254Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027260Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027367Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027418Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)EnvironmentalOpen in IMG/M
3300027488Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8dEnvironmentalOpen in IMG/M
3300027579Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8hEnvironmentalOpen in IMG/M
3300027581Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027588Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8dEnvironmentalOpen in IMG/M
3300027593Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8hEnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028113Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028581 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17mEnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034167Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
M3P_101995313300000269LoticVAFFFMMRCIQFIQTYSGNLSTSFDSSELLAVQALCHQLGSQNALLVQIAWLQISSFAQYSGHEFRWTSLLWI*
NpDRAFT_1008993633300000929Freshwater And MarineMPLRSKHISPSLLFFFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLVQIAWLQVSSLA*
B570J29635_100730413300002302FreshwaterKRLKKNSGNKSTSFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRRAPMLRI*
B570J29583_101809413300002350FreshwaterFSPAMVFFFMMRMNKRLKKHSGNKSTSFSASELLAVQALCHQLGSQNALLXQIXWLQITNFAQYSGDEFRXAPMLRI*
B570J40625_100001712203300002835FreshwaterMVFFFMMRMNKRLKKNSGNKSTSFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRRAPMLRI*
JGI25913J50563_100159853300003431Freshwater LakeMVFFFMMRMNKRLKKHSGNKSTSFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRRAPMLRI*
JGI25923J51411_105590323300003493Freshwater LakeTELDQFAPAVAFFFMMRCIQFIQTYSGNLSTSFDSSELLAVQALCHQLGSQNALLVQIAWLQISSFAQYSGHEFRWTSLLWI*
Ga0007758_1009949813300004790Freshwater LakeLKPAALYQTELDQFSPAIVFFFMMRMNKRMKKHSGNKSTPFSASELLAVQALCHQLGSQNALLVQIAWLQVSSLA*
Ga0049081_1003148423300005581Freshwater LenticMVFFFMMRMNKRLKKHSGNKSTSFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRWAPMLRI*
Ga0049085_1000649473300005583Freshwater LenticMPFRSKHISPSLLFFFMMLQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLMQIARFQVSSLAQHSGDEFRWSPLLGI*
Ga0049082_1003872433300005584Freshwater LenticMPFRSKHISPSLLFFFMMLQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLVQIAWLQVSSLA*
Ga0049084_1000792823300005585Freshwater LenticMPFRSKHISPSLLFFFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLMQIARFQVSSLAQHSGDEFRWSPLLGI*
Ga0102875_115492023300007547EstuarineMPLRSKHISPSVLFLFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLVQIAWLQVSSLA*
Ga0102877_102145323300007548EstuarineMPLRSKHISPSVLFFFMMRQNKRMKKYSAYTSTLFRSSQLLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0102879_101336143300007549EstuarineMPLRSKHISPSVLFFFMMRQNKRMKKYSAYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0102880_101856323300007550EstuarineMPLRSKHISPSVLFLFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0102819_107424423300007553EstuarineINRISITLPSMPLRSKHISPSVLFFFMMRQNKRMKKYSAYTSTLFRSSQLLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0102914_122127623300007561EstuarineMPLRSKHISPSVLFLFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLVQIAWLQVSSLAQHSGHEFRWSPLLGI*
Ga0102916_102384513300007585EstuarineMPLRSKHISPSVLFLFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVPSLAQHSGHEFRWSPLLGI*
Ga0102918_112058113300007593EstuarineIQFIQTYSGNLSTSFDSSELLAVQALCHQLGSQNALLVQIAWLQISSFAQYSGHEFRWTSLLWI*
Ga0102919_101681213300007597EstuarineKDINRISITLPSMPLRSKHISPSVLFFFMMRQNKRMKKYSAYTSTLFRSSQLLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0102921_116556523300007603EstuarineMPLRSKHISPSVLFLFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLVQIARLQVSSLA*
Ga0102897_102031433300007617EstuarineMPLRSKHISPSVLFFFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0102863_104585523300007622EstuarineMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLVQIAWLQVSSLAQHSGHEFRWSPLLGI*
Ga0102869_122076013300007627EstuarineKPAALYQTELDQFSPAVVFFFMMRMNKRMKKHSGNKSTPFSASELLAVQALCHQLGSQNALLVQIAWLQVSSLA*
Ga0102894_112929723300007632EstuarineLFFFMMRQNKRMKKYSAYTSTLFRSSQLLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0102856_100990533300007636EstuarineMPFRSKHISPSLLFFFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQN
Ga0102865_110912433300007639EstuarineMNKRMKKHSGNKSTPFSASELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEF
Ga0102865_115441013300007639EstuarineIQTYSGNLSTSFDSSELLAVQALCHQLGSQNALLVQIAWLQISSFAQYSGHEFRWTSLLWI*
Ga0102823_108381623300007692EstuarineMPLRSKHISPSVLFFFMMRQNKRMKKYSAYTSTLFRSSELLAVQALCHQLGSQNALLVQIAWLQVSSLAQHSGHEFRWSPLLGI*
Ga0102859_113247913300007708EstuarineMVFFFMMRMNKRLKKHSGNKSTSFSASELLAVQALCHQLGSQNALLVQIAWLQNTNYDQYSGDEFR
Ga0105737_102916813300007862Estuary WaterMPLRSKHISPSVLFFFMMRQNKRMKKYSAYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRW
Ga0105744_113895923300007863Estuary WaterMPLRSKHISPSVLFFFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLMQIARFQVSSLAQHSGAEFRWSPLLGI*
Ga0102907_111437923300007962EstuarineMMLQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLVQIAWLQISNFAQHSGDEFRWTSVLWV*
Ga0114336_113480213300008261Freshwater, PlanktonVFFFMMRMNKRLKKHSGNKSTSFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRRAPMLRI*
Ga0102888_110773823300008995EstuarineLCQTELDQFAPVVAFFFMMRCIQFIQTYSGNLSTSFDSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0102816_101529423300008999EstuarineMPLRSKHISPSVLFFFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLMQIARFQVSSLAQHSGDEFRWSPLLGI*
Ga0102816_117023013300008999EstuarineKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSIAQHSGDEFRWAPMLRI
Ga0102911_110860223300009049EstuarineMNKRMKKHSGNKSTPFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRWEAMLRI*
Ga0102864_104226623300009051EstuarineMPFRSKHISPSLLFFFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0102892_100225853300009057EstuarineMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0102854_100685513300009058EstuarineMPLRSKHISPSVLFFFMMRQNKRMKKYSGYTSTLFRSSQLLAVQALCHQLGSQNALLLQTARLQVSSLAQHSG
Ga0102830_108610913300009059EstuarinePALCQTELDQFAPAVAFFFMMRCIQFIQTYSGNLSTSFDSSALLAVQALCHQLGSQNALLVQIAWLQISNFAQHSGHEFRWTSLLWI*
Ga0102815_1001704023300009080EstuarineMPLRSKHISPSVLFLFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLA*
Ga0114980_1015948433300009152Freshwater LakeMPLRSKHISPSVLFFFMMRQNKQMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0114981_1001012613300009160Freshwater LakeMPLRSKHISPSVLFFFMMRQNKRMKKYSAYTSTLFRSSELLAVQALCHQLGSQNALFLQTARLQVPSLAQHSGDEFRWSPLLGI*
Ga0114969_1011018823300009181Freshwater LakeMPLRSKHISPSVLFFFMMRQNKQMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLMQIARFQVSSLAQHSGDEFRWSPLLGI*
Ga0102890_100535733300010309EstuarineMPLRSKHISPSVLFFFMMRQNKRMKKYSGYTSTLFRSSQLLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0129318_1003730733300011009Freshwater To Marine Saline GradientMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLVQIAWLQISNFAQHSGHEFRWTSLLWI*
Ga0157531_106747113300012727FreshwaterSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0138282_105637113300012766Freshwater LakeKYSAYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0138287_126010823300012772Freshwater LakePPSVLFFFMMRQNKQMKKYSGYTSTLFRSSQLLAVQALCHQLGSQNALFLQTARLQVPSLAQHSGDEFRWSPLLGI*
Ga0138283_121208323300012774Freshwater LakeRQNKRMKKYSAYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0138284_136689613300012779Freshwater LakeSAHTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI*
Ga0187845_112331813300018815FreshwaterKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVPSLAQHSGHEFRWSPLLGI
Ga0187845_120915113300018815FreshwaterMKKHSGNKSTPFSASELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLHG
Ga0187843_1014135413300019093FreshwaterMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Ga0194035_100710543300020167Anoxic Zone FreshwaterMKKSSGNNYPPFGSSELLAVQALCHQLGSENALLVQIARLQVSSFAQHSGDEFRWTSVLW
Ga0208483_102334623300020492FreshwaterMVFFFMMRMNKRLKKNSGNKSTSFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRRAPMLRI
Ga0208590_103407713300020501FreshwaterCLKPAALYQTELDQFSPAMVFFFMMRMNKRLKKNSGNKSTSFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRRAPMLRI
Ga0208697_101270023300020507FreshwaterMVFFFMMRMNKRMKKHSGNKSTPFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRRAPMLRI
Ga0208857_100415413300020542FreshwaterMNKRLKKNSGNKSTSFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRRAPMLRI
Ga0208719_101768533300020564FreshwaterMVFFFMMRMNKRLKKHSGNKSTSFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRWAPMLRI
Ga0222713_1014348313300021962Estuarine WaterMPLRSKHISPSVLFFFMMRQNKRMKKYSAYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSP
Ga0214919_1000928573300023184FreshwaterMPLRSKHISPSVLFFFMMRQNKRMKKYSAYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Ga0214919_1003859243300023184FreshwaterMKKSSGNNYPPFGSSELLAVQAFCHQLGSENALLVQIARLQVSSFAQHSGDEFRWTSVLW
Ga0244775_1003680733300024346EstuarineMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLG
Ga0244776_1005741843300024348EstuarineMPLRSKHISPSVLFLFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLA
Ga0244776_1030585233300024348EstuarineMVFFFMMRMNKRLKKHSGNKSTSFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDAFRW
Ga0244776_1085076623300024348EstuarineKKYSGYASTLFRSSELLAVQALCHQLGSQNALLMQIARFQVSSLAQHSGDEFRWSPLLGI
Ga0256318_102610333300024485FreshwaterDQFAPAVAFFFMMRCIQFIQTYSGNLSTSFNSSELLAVQALCHQLGSQNALLVQIAWLQISSFAQYSGHEFRWTSLLWI
Ga0256309_116904313300024566FreshwaterQFEPAVAFFFMMRCIQSIQTYSGNLSTSFDSSELLAVQALCHQLGSQNALLVQIAWLQISSFAQYSGHEFRWTSLLWI
Ga0256302_113140023300024571FreshwaterFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Ga0255071_103877323300027127FreshwaterFSPAIVFFFMMRMNKRMKKHSGNKSTPFSASELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Ga0255089_104442023300027130FreshwaterMPLRSKHISPSVLFLFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Ga0255110_106308813300027132FreshwaterPAVVFFFMMRMNKRMKKHSGNKSTPFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRWAPMLRI
Ga0255076_106289413300027141FreshwaterDINRISITLPSMPLRSKHISPSVLFFFMMRQNKRMKKYSAYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Ga0255102_101957733300027144FreshwaterFAPALAFFFMMRCIQFIQTYSGNLSTSFDSSELLAVQALCHQLGSQNALLVQIAWLQISSFTQYSGHEFRWTSLLWI
Ga0255113_103040433300027147FreshwaterMKKHSGNKSTPFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRRAPMLR
Ga0255115_100335343300027148FreshwaterMVFFFMMRMNKRLKKHSGNKSTSFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRRAPMLRI
Ga0208800_100311513300027193EstuarineMPLRSKHISPSVLFFFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Ga0208023_100624233300027206EstuarineMPFRSKHISPSLLFFFMMLQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLMQIARFQVSSLAQHSGDEFRWSPLLGI
Ga0208554_100057923300027212EstuarineMMLQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLMQIARFQVSSLAQHSGDEFRWSPLLGI
Ga0208554_105369213300027212EstuarineNKRMKKYSAYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Ga0208306_101247133300027214EstuarineMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLVQIAWLQVSSLAQHSGHEFRWSPLLGI
Ga0208165_100849133300027218EstuarineMPLRSKHISPSVLFFFMMRQNKRMKKYSAYTSTLFRSSQLLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSP
Ga0208024_106503613300027222EstuarineRMKKYSAYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Ga0208172_106148013300027231EstuarineKYSAYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Ga0208444_100079133300027240EstuarineMPLRSKHISPSVLFLFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVPSLAQHSGHEFRWSPLLGI
Ga0208931_102500333300027246EstuarineSPSVLFLFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Ga0208177_101161433300027254EstuarineMPLRSKHISPSVLFLFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLVQIAWLQVSSLAQHSGHEFRWSPLLGI
Ga0208027_100836733300027260EstuarineDINRISITLPSIPFHSKHISPSLLFFFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Ga0208801_100923733300027367EstuarineMMLQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Ga0208022_102437413300027418EstuarineMPLRSKHISPSVLFLFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQT
Ga0255084_101546113300027488FreshwaterSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Ga0255068_13445313300027579FreshwaterMRCIQFIQTYSGNLSTSFNSSELLAVQALCHQLGSQNALLVQIAWLQISSFAQYSGHEFR
Ga0209651_103283833300027581Freshwater LakeIPFHSKHISPSLLFFFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLVQIARLQVSSLA
Ga0255101_102928823300027588FreshwaterTYSGNLSTSFDSSELLAVQALCHQLGSQNALLVQIAWLQISNFAQHSGHEFRWTSLLWI
Ga0255118_102885223300027593FreshwaterVQFSPAIVFFFMMRMNKRMKKHSGNKSTPFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRWAPMLRI
Ga0209356_114540113300027644Freshwater LakeMMRCIQFIQTYSGNLSTSFDSSELLAVQALCHQLGSQNALLVQIAWLQISSFAQYSGHEFRWTSLLWIRSKTIN
Ga0209617_1006326333300027720Freshwater And SedimentAALYQTELDQFSPAIVFFFMMRMNKRMKKHSGNKSTPFSASELLAVQALCHQLGSQNALLVQIAWLQVSSLA
Ga0209596_114808333300027754Freshwater LakeSKHISPSVLFFFMMRQNKRMKKYSAYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFRWSPLLGI
Ga0209134_1010718723300027764Freshwater LakeELDQFAPVVAFFFMMRCIQFIQTYSGNLSTSFDSSELLAVQALCHQLGSQNALLVQIAWLQISSFAQYSGHEFRWTSLLWI
Ga0209191_105741713300027969Freshwater LakeMKKYSAYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGDEFR
Ga0255234_118100123300028113FreshwaterFFFMMRMNKRMKKHSGNKSTPFSASELLAVQALCHQLGSQNALLVQIAWLQISSFAQYSGHEFRWTSLLWI
(restricted) Ga0247840_1053458213300028581FreshwaterQFAPVVAFFFMMRCIQFIQTYSGNLSTSFDSSELLAVQALCHQLGSQNALLVQIAWLQISSFAQYSGHEFRWTSLLWI
Ga0315908_1020812613300031786FreshwaterMVFFFMMRMNKRLKKHSGNKSTSFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFR
Ga0315908_1141029323300031786FreshwaterMPLRSKHISPSVLFFFMMRQNKRMKKYSGYTSTLFRSSELLAVQALCHQLGSQNALLLQTARLQVPSLAQHSGHEFRWSPLLGI
Ga0315905_1041360933300032092FreshwaterKPAALYQTELDQFSPAIVFFFMMRMNKRMKKHSGNKSTPFSASELLAVQALCHQLGSQNALLVQIAWLQVSSLA
Ga0315903_1056899613300032116FreshwaterRKKHSGNKSTPFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRWAPMLR
Ga0334989_0155726_384_6023300033984FreshwaterVFFFMMRMNKRMKKHSGNKSTPFSASELLAVQALCHQLGSQNALLLQTARLQVSSLAQHSGHEFRWSPLLGI
Ga0335017_0381927_584_7663300034167FreshwaterMRCIQFIQTYSGNLSTSFDSSELLAVQALCHQLGSQNALLVQIAWLQISSFAQYSGHEFR
Ga0334997_0007198_7607_77983300034280FreshwaterMVFFFMMRMNKRLKKNSGNKSTSFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDE
Ga0335013_0812959_61_2823300034284FreshwaterMVFFFMMRMNKRLKKHSGNKSTPVSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRRAPMLRI
Ga0335048_0132087_825_10463300034356FreshwaterMVFFFMMRMNKRMKKHSGNKSTPFSASELLAVQALCHQLGSQNALLVQIAWLQITNFAQYSGDEFRWAPMLRI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.