Basic Information | |
---|---|
Family ID | F075472 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 119 |
Average Sequence Length | 41 residues |
Representative Sequence | MSAAARLSLVDRADPALSIVAQCRLLKVARSTLYHRPA |
Number of Associated Samples | 112 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 83.19 % |
% of genes near scaffold ends (potentially truncated) | 89.08 % |
% of genes from short scaffolds (< 2000 bps) | 98.32 % |
Associated GOLD sequencing projects | 108 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.319 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog (9.244 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.731 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.815 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.36% β-sheet: 0.00% Coil/Unstructured: 63.64% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF01527 | HTH_Tnp_1 | 44.54 |
PF13518 | HTH_28 | 3.36 |
PF13683 | rve_3 | 2.52 |
PF13005 | zf-IS66 | 1.68 |
PF10551 | MULE | 1.68 |
PF13276 | HTH_21 | 1.68 |
PF13551 | HTH_29 | 0.84 |
PF13340 | DUF4096 | 0.84 |
PF03050 | DDE_Tnp_IS66 | 0.84 |
PF01594 | AI-2E_transport | 0.84 |
PF01165 | Ribosomal_S21 | 0.84 |
PF01609 | DDE_Tnp_1 | 0.84 |
PF00665 | rve | 0.84 |
PF03450 | CO_deh_flav_C | 0.84 |
PF00872 | Transposase_mut | 0.84 |
PF03235 | DUF262 | 0.84 |
PF13817 | DDE_Tnp_IS66_C | 0.84 |
PF07592 | DDE_Tnp_ISAZ013 | 0.84 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.84 |
COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.84 |
COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.84 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.84 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.84 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.84 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.84 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.84 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.84 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.84 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.84 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.32 % |
Unclassified | root | N/A | 1.68 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459006|GBPF9FW01DR7AJ | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300000313|WSSedB1CaDRAFT_10032368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1028 | Open in IMG/M |
3300001356|JGI12269J14319_10370665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
3300001408|JGI20206J14855_1059528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 544 | Open in IMG/M |
3300001412|JGI20173J14856_1048146 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300001566|A2135W6_1113824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
3300004092|Ga0062389_104959039 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300005335|Ga0070666_10125740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1780 | Open in IMG/M |
3300005457|Ga0070662_101900689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
3300005583|Ga0049085_10181969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 702 | Open in IMG/M |
3300005610|Ga0070763_10770164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Asticcacaulis → Asticcacaulis benevestitus | 567 | Open in IMG/M |
3300005834|Ga0068851_10059876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1948 | Open in IMG/M |
3300006052|Ga0075029_100285137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1051 | Open in IMG/M |
3300006059|Ga0075017_101446642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
3300006102|Ga0075015_100415297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 762 | Open in IMG/M |
3300006162|Ga0075030_101159094 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300006172|Ga0075018_10756649 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300006175|Ga0070712_101531000 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300006581|Ga0074048_12723710 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300006893|Ga0073928_10433064 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300009500|Ga0116229_11190062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 608 | Open in IMG/M |
3300009500|Ga0116229_11393559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 556 | Open in IMG/M |
3300009698|Ga0116216_10737401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 591 | Open in IMG/M |
3300009700|Ga0116217_10937594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 530 | Open in IMG/M |
3300010341|Ga0074045_10789753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 601 | Open in IMG/M |
3300010357|Ga0116249_10932678 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300010396|Ga0134126_12898484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 519 | Open in IMG/M |
3300010860|Ga0126351_1228420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 587 | Open in IMG/M |
3300010876|Ga0126361_10196880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 587 | Open in IMG/M |
3300010877|Ga0126356_10677177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 540 | Open in IMG/M |
3300010880|Ga0126350_12429450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 538 | Open in IMG/M |
3300012212|Ga0150985_109907383 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300012404|Ga0134024_1111922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 517 | Open in IMG/M |
3300012924|Ga0137413_11342457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 575 | Open in IMG/M |
3300012984|Ga0164309_10961376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 701 | Open in IMG/M |
3300014325|Ga0163163_12725922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 551 | Open in IMG/M |
3300014487|Ga0182000_10280602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 684 | Open in IMG/M |
3300014499|Ga0182012_10426601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 871 | Open in IMG/M |
3300014654|Ga0181525_10779006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 539 | Open in IMG/M |
3300016270|Ga0182036_11512365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 564 | Open in IMG/M |
3300017946|Ga0187879_10666611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 579 | Open in IMG/M |
3300018019|Ga0187874_10328701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 620 | Open in IMG/M |
3300018034|Ga0187863_10162159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1247 | Open in IMG/M |
3300018034|Ga0187863_10843946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 520 | Open in IMG/M |
3300018042|Ga0187871_10814007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 521 | Open in IMG/M |
3300018043|Ga0187887_10627064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 635 | Open in IMG/M |
3300018043|Ga0187887_10960715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
3300018046|Ga0187851_10449483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 734 | Open in IMG/M |
3300018046|Ga0187851_10693101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 574 | Open in IMG/M |
3300018047|Ga0187859_10759582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 554 | Open in IMG/M |
3300018057|Ga0187858_10753306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 579 | Open in IMG/M |
3300018062|Ga0187784_11063488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 643 | Open in IMG/M |
3300019888|Ga0193751_1142003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 871 | Open in IMG/M |
3300020005|Ga0193697_1049095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Asticcacaulis | 1050 | Open in IMG/M |
3300021388|Ga0213875_10587067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 538 | Open in IMG/M |
3300021405|Ga0210387_11894657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
3300022557|Ga0212123_10859592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 538 | Open in IMG/M |
3300024347|Ga0179591_1041383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3198 | Open in IMG/M |
3300025414|Ga0208935_1037094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 648 | Open in IMG/M |
3300025505|Ga0207929_1101755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
3300025903|Ga0207680_10417833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → unclassified Roseomonas → Roseomonas sp. B5 | 949 | Open in IMG/M |
3300026058|Ga0208421_1024812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Rhizorhabdus → Rhizorhabdus wittichii | 552 | Open in IMG/M |
3300026075|Ga0207708_10293319 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
3300027535|Ga0209734_1040977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 870 | Open in IMG/M |
3300027552|Ga0209982_1008834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1483 | Open in IMG/M |
3300027807|Ga0209208_10507478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 562 | Open in IMG/M |
3300027819|Ga0209514_10362955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 637 | Open in IMG/M |
3300027824|Ga0209040_10500387 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300027825|Ga0209039_10429457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 501 | Open in IMG/M |
3300027862|Ga0209701_10576733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 600 | Open in IMG/M |
3300027911|Ga0209698_10523895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 916 | Open in IMG/M |
3300028138|Ga0247684_1064665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Rhizorhabdus → Rhizorhabdus wittichii | 597 | Open in IMG/M |
3300028178|Ga0265593_1023676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1918 | Open in IMG/M |
3300028560|Ga0302144_10231522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 598 | Open in IMG/M |
3300028652|Ga0302166_10179478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
3300028704|Ga0307321_1130890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 525 | Open in IMG/M |
3300028712|Ga0307285_10218326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 537 | Open in IMG/M |
3300028780|Ga0302225_10348389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 699 | Open in IMG/M |
3300028791|Ga0307290_10332884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 556 | Open in IMG/M |
3300028877|Ga0302235_10512116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 509 | Open in IMG/M |
3300029913|Ga0311362_11235170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 552 | Open in IMG/M |
3300029915|Ga0311358_10766206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 697 | Open in IMG/M |
3300029915|Ga0311358_10961981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 592 | Open in IMG/M |
3300029917|Ga0311326_10483595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 606 | Open in IMG/M |
3300029922|Ga0311363_11199850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 640 | Open in IMG/M |
3300029944|Ga0311352_11493285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 506 | Open in IMG/M |
3300029951|Ga0311371_11781013 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
3300029954|Ga0311331_11371565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 584 | Open in IMG/M |
3300029982|Ga0302277_1064965 | Not Available | 1699 | Open in IMG/M |
3300029987|Ga0311334_11118889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 658 | Open in IMG/M |
3300029999|Ga0311339_11524725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 594 | Open in IMG/M |
3300030002|Ga0311350_10248991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1583 | Open in IMG/M |
3300030011|Ga0302270_10088826 | Not Available | 1982 | Open in IMG/M |
3300030020|Ga0311344_11425871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 506 | Open in IMG/M |
3300030020|Ga0311344_11437843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 503 | Open in IMG/M |
3300030053|Ga0302177_10635023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 543 | Open in IMG/M |
3300030399|Ga0311353_10957293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 720 | Open in IMG/M |
3300030503|Ga0311370_12428093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 506 | Open in IMG/M |
3300030586|Ga0265393_1205842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 522 | Open in IMG/M |
3300030617|Ga0311356_11287888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 669 | Open in IMG/M |
3300030618|Ga0311354_11670531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 558 | Open in IMG/M |
3300030743|Ga0265461_13957879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 504 | Open in IMG/M |
3300030872|Ga0265723_1016875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 592 | Open in IMG/M |
3300031057|Ga0170834_106041984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 971 | Open in IMG/M |
3300031231|Ga0170824_105910256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
3300031231|Ga0170824_126069749 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300031242|Ga0265329_10235525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 608 | Open in IMG/M |
3300031470|Ga0272432_1230065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
3300031474|Ga0170818_113060995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
3300031680|Ga0318574_10849188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 535 | Open in IMG/M |
3300031722|Ga0311351_10879655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 684 | Open in IMG/M |
3300031726|Ga0302321_100106680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2814 | Open in IMG/M |
3300031788|Ga0302319_10503906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1299 | Open in IMG/M |
3300032060|Ga0318505_10576398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 529 | Open in IMG/M |
3300032756|Ga0315742_10682075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 931 | Open in IMG/M |
3300032895|Ga0335074_11074899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 697 | Open in IMG/M |
3300033486|Ga0316624_10426744 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300034061|Ga0334987_0119696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1986 | Open in IMG/M |
3300034111|Ga0335063_0602221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 517 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 9.24% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 9.24% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.88% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.04% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 5.04% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.20% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 3.36% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.52% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.52% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.52% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.52% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 2.52% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.68% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.68% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.68% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.84% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.84% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.84% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.84% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.84% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.84% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.84% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.84% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.84% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.84% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.84% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.84% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.84% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.84% |
Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.84% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.84% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.84% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.84% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
3300000313 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Cattail | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001408 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 | Environmental | Open in IMG/M |
3300001412 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300001566 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-35cm)- 6 week illumina | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010357 | AD_USSTca | Engineered | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026058 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027807 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes) | Host-Associated | Open in IMG/M |
3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030586 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300030872 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
3300031470 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley nord | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
L01_00713460 | 2170459006 | Grass Soil | MSRPERLALVDHDDQAMPIVAQCQLLKVARSTLYYRPA |
WSSedB1CaDRAFT_100323683 | 3300000313 | Wetland | MSAAARRTLVDRDDPALPVAAQCRLPKIAHSTLYY* |
JGI12269J14319_103706652 | 3300001356 | Peatlands Soil | MSPGTRRSLVDRADPVLSIVAQCQLLKVARSTLYYRPAAGS |
JGI20206J14855_10595281 | 3300001408 | Arctic Peat Soil | MSGAARLALVERADGALSIVAQCRMLRVARSTLYWRPAPVRADDLDLM |
JGI20173J14856_10481462 | 3300001412 | Arctic Peat Soil | MNRSERLALVDHDDPVLPIVAQCRLLKVARSTLYYRPVPMSGDDLA |
A2135W6_11138241 | 3300001566 | Permafrost | MNQVVRLSLVDRADAELSIVAQCRLLKVARSSLYWRSATVSEDDLR |
Ga0062389_1049590392 | 3300004092 | Bog Forest Soil | MSGAARLALVDRADAALSIVAQCRMLRVARSTLYWRPAPVSAND |
Ga0070666_101257401 | 3300005335 | Switchgrass Rhizosphere | MSAVARRALVDRSDPHVSVAAQCRLLRVARSTLYYRSAAVSEG |
Ga0070662_1019006891 | 3300005457 | Corn Rhizosphere | MSRIARLSLVDRAEVGLSIAAQCRLLKIARSTLYWRAVPVSEDDLRLM |
Ga0049085_101819691 | 3300005583 | Freshwater Lentic | MKSAARLALVDRADADLSIVAQCRLLRVARSTLYWRPAPV |
Ga0070763_107701641 | 3300005610 | Soil | LFLEKVWCLSLSARLSLVERSEPDLPIAAQCRLLKVARSTLY |
Ga0068851_100598763 | 3300005834 | Corn Rhizosphere | MSALARRALVDRSDPHVSVAAQCRLLRVARSTLYYRPAAV |
Ga0075029_1002851373 | 3300006052 | Watersheds | MNRAERLALVDHDDPVLPVTAQCRLLKVARSTLYYQP |
Ga0075017_1014466421 | 3300006059 | Watersheds | MNQVTRLSLVDRADADLSIVAQCRPLKLARSSLYWH |
Ga0075015_1004152972 | 3300006102 | Watersheds | MSRPERLALVDHDDPLMALVTQCQLLKVARSTLYYRPVPVSANDRR* |
Ga0075030_1011590941 | 3300006162 | Watersheds | MKRGERLALVDHDDPVLPVAAQCRLLKVARSTLYYQP |
Ga0075018_107566492 | 3300006172 | Watersheds | MSRPERLALVDPDDQVVPVVAQCRLLKVARSSLYYR |
Ga0070712_1015310001 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPAVRRALVDRDDPALPVAVQCRLLKVARSTLYYRP |
Ga0074048_127237102 | 3300006581 | Soil | MNRAERLALVDHDDPALPVSAQCRLLRVARSTLYYQ |
Ga0073928_104330641 | 3300006893 | Iron-Sulfur Acid Spring | MNQITRLSLVDRSDADLSIVAQCRLLKVARSTLYYRAAAVSADDLRLMRW |
Ga0116229_111900622 | 3300009500 | Host-Associated | MSGAARLALVDRADGALSLVAQCRMLRVARSTLYWRPAAASAGDLDLMHRLDVQY |
Ga0116229_113935592 | 3300009500 | Host-Associated | MSSPARLALVDAAEPGLSIVAQCRLLKVARSTLYYRPASENA |
Ga0116216_107374012 | 3300009698 | Peatlands Soil | MKAAERRAIVDHNDPVLPIVAQCRLLKIARSTLYYRPV |
Ga0116217_109375942 | 3300009700 | Peatlands Soil | MSAPDRRTLVDRDDPVLAIVAQCRLLKIARSTLYYR |
Ga0074045_107897531 | 3300010341 | Bog Forest Soil | MSSAARLSLVDRADPAFSIVAQCQLLKVARSTLYYRP |
Ga0116249_109326783 | 3300010357 | Anaerobic Digestor Sludge | MSRAARLALVDRDDPAMPVAAQCRLLKVARSTLYHQPCPVSDDDLAV |
Ga0134126_128984841 | 3300010396 | Terrestrial Soil | MNQITRLSLVERPDADLSIVAQCRLLKVARSTLYHRAAP |
Ga0126351_12284202 | 3300010860 | Boreal Forest Soil | MNRPERLALVDHDDPALPVVAQCRLLKVARSTLYYQ |
Ga0126361_101968803 | 3300010876 | Boreal Forest Soil | MNRPDRLALVDHDDPALPVVAQCRLLKVARSTLYYQPV |
Ga0126356_106771773 | 3300010877 | Boreal Forest Soil | MSLGERRALVERDDPDLSVAAQCRLLNVARSTLYYQPGPMN |
Ga0126350_124294502 | 3300010880 | Boreal Forest Soil | MTRPERLALVDHGDPALPVVAQCRLLKVARSTLYYQ |
Ga0150985_1099073832 | 3300012212 | Avena Fatua Rhizosphere | MSAAQRLALVDRADSALSVAAQCRLLKVARSTLYYQ |
Ga0134024_11119221 | 3300012404 | Grasslands Soil | MSPAQRLALVERDDAALSVAAQCRLLKLARSTLYYQP |
Ga0137413_113424571 | 3300012924 | Vadose Zone Soil | MSRPERLALVDHDDQVLPVVAQCRLLKVARSTLYYRPAPVSMDD |
Ga0164309_109613763 | 3300012984 | Soil | MSRSDRLALVDHGDRVVPVVAQCRLLKVTRSSLYYRPAPVS |
Ga0163163_127259222 | 3300014325 | Switchgrass Rhizosphere | MNQITRLSLVDRSDADLSIVAQCRLLKVARSTLYY |
Ga0182000_102806022 | 3300014487 | Soil | MSAVERRALVDRSDPHVSVAAQCRLLRVARSTLYYRPAAVSED |
Ga0182012_104266013 | 3300014499 | Bog | MSAAARLALVDRADTALSIVAQCRMLRVARSTLYAS |
Ga0181525_107790061 | 3300014654 | Bog | MSSPARLALVDAAEPALSIVAQCRLLKVARSTLYYRPAS |
Ga0182036_115123652 | 3300016270 | Soil | MSAVERRGLVDNADQALSVVAQCRLLKIARSTLYYRPVP |
Ga0187879_106666112 | 3300017946 | Peatland | MSAPERRALVDRDDPVLPVVAQCRLLKIARSTLYY |
Ga0187874_103287013 | 3300018019 | Peatland | MNRAARLALVDHDDPVLPIAAQCRLLQVARSTLYYQPVPASAD |
Ga0187863_101621591 | 3300018034 | Peatland | MNRRERLALVDQDDPVLTVSAQCRLLEVARSTLYHRPVPASPDD |
Ga0187863_108439461 | 3300018034 | Peatland | MSSAARLGLVDPSEPALSIVAQCRLLQVARSTLYYRAMPVSAED |
Ga0187871_108140072 | 3300018042 | Peatland | MNRAERLARVDHEDPVLAIAAQCRLLKVARSTLYYQPVPAGAGP |
Ga0187887_106270643 | 3300018043 | Peatland | MSLPERRAMVDPDDPVLPIVAQCRLLKIARSTLYY |
Ga0187887_109607152 | 3300018043 | Peatland | VRLSLVDRSEPDLPIAAQCRLLKVARSTLYYRPLPVSVDDLRL |
Ga0187851_104494831 | 3300018046 | Peatland | MNRLERLALVDHDDPVLPVVVQCRLLKVARSTLYYRPVPVSADDLAVMRR |
Ga0187851_106931011 | 3300018046 | Peatland | MSAVARLSLVDRADPVLSIAAQCRLLKVARSTLYY |
Ga0187859_107595822 | 3300018047 | Peatland | MSRSERLALVDHDDAALPVVTQCRLLKVARSTLYY |
Ga0187858_107533061 | 3300018057 | Peatland | MNRAERLALVDHDDQVLPVTAQCRLLKVARSTLYYQPVPAGYYQPVPAGADELVVMRRIDEL |
Ga0187784_110634882 | 3300018062 | Tropical Peatland | MSAPDRRALVDPDDPVLPIVAQCRLLKIARSTLYY |
Ga0193751_11420031 | 3300019888 | Soil | MNRSERLALVGDDDPTLPVVAQCRLLKIARSTLYYRPVPVS |
Ga0193697_10490952 | 3300020005 | Soil | MSRSDRLALVDHGDRVVPVVAQCRLLKVTRSSLYYRPAPVSADDLCGDAADG |
Ga0213875_105870672 | 3300021388 | Plant Roots | MSRSDRQALIDRADSQLSIARQCQLLKVARSTLYYRP |
Ga0210387_118946571 | 3300021405 | Soil | MSPVERLALVDRDDPDLPIAAQCRLLKVARSTLYYQPAPM |
Ga0212123_108595922 | 3300022557 | Iron-Sulfur Acid Spring | MNQITRLSLVDRSDADLSIVAQCRLLKVARSTLYYRAAAVSADDLRLMRWL |
Ga0179591_10413835 | 3300024347 | Vadose Zone Soil | MNQVARLSLVDRGDVDLSIVAQCRLLKVARSSLYLAFGSGE |
Ga0208935_10370943 | 3300025414 | Peatland | MNRAERLALVDHDDPVLQVTAQCRLLKVARSTLYYQ |
Ga0207929_11017552 | 3300025505 | Arctic Peat Soil | MNQMTRLSLVDRADTDLSIVAQCRLLKVARSTLYYRAAPV |
Ga0207680_104178331 | 3300025903 | Switchgrass Rhizosphere | MSALARRALVDRSDPHVSVAAQCRLLRVARSTLYYRSAAVSEG |
Ga0208421_10248122 | 3300026058 | Natural And Restored Wetlands | MSRIARLSLVDRAEVGLSIAAQCRLLKIARSTLYWRAVPVSEDDLRLMRRI |
Ga0207708_102933191 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAVARRALVDRSDPHVSVAAQCRLLRVARSTLYYRPAAVSEG |
Ga0209734_10409773 | 3300027535 | Forest Soil | MNRPDRLALVDHDDPALPIIAQCRLLKVARSTLYYQPVPARWTIW |
Ga0209982_10088341 | 3300027552 | Arabidopsis Thaliana Rhizosphere | PERQALIDGEAAMPITRQCQLLGVARSTLYYQPQG |
Ga0209208_105074782 | 3300027807 | Host-Associated | MSAPARRALVDAAAPALSIVSQCRLLKVARSTLYYRPAAVS |
Ga0209514_103629552 | 3300027819 | Groundwater | MNRPERLALVDHDDPALPVVAQCRLLKIARSTLYYRPVPVSS |
Ga0209040_105003872 | 3300027824 | Bog Forest Soil | MNQFARLSLVDRADADLSIVAQCRLLKVARSSLYWRPA |
Ga0209039_104294571 | 3300027825 | Bog Forest Soil | MNQTARLSLVDRAERELSITAQCQLLKLARSTLYYRPSPVSA |
Ga0209701_105767331 | 3300027862 | Vadose Zone Soil | MSRPERLTLVDHDDQAVPVVAQCRLLKVARSTLYYRQAPVSMD |
Ga0209698_105238951 | 3300027911 | Watersheds | MNRRERLPQVDHGDPLLPVAAQCRLLRVARSTLYH |
Ga0247684_10646652 | 3300028138 | Soil | MSRIARLSLVDRAEVGLSIAAQCRLLKIARSTLYWRAVPVSEDDLRLMRR |
Ga0265593_10236762 | 3300028178 | Saline Water | MSRAVRLGLVDRDDPAMAVAAQCRLLKVARSTLYHQSCPVSDDDLAVGCDSTLWGVL |
Ga0302144_102315221 | 3300028560 | Bog | MSAPERRALVDRDDPVLPVVAQCRLLKIARSTLYYLPAAVDPDDL |
Ga0302166_101794781 | 3300028652 | Fen | MTQSERLALVDRDDPDVPVVNQCRLLKIARSTLYYRPVPVSSD |
Ga0307321_11308902 | 3300028704 | Soil | MSRPERLALVDPDDQAMPVVAQCQLLKVARSTLYYRPAP |
Ga0307285_102183263 | 3300028712 | Soil | MKPSERVGLVDHADPVLPVVAQCQLLKVARSTVYYRP |
Ga0302225_103483892 | 3300028780 | Palsa | MNRVERLALVDHDDAVLSIRAQCHLLRVARSTLYYQPVLSSP |
Ga0307290_103328842 | 3300028791 | Soil | MSRGERLALVDRADAALSSVEQCLLLKVARSTLYYQPAPVSA |
Ga0302235_105121161 | 3300028877 | Palsa | MSPDTRRSQVDRAEAVLSIVAQCRLLKVVRSTLYY |
Ga0311362_112351701 | 3300029913 | Bog | MSAVVRLSLVDRADPDMSIVEQCRLLKVSRSTLYY |
Ga0311358_107662061 | 3300029915 | Bog | MNQAERLSLVDRADDQMSIVTQCRLLRVARSTLYYRPVA |
Ga0311358_109619813 | 3300029915 | Bog | MNQVARLSQVDRGDAELSVVVQCRLLKVARSSLYWRPAAVSEDDLRL |
Ga0311326_104835952 | 3300029917 | Bog | MSAAARLSLVDRADPALSIVAQCRLLKVARSTLYHRP |
Ga0311363_111998501 | 3300029922 | Fen | MNQAARLSLVDRADDQMSIVTQCRLLRVARSTLYYRPVAAS |
Ga0311352_114932852 | 3300029944 | Palsa | MSAAERLVLVDGAESGLSIAAQCRLLKVARSTLYYRPLPVS |
Ga0311371_117810132 | 3300029951 | Palsa | MSTAARLPLVDRTDLILSVVAQCRLLKIARSTLYYRPDGA |
Ga0311331_113715652 | 3300029954 | Bog | MSAAARLSLVDRADPALSIVAQCRLLKVARSTLYHRPAPV |
Ga0302277_10649652 | 3300029982 | Bog | MNAAARLSLVDRTDSALSIVAQCRMLKIARSTLYWRPAAASDG |
Ga0311334_111188891 | 3300029987 | Fen | MNQVARLSLVDGADADLSIVAQCRLLKVARSSLYWRPAAVSEDD |
Ga0311339_115247252 | 3300029999 | Palsa | MSPAVRLTLVDRADGQLSIVAQCRLLQVARSTLYW |
Ga0311350_102489913 | 3300030002 | Fen | MSQATRLTLVDSASDELSIVAQCRLLKIARSTLYWRPAAVSEDDL |
Ga0302270_100888261 | 3300030011 | Bog | MNAAARLSLVDRTDSALSIVAQCRMLKIARSTLYW |
Ga0311344_114258711 | 3300030020 | Bog | MSAAARLSLVDRADPALSIVAQCRLLKVARSTLYHRPA |
Ga0311344_114378431 | 3300030020 | Bog | MSPAARLSLVDRADSAVSIMAQCQLLKVARSALYYRPA |
Ga0302177_106350232 | 3300030053 | Palsa | MNRAERLALVDHDDPVLPVTAQCRLLKVARSTLYYQSIPADADELAV |
Ga0311353_109572932 | 3300030399 | Palsa | MPDEGMSPGERRALAERDDTDPIAAQYRLLNVARSTLHYQPAPMHPDDLA |
Ga0311370_124280931 | 3300030503 | Palsa | MNRAERLALVDHDDPVLPVAAQCRLLKVARSPLYYQPIPADADELA |
Ga0265393_12058421 | 3300030586 | Soil | MNRSDRLALVDHDDPALPVVAQCRLLKVARSTLYYRPVPVSAD |
Ga0311356_112878882 | 3300030617 | Palsa | MNRAERLALVDHDDPVLPVTAQCRLLKVARSTLYY |
Ga0311354_116705312 | 3300030618 | Palsa | MSGVARLALVDRADGALSIVAQCRMLRVARSTLYWRPAPV |
Ga0265461_139578792 | 3300030743 | Soil | MTRIARLSLVDRADASLSIAAQCRLLKIARSSLYWRPAAMSEDEKQRRKRK |
Ga0265723_10168752 | 3300030872 | Soil | MSPGERRALVDRDDPDLPIAVQCRLLKVARSTLYYQPTPVDPDDL |
Ga0170834_1060419842 | 3300031057 | Forest Soil | MSSAERLALVEHADPVLSVVAQCRLLKVVRSTLYYPPGTGEPG |
Ga0170824_1059102561 | 3300031231 | Forest Soil | MNRAERLALVDHDDPVLPVTAQCRLLKVARSTLYYQPVSASAE |
Ga0170824_1260697492 | 3300031231 | Forest Soil | MNRPERLALVDHDDPVLPVTAQCRLLKVARSTLYYQP |
Ga0265329_102355253 | 3300031242 | Rhizosphere | MTRPERLALVDHDDLALPVVVQCRLLKVARSTLYYRPVPVSADD |
Ga0272432_12300653 | 3300031470 | Rock | VEKVGAMSPGERRALVDRDDPDLSVAAQCRLLKVARST |
Ga0170818_1130609951 | 3300031474 | Forest Soil | MSRPERLALVDHDDPVPPVVAQCQLLKVARSTLYYRP |
Ga0318574_108491881 | 3300031680 | Soil | MSAVERRGLVDNADQALSVVAQCRLLKIARSTLYYR |
Ga0311351_108796553 | 3300031722 | Fen | MNEVARLSLVDGADADLSIVAQCRLLKVARSSLYW |
Ga0302321_1001066804 | 3300031726 | Fen | MSPSARLALVDSADPVLSVVAQCRLLKVARSTLYYRPAPLR |
Ga0302319_105039061 | 3300031788 | Bog | MNQVARLSLVDRADAGLSIVAQCRLLKVARSSLYWRPAAVSE |
Ga0318505_105763982 | 3300032060 | Soil | MSAVERRGLVDNADQALSVVAQCRLLKIARSTLYYRPVPI |
Ga0315742_106820751 | 3300032756 | Forest Soil | MNRAERLVLVAHDDPVLPVTTQCRLLQVARSTLYYQPVPAGSD |
Ga0335074_110748991 | 3300032895 | Soil | MSPTDRLLLVDRADPRLSIVAQCRLLKIARSTLYYRPA |
Ga0316624_104267441 | 3300033486 | Soil | MNQMTRLSLVDRSDADLSIVAQCRLLKVARSTLYYRA |
Ga0334987_0119696_1123_1245 | 3300034061 | Freshwater | MSRAARLALVDRDDPAMPVTAQCRLLKVARSTLYHRKRCG |
Ga0335063_0602221_17_139 | 3300034111 | Freshwater | MSRATRLALVDRDDPAMPVTAQCRLLKVARSTLYHRKRCG |
⦗Top⦘ |