NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F078325

Metagenome / Metatranscriptome Family F078325

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078325
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 57 residues
Representative Sequence LQAEMLREFGQTSRALGNSADARLAWREAAESFEDVGAQHEAAEINALLASLPS
Number of Associated Samples 106
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.31 %
% of genes near scaffold ends (potentially truncated) 93.97 %
% of genes from short scaffolds (< 2000 bps) 89.66 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(28.448 % of family members)
Environment Ontology (ENVO) Unclassified
(30.172 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.690 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 87.04%    β-sheet: 0.00%    Coil/Unstructured: 12.96%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF00158Sigma54_activat 53.45
PF02954HTH_8 9.48
PF13424TPR_12 8.62
PF13374TPR_10 0.86
PF00791ZU5 0.86
PF13176TPR_7 0.86
PF00012HSP70 0.86
PF00977His_biosynth 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 0.86


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908044|A5_c1_ConsensusfromContig8516All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium613Open in IMG/M
2170459004|F62QY1Z01A2MC1All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium531Open in IMG/M
3300000881|JGI10215J12807_1046915All Organisms → cellular organisms → Bacteria2045Open in IMG/M
3300000886|AL3A1W_1105174All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300001305|C688J14111_10109988All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium841Open in IMG/M
3300001566|A2135W6_1220048All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium547Open in IMG/M
3300001664|P5cmW16_1006072All Organisms → cellular organisms → Bacteria2279Open in IMG/M
3300004156|Ga0062589_101876096All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300004157|Ga0062590_102912205All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium512Open in IMG/M
3300004463|Ga0063356_103960834All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium637Open in IMG/M
3300005187|Ga0066675_10910952All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium664Open in IMG/M
3300005290|Ga0065712_10193714All Organisms → cellular organisms → Bacteria1137Open in IMG/M
3300005337|Ga0070682_100609300All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300005343|Ga0070687_100969219All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300005406|Ga0070703_10420409All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium586Open in IMG/M
3300005440|Ga0070705_101179466All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300005457|Ga0070662_101971842All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005459|Ga0068867_100325214All Organisms → cellular organisms → Bacteria1275Open in IMG/M
3300005536|Ga0070697_100962172All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300005543|Ga0070672_101242548All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300005546|Ga0070696_101367668All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium603Open in IMG/M
3300005556|Ga0066707_10166777All Organisms → cellular organisms → Bacteria1405Open in IMG/M
3300005561|Ga0066699_10536434All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300005574|Ga0066694_10501708All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005587|Ga0066654_10654527All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005587|Ga0066654_10866174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → Kutzneria albida517Open in IMG/M
3300005903|Ga0075279_10112967All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300006031|Ga0066651_10238983All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300006864|Ga0066797_1161924All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300006881|Ga0068865_101400171All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300006894|Ga0079215_10136097All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300007004|Ga0079218_10051739All Organisms → cellular organisms → Bacteria2556Open in IMG/M
3300007821|Ga0104323_115774All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1353Open in IMG/M
3300009038|Ga0099829_10187475All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1668Open in IMG/M
3300009090|Ga0099827_10336655All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1282Open in IMG/M
3300009137|Ga0066709_100278123All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2260Open in IMG/M
3300009137|Ga0066709_100279733All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2254Open in IMG/M
3300009143|Ga0099792_10907394All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium583Open in IMG/M
3300010159|Ga0099796_10013947All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2309Open in IMG/M
3300010219|Ga0136220_1018024All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium838Open in IMG/M
3300010326|Ga0134065_10263345All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium647Open in IMG/M
3300010396|Ga0134126_12257955All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium593Open in IMG/M
3300010399|Ga0134127_10651266All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1088Open in IMG/M
3300011332|Ga0126317_10434356All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium537Open in IMG/M
3300012003|Ga0120163_1059814All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium898Open in IMG/M
3300012008|Ga0120174_1065564All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium961Open in IMG/M
3300012010|Ga0120118_1026370All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1549Open in IMG/M
3300012201|Ga0137365_10361158All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1073Open in IMG/M
3300012205|Ga0137362_10522173All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1026Open in IMG/M
3300012208|Ga0137376_11267009All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium627Open in IMG/M
3300012210|Ga0137378_10873171All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium812Open in IMG/M
3300012351|Ga0137386_10906557All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium631Open in IMG/M
3300012359|Ga0137385_11622220All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium511Open in IMG/M
3300012469|Ga0150984_110925330All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium772Open in IMG/M
3300012922|Ga0137394_10331529All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1299Open in IMG/M
3300012924|Ga0137413_10108399All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1746Open in IMG/M
3300012955|Ga0164298_11318762All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium554Open in IMG/M
3300012975|Ga0134110_10318154All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium675Open in IMG/M
3300012975|Ga0134110_10534829All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium537Open in IMG/M
3300013100|Ga0157373_10345439All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1061Open in IMG/M
3300013296|Ga0157374_10273279All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1667Open in IMG/M
3300014058|Ga0120149_1138455All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium666Open in IMG/M
3300015192|Ga0167646_1065961All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium804Open in IMG/M
3300015199|Ga0167647_1115093All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium644Open in IMG/M
3300015242|Ga0137412_10135335All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1992Open in IMG/M
3300015245|Ga0137409_10419056All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1156Open in IMG/M
3300018028|Ga0184608_10169208All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium949Open in IMG/M
3300018054|Ga0184621_10081493All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1125Open in IMG/M
3300018071|Ga0184618_10282318All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium705Open in IMG/M
3300018422|Ga0190265_10013905All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae6184Open in IMG/M
3300018429|Ga0190272_11563707All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium674Open in IMG/M
3300018429|Ga0190272_11596037All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium669Open in IMG/M
3300018429|Ga0190272_12434905All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium568Open in IMG/M
3300018431|Ga0066655_10988285All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium581Open in IMG/M
3300018432|Ga0190275_13492472All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium509Open in IMG/M
3300018433|Ga0066667_10022472All Organisms → cellular organisms → Bacteria3387Open in IMG/M
3300019867|Ga0193704_1003923All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2939Open in IMG/M
3300019867|Ga0193704_1091206All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium544Open in IMG/M
3300019877|Ga0193722_1084980All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium773Open in IMG/M
3300019883|Ga0193725_1048078All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1098Open in IMG/M
3300020012|Ga0193732_1014223All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1376Open in IMG/M
3300020027|Ga0193752_1297874All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium565Open in IMG/M
3300020059|Ga0193745_1065706All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium792Open in IMG/M
3300020059|Ga0193745_1073827All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium743Open in IMG/M
3300021363|Ga0193699_10016098All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2699Open in IMG/M
3300021408|Ga0193708_1091026All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium539Open in IMG/M
3300021510|Ga0222621_1066309All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium760Open in IMG/M
3300022756|Ga0222622_10652471All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium762Open in IMG/M
3300025899|Ga0207642_10519571All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium731Open in IMG/M
3300025907|Ga0207645_10366986All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium965Open in IMG/M
3300025918|Ga0207662_10238634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1189Open in IMG/M
3300025939|Ga0207665_10298064All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1204Open in IMG/M
3300026003|Ga0208284_1023543All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium517Open in IMG/M
3300026075|Ga0207708_10762927All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium831Open in IMG/M
3300026343|Ga0209159_1112000All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1168Open in IMG/M
3300026528|Ga0209378_1089504All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1375Open in IMG/M
3300027645|Ga0209117_1030976All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1671Open in IMG/M
3300027667|Ga0209009_1087538All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium789Open in IMG/M
3300027886|Ga0209486_10680493All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium661Open in IMG/M
3300028047|Ga0209526_10705819All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium635Open in IMG/M
3300028715|Ga0307313_10219029All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium591Open in IMG/M
3300028718|Ga0307307_10087626All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium940Open in IMG/M
3300028719|Ga0307301_10048102All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1309Open in IMG/M
3300028799|Ga0307284_10073815All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1240Open in IMG/M
3300028799|Ga0307284_10283887All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium663Open in IMG/M
3300028807|Ga0307305_10247428All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium815Open in IMG/M
3300028807|Ga0307305_10264888All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium784Open in IMG/M
3300028824|Ga0307310_10346249All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium730Open in IMG/M
3300028884|Ga0307308_10439536All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium625Open in IMG/M
3300028884|Ga0307308_10610436All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium523Open in IMG/M
3300028885|Ga0307304_10239664All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium787Open in IMG/M
3300030904|Ga0308198_1026407All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium808Open in IMG/M
3300031093|Ga0308197_10006639All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2009Open in IMG/M
3300031094|Ga0308199_1000929All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2926Open in IMG/M
3300031099|Ga0308181_1003712All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1866Open in IMG/M
3300033412|Ga0310810_10934747All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium755Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil28.45%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.62%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost6.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.17%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.45%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.59%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.59%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.59%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.59%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.72%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.72%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.72%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.72%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.72%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.86%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.86%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.86%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.86%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.86%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.86%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.86%
SoilEngineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2170459004Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2)EnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000886Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001566Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-35cm)- 6 week illuminaEnvironmentalOpen in IMG/M
3300001664Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembledEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005903Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007821Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010219Soil microbial communities from Bangor area, North Wales, UK, before enrichment, after WGAEngineeredOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012003Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25MEnvironmentalOpen in IMG/M
3300012008Permafrost microbial communities from Nunavut, Canada - A39_80cm_12MEnvironmentalOpen in IMG/M
3300012010Permafrost microbial communities from Nunavut, Canada - A7_35cm_12MEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300015192Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface)EnvironmentalOpen in IMG/M
3300015199Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300020012Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1EnvironmentalOpen in IMG/M
3300020027Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021408Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c1EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026003Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030904Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A5_c1_008723402124908044SoilEGLEDRLLQAEMLREFGQTSRALGNSADARLAWREAAESFEDVGAQYEAAEINALLASLP
E4B_020452102170459004Grass SoilLGSFEAEGLEDRLLQAEMLREFGQTSRALGNSADARLAWQEAAESFEDVGARHEAAEINALLASLPT
JGI10215J12807_104691533300000881SoilEFGQTSRALGNSDEARLAWIEAAESFEDVGARHEAAEINALLASLPR*
AL3A1W_110517413300000886PermafrostLEDRLLQAEMLREFGQTSRALGNPDEARLAWKEAAESFEDVGARDEAAEINALLASLPVS
C688J14111_1010998813300001305SoilADARLAWQEAAESFEGVGAQYEAAEINALIASLPA*
A2135W6_122004823300001566PermafrostFGQTSRALGNPDEARLAWREAAESFEDVGARDEAAEIKALIASLPAS*
P5cmW16_100607233300001664PermafrostRIGIFEAEGLEDRLLQAEMLREFGQTSRALGNSADARLAWQEAAESFEDVGARHEAAEINALLASLPT*
Ga0062589_10187609613300004156SoilALGNSADARLAWSEAAESFEDVGAQREAAEINALLASLPS*
Ga0062590_10291220523300004157SoilYDASIATLRIAIFEAESLEDRLLQAELLREFGQTSRALGNSDEARLAWIEAAESFEDVGARHEAAEINALLASLPR*
Ga0063356_10396083413300004463Arabidopsis Thaliana RhizosphereFGQTSRALGNSDEARLAWIEAAESFEDVGARHEAAEINALLASLPR*
Ga0066675_1091095223300005187SoilSIATLRIGIFEAEGLEDRLLQAELLREFGQTSRALGNAADARLAWREAAESFEGVGAQHEAAEIDALLGSLPS*
Ga0065712_1019371423300005290Miscanthus RhizosphereEAEGLEDRLLQAEMLREFGQTSRALGNSADARLAWQEAAESFEDVGARHEAAEINALLASLPT*
Ga0070682_10060930023300005337Corn RhizosphereLLQAELLREFGQTSRALGNSADARLAWSEAAESFEDVGAQHEAAEINALLSSLPS*
Ga0070687_10096921913300005343Switchgrass RhizosphereLREFGQTSRALGNSADARLAWQEAAESFEDVGARHEAAEINALLASLPT*
Ga0070703_1042040913300005406Corn, Switchgrass And Miscanthus RhizosphereDASIATLRIGIFEAEGLEDRLLQAEMLREFGQTSRALGNSADARLAWREAAESFEGVGAQHEAAEINALLSSLPA*
Ga0070705_10117946623300005440Corn, Switchgrass And Miscanthus RhizosphereALGNSADARLAWREAAESFEDVGAQREAAEINALLASLPA*
Ga0070662_10197184213300005457Corn RhizosphereLREFGQTSRALGNSADARLAWSEAAESFEDVGAQHEAAEINALLSSLPS*
Ga0068867_10032521413300005459Miscanthus RhizosphereEMLREFGQTSRALGNSADARLAWREAAESFEGVGAQFEAAEINALIASLPV*
Ga0070697_10096217213300005536Corn, Switchgrass And Miscanthus RhizosphereLLQAEMLREFGQTSRALGNPEEARLAWREAAESFEDVGARHEAAEINALLASLPS*
Ga0070672_10124254813300005543Miscanthus RhizosphereSIATLRIGIFEAEGIEDRLLQAEMLREFGQTSRALGNSEDARLAWKEAAESFEGVGARYEAAEINALIASLPS*
Ga0070696_10136766823300005546Corn, Switchgrass And Miscanthus RhizosphereQTSRALGNAADAQLAWREAAESFEDVGAQHEAAEINALLASLPS*
Ga0066707_1016677723300005556SoilIGIFEAESLEDRLLQAEMLREFGQTSRALGNSADARLAWLEAAESFEDVGAQHEAAEINALLASLPS*
Ga0066699_1053643423300005561SoilIATLRIGIFEAEGLEDPLLQAEMLREFGQTSRALGNSADARLAWREAAESFEDVGAQREAAEINALLASLPA*
Ga0066694_1050170813300005574SoilAESLEDRLLQAEMLREFGQTSRALGNSADARLAWLEAAESFEDVGAQHEAAEINALLASLPS*
Ga0066654_1065452713300005587SoilAEMLREFGQTSRALGNSADARLAWREAAESFEGVGAQHEAAEINALLASLPA*
Ga0066654_1086617413300005587SoilIGIFEAESLEDRLLQAEMLREFGQTCRALGNSADARLAWREAAESFEDVGAQHEAAEINALLASLPN*
Ga0075279_1011296713300005903Rice Paddy SoilAELLREFGQTSRALGNSADARLAWSEAAESFEDVGAQHEAAEINALLSSLPS*
Ga0066651_1023898313300006031SoilTSRALGNSADARLAWREAAESFEGVGAQHEAAEINALLASLPA*
Ga0066797_116192423300006864SoilFEAEGLEDRLLQAEMLREFGQTSRALGNSADARLAWREAAESFDDVGAQHEAAEINALLASLPS*
Ga0068865_10140017113300006881Miscanthus RhizosphereEGIEDRLLQAEMLREFGQTSRALGNSADARLAWREAAESFEGVGAQYEAAEINALIASLPV*
Ga0079215_1013609713300006894Agricultural SoilSIATLRIGIFEAEGLEDKLLQAEMLREFGQTSRALGNSAEARLAWQEAAESFQGVGAVHEAAEIRALLASLPA*
Ga0079218_1005173913300007004Agricultural SoilFEAEGLEDRLLQAEMLREFGQTSRALGNPAEARLAWQEAAESFQGVGAVHEAAEIRALIDSLST*
Ga0104323_11577413300007821SoilFEAEGLEDRLLQAEMLREFGQTSRALGNSADARLAWREAAESFEDVGAQHEAAEINALLASLPS*
Ga0099829_1018747513300009038Vadose Zone SoilIATLRIGIFEAEGREDRLLHAEMLRECGQRSRALGKSADARLAWREAAESFEDVGAQHEAAEINALLASLPS*
Ga0099827_1033665513300009090Vadose Zone SoilEAEGLEDRLLQAEMLREFGQTSRALGNAADAQLAWREAAESFEDVGAQHEAAEINALLASLPS*
Ga0066709_10027812333300009137Grasslands SoilLEDRLLQAEMLREFGQTSRALGNSADARLAWREAAESFEDVGAQHEAAEIKALLASLPS*
Ga0066709_10027973313300009137Grasslands SoilTSRALGNSADARLAWREAAESFEDVGAQHEAAEINALLASLPS*
Ga0099792_1090739423300009143Vadose Zone SoilEDRLLQAEMLREFGQTSRALGNSADARLAWREAAESFEDVGAQHEAAEINALLSSLPS*
Ga0099796_1001394713300010159Vadose Zone SoilGLEDRLLQAEMLREFGQTSRALGNSADARLAWQEAAESFEDVGARHEAAEINALLASLPT
Ga0136220_101802423300010219SoilXEGLEDRLLQAELLREFGQTSRALGNSADARLAWSEAAESFEDVGAQHEAAEINALLSSLPS*
Ga0134065_1026334513300010326Grasslands SoilLLQAEMLREFGQTSRALGNSADARLAWREAAESFEDVGAQREAAEINALLASLPT*
Ga0134126_1225795513300010396Terrestrial SoilMLREFGQTSRALGTPADARLAWREAAESFEGVGAQYEAAEINALIASLPV*
Ga0134127_1065126613300010399Terrestrial SoilIFEAEGIEDRLLQAEMLREFGQTSRALGNSADARLAWREAAESFEGVGAQYEAAEINALIASLPV*
Ga0126317_1043435623300011332SoilEDRLLQAEMLREFGQTSRALGNSADARLAWREAAESFEGVGAQYEAAEINALIASLPA*
Ga0120163_105981413300012003PermafrostGNPDEARLAWKEAAESFEDVGARHEATEINALLASLPVS*
Ga0120174_106556423300012008PermafrostVTGDQPLRIAIFEAEGLEDRLLQAEMLREFGQTSRALGNADEARLAWREAAESFEDVGARHEAAEINALLASLPS*
Ga0120118_102637013300012010PermafrostMLREFGQTSRALGNSNEARLAWREAAESFEDVGARNEAAEINALLASLPS*
Ga0137365_1036115813300012201Vadose Zone SoilRIGIFEAESLEDRLLQAEMLREFGQTSRALGNSADARLAWLEAAESFEDVGAQHEAAEINALLASLPS*
Ga0137362_1052217323300012205Vadose Zone SoilGLEDRLLQAEMLREFGQTSRALGNSADARLAWREAAESFEDVGAQHEAAEINALLSSLPS
Ga0137376_1126700913300012208Vadose Zone SoilDRLLQAELLREFGQTSRALGNSADARLAWQEAAESFEGVGAQHEAAEINALLGSLPA*
Ga0137378_1087317123300012210Vadose Zone SoilAEMLREFGQTSRALGNSADARLAWLEAAESFEDVGAQHEAAEINALLASLPS*
Ga0137386_1090655723300012351Vadose Zone SoilGQTCRALGNSADARLAWREAAESFEDVGAQHEAAEINALLASLPS*
Ga0137385_1162222023300012359Vadose Zone SoilLQAEMLREFGQTSRALGNSADARLAWLEAAESFEDVGAQHEAAEINALLASLPS*
Ga0150984_11092533013300012469Avena Fatua RhizosphereEDRLLQAEMLREFGQTSRALGNAADARLAWREAAESFEDVGAQHEAAEINALLASLPG*
Ga0137394_1033152913300012922Vadose Zone SoilREFGQTSRALGNAADAQLAWREAAESFEDVGAQHEAAEINALLASLPS*
Ga0137413_1010839913300012924Vadose Zone SoilLRIGIFEAEGLEDRLLQAEMLREFGQTSRALGNSADARLAWQEAAESFEDVGARHEAAEINALLASLPT*
Ga0164298_1131876223300012955SoilEGLEDRLLQAEMLREFGQTSRALGNPSEARLAWREAAESFEDVGARHEAAEINALLASLPS*
Ga0134110_1031815423300012975Grasslands SoilLGNSADARLAWQEAAESFEGVGAQHEAAEINALLGSLPA*
Ga0134110_1053482913300012975Grasslands SoilSIATLRIGIFEAESLEDRLLQAEMLREFGQTCRALGNSADARLAWREAAESFEDVGAQHEAAEINALLASLPN*
Ga0157373_1034543923300013100Corn RhizosphereDRLLQAELLREFGQTSRALGNSADARLAWSEAAESFEDVGAQHEAAEINALLSSLPS*
Ga0157374_1027327933300013296Miscanthus RhizosphereQAEMLREFGQTSRALGNSADARLAWQEAAESFEDVGARHEAAEINALLASLPT*
Ga0120149_113845523300014058PermafrostAEGLEDRLLQAEMLREFGQTSRALGNSADARLAWREAAESFEDVGAQHEAAEINALLASLPS*
Ga0167646_106596113300015192Glacier Forefield SoilLQAEMLREFGQTSRALGNSADARLAWREAAESFEDVGAQHEAAEINALLASLPS*
Ga0167647_111509313300015199Glacier Forefield SoilREFGQTSRALGNSADARLAWREAAESFEDVGAQHEAAEINALLASLPS*
Ga0137412_1013533513300015242Vadose Zone SoilMLREFGQTSRALGNSADARLAWQEAAESFEDVGARHEAAEINALLASLPT*
Ga0137409_1041905623300015245Vadose Zone SoilLREFGQTSRALGNSADARLAWREAAESFEDVGAQHEAAEINALLSSLPS*
Ga0184608_1016920813300018028Groundwater SedimentAVGNPDEARLAWREAAESFEDVGARHEAAEINALLASLPN
Ga0184621_1008149333300018054Groundwater SedimentLLQAEMLREFGQTSRALGNPDEARLAWREAAESFEDVGARHEAAEIKALLANLPT
Ga0184618_1028231823300018071Groundwater SedimentEEARLAWREAAESFEDVGARHEAAEINALLASLPT
Ga0190265_1001390553300018422SoilATLRIAIFEAEGLEDRLLQAEMLREFGQTSQALGQFPEARLAWKEAAESFQGVGALHEAAQINTLLASLPG
Ga0190272_1156370713300018429SoilLQAELLREFGQTSRALGNSDEARLAWREAAESFEDVGARHEAAEINALLASLPR
Ga0190272_1159603723300018429SoilQAEMLREFGQTSRAVGHSADARLDWQEAAESFQGVGAIHEAAEIHTLLASLPS
Ga0190272_1243490513300018429SoilMLREFGQTSRALGNSAEARLAWQDAAESFQGVGAVHEAAEIHALLASLPI
Ga0066655_1098828523300018431Grasslands SoilSRALGNSADARLAWQEAAESFEGVGAQYEAAEINALIASLPA
Ga0190275_1349247213300018432SoilQAELLREFGQTARALGNSADARLAWQEAAESFQGVGAVYEAAEIHALLASLPA
Ga0066667_1002247213300018433Grasslands SoilEDRLLQAEMLREFGQTSRALGNSVDARLAWLEAAESFEDVGAQHEAAEINALLASLPS
Ga0193704_100392343300019867SoilLREFGQTSRALGNPDEARLAWREAAESFEDVGARHEAAEINALLASLPN
Ga0193704_109120623300019867SoilLREFGQTSRALGNPDEARLAWREAAESFEDVGARHEAAEIKALLANLPT
Ga0193722_108498023300019877SoilFEAEGLEDRLLQAEMLREFGQTSRALGNPEEARLAWREAAESFEDVGARHEAAEINALLASLPS
Ga0193725_104807823300019883SoilSIATLRIAIFEAEGLEDRLLQAEMLREFGQTSRALGNPEEARLAWREAAESFEDVGARHEAAEINALLASLPS
Ga0193732_101422313300020012SoilFEAEGLEDRLLQAEMLREFGQTSRALGNPDEARLAWREAAESFEDVGARHEAAEIKALLANLPT
Ga0193752_129787413300020027SoilQAEMLREFGQTSHALGNPNEARLAWREAAESFEDVGARHEAAEINALLASLPS
Ga0193745_106570613300020059SoilSRALGNSAEARLAWIEAAESFEGVGARHEAAEIALLLGSLPAN
Ga0193745_107382713300020059SoilAEGLEDRLLQAEMLREFGQTSRALGNPEEARLAWREAAESFEDVGARHEAAEINALLASLPS
Ga0193699_1001609843300021363SoilAYDASIATLRIAIFEAEGLEDRLLQAEMLREFGQTSRALGNPNEARLAWREAAESFEDVGARHEAAEINALLGSLPS
Ga0193708_109102613300021408SoilLEDRLLQAEMLREFGQTSRALGNSSDARLAWVEAAESFEDVGAQHEAAEINALIASLPS
Ga0222621_106630923300021510Groundwater SedimentGLEDRLLQAEMLREFGQTSRALGNPDEARLAWREAAESFEDVGARHEAAEIKALLANLPT
Ga0222622_1065247113300022756Groundwater SedimentIATLRIAIFEAEGLEDRLLQAEMLREFGQTSRALGNPEEARLAWREAAESFEDVGARHEAAEINALLASLPS
Ga0207642_1051957123300025899Miscanthus RhizosphereGLEDRLLQAEMLREFGQTSKALGNSADARLAWSEAAESFEDVGAQREAAEINALLASLPT
Ga0207645_1036698613300025907Miscanthus RhizosphereIFEAESLEDRLLQAELLREFGQTSRALGNSDEARLAWIEAAESFEDVGARHEAAEINALLASLPR
Ga0207662_1023863423300025918Switchgrass RhizosphereMLREFGQTSRALGNSADARLAWQEAAESFEDVGARHEAAEINALLASLPT
Ga0207665_1029806423300025939Corn, Switchgrass And Miscanthus RhizosphereLLQAEMLREFGQTSRALGNSADARLAWREAAESFEGVGAQHEAAEINALLASLPS
Ga0208284_102354323300026003Rice Paddy SoilQTSRELGNSADARLAWREAAESFEDVGARHEAAEINSLLSSLPS
Ga0207708_1076292723300026075Corn, Switchgrass And Miscanthus RhizosphereLREFGQTSRALGNSADARLAWREAAESFEGVGAQFEAAEINALIASLPV
Ga0209159_111200023300026343SoilLQAEMLREFGQTSRALGNSADARLAWLEAAESFEDVGAQHEAAEINALLASLPS
Ga0209378_108950423300026528SoilEDRLLQAEMLREFGQTSRALGNSADARLAWLEAAESFEDVGAQHEAAEINALLASLPS
Ga0209117_103097633300027645Forest SoilATLRIAIFEAEGLEDRLLQAEMLREFGQTSRALGNPDEARLAWREAAESFEDVGARDEAAEINALLASLPS
Ga0209009_108753823300027667Forest SoilNPDEARLAWREAAESFEDVGARNEAAEINALLASLPTS
Ga0209486_1068049323300027886Agricultural SoilFEAEGLEDRLLQAEMLREFGQTSRALGNPAEARLAWQEAAESFQGVGAVHEAAEIRALIDSLST
Ga0209526_1070581923300028047Forest SoilLGNSADARLAWREAAESFEDVGAQHEAAEINALLASLPS
Ga0307313_1021902923300028715SoilGLEDRLLQAEMLREFGQTSRALGNPEEARLAWREAAESFEDVGARHEAAEINALLASLPS
Ga0307307_1008762613300028718SoilTLRIAIFEAEGLEDRLLQAEMMREFGQASRALGNSEEARLAWQEAADSFDEVGAPHEAAEINALLASLPS
Ga0307301_1004810223300028719SoilREFGQTSRALGNPDEARLAWREAAESFEDVGARHEAAEINALLASLPN
Ga0307284_1007381513300028799SoilFGQASRALGNSEEARLAWQEAADSFDEVGAPHEAAEINALLASLPS
Ga0307284_1028388713300028799SoilFEAEGLEDRLLQAEMLREFGQTSRALGNPNEARLAWREAAESFEDVGARDEAAEINALIDSLPAT
Ga0307305_1024742823300028807SoilMLREFGQTSRALGNSADARLAWREAAESFEDVGAQHEAAEINALLASLPS
Ga0307305_1026488813300028807SoilQAEMLREFGQTSRALGNPEEARLAWREAAESFEDVGARHEAAEINALLASLPS
Ga0307310_1034624913300028824SoilAIFEAEGLEDRLLQAEMLREFGQTSRALGNPNEARLAWREAAESFEDVGARDEAAEINALIDSLPAT
Ga0307308_1043953613300028884SoilGNSADARLAWREAAESFEDVGAQHEAAEINALLASLPS
Ga0307308_1061043613300028884SoilDASIATLRIAIFEAEGLEDRLLQAEMLREFGQTSRALGNPDEARLAWREAAESFEDVGARHEAAEINALLASLPS
Ga0307304_1023966413300028885SoilREFGQTSRALGNPDEARLAWHEAAESFEDVGARHEAAEINALLASLPS
Ga0308198_102640713300030904SoilATLRIAIFEAEGLEDRLLQAEMLREFGQSSRALGNPDEARLAWREAAESFEDVGARHEAAEIKALLANLPT
Ga0308197_1000663923300031093SoilYDASIATLRIAIFEAEGLEDRLLQAEMLREFGQTSRALGNPDEARLAWREAAESFEDVGARHEAAEIKALLANLPT
Ga0308199_100092913300031094SoilASIATLRIAIFEAEGLEDRLLQAEMLREFGQTSRAVGNPDEARLAWHEAAESFEDVGARHEAAEINALLASLPS
Ga0308181_100371213300031099SoilPDEARLAWREAAESFEDVGARHEAAEIKALLANLPT
Ga0310810_1093474713300033412SoilALGNSADARLAWSEAAESFEDVGAQHEAAEINALLSSLPS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.