


| Basic Information | |
|---|---|
| Family ID | F074591 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MRNWNWTPRAKTIGALLQAVAVVGIGWVLFVGTWFALGGN |
| Number of Associated Samples | 71 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 80.67 % |
| % of genes near scaffold ends (potentially truncated) | 15.13 % |
| % of genes from short scaffolds (< 2000 bps) | 66.39 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.782 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (21.008 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.345 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.303 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF02467 | Whib | 25.21 |
| PF05866 | RusA | 10.08 |
| PF00436 | SSB | 2.52 |
| PF00145 | DNA_methylase | 1.68 |
| PF06378 | DUF1071 | 1.68 |
| PF12850 | Metallophos_2 | 0.84 |
| PF03354 | TerL_ATPase | 0.84 |
| PF13730 | HTH_36 | 0.84 |
| PF01551 | Peptidase_M23 | 0.84 |
| PF00534 | Glycos_transf_1 | 0.84 |
| PF04586 | Peptidase_S78 | 0.84 |
| PF01844 | HNH | 0.84 |
| PF04860 | Phage_portal | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 10.08 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 2.52 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 2.52 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.68 |
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.84 |
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.78 % |
| All Organisms | root | All Organisms | 46.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559021|LBLPB2_contig00040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1864 | Open in IMG/M |
| 3300002408|B570J29032_109423543 | Not Available | 753 | Open in IMG/M |
| 3300002835|B570J40625_100254698 | Not Available | 1825 | Open in IMG/M |
| 3300002835|B570J40625_100573339 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
| 3300002835|B570J40625_101270906 | Not Available | 613 | Open in IMG/M |
| 3300005581|Ga0049081_10134169 | Not Available | 912 | Open in IMG/M |
| 3300005581|Ga0049081_10179729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
| 3300005805|Ga0079957_1009315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7534 | Open in IMG/M |
| 3300005805|Ga0079957_1102929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1551 | Open in IMG/M |
| 3300006802|Ga0070749_10007427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7160 | Open in IMG/M |
| 3300007234|Ga0075460_10032280 | Not Available | 2029 | Open in IMG/M |
| 3300007234|Ga0075460_10233754 | Not Available | 617 | Open in IMG/M |
| 3300007542|Ga0099846_1212773 | Not Available | 679 | Open in IMG/M |
| 3300008107|Ga0114340_1013911 | Not Available | 3898 | Open in IMG/M |
| 3300008107|Ga0114340_1202729 | Not Available | 663 | Open in IMG/M |
| 3300008116|Ga0114350_1019551 | Not Available | 2832 | Open in IMG/M |
| 3300008116|Ga0114350_1098860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
| 3300008266|Ga0114363_1001471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23424 | Open in IMG/M |
| 3300008266|Ga0114363_1010855 | All Organisms → Viruses | 4318 | Open in IMG/M |
| 3300008266|Ga0114363_1111173 | Not Available | 969 | Open in IMG/M |
| 3300008266|Ga0114363_1157999 | Not Available | 745 | Open in IMG/M |
| 3300008266|Ga0114363_1186387 | Not Available | 652 | Open in IMG/M |
| 3300008450|Ga0114880_1011416 | All Organisms → Viruses → Predicted Viral | 4371 | Open in IMG/M |
| 3300008450|Ga0114880_1014372 | All Organisms → Viruses → Predicted Viral | 3816 | Open in IMG/M |
| 3300008450|Ga0114880_1015245 | Not Available | 3682 | Open in IMG/M |
| 3300008962|Ga0104242_1017724 | Not Available | 1237 | Open in IMG/M |
| 3300009068|Ga0114973_10018673 | Not Available | 4340 | Open in IMG/M |
| 3300009081|Ga0105098_10544211 | Not Available | 597 | Open in IMG/M |
| 3300009151|Ga0114962_10013194 | Not Available | 6018 | Open in IMG/M |
| 3300009151|Ga0114962_10152377 | All Organisms → Viruses → Predicted Viral | 1388 | Open in IMG/M |
| 3300009155|Ga0114968_10288311 | Not Available | 921 | Open in IMG/M |
| 3300009159|Ga0114978_10845299 | Not Available | 514 | Open in IMG/M |
| 3300009165|Ga0105102_10602754 | Not Available | 607 | Open in IMG/M |
| 3300009165|Ga0105102_10650346 | Not Available | 587 | Open in IMG/M |
| 3300009169|Ga0105097_10202242 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
| 3300009169|Ga0105097_10722956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300009182|Ga0114959_10000825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28904 | Open in IMG/M |
| 3300009182|Ga0114959_10089168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1707 | Open in IMG/M |
| 3300009183|Ga0114974_10526186 | Not Available | 660 | Open in IMG/M |
| 3300009184|Ga0114976_10148322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1315 | Open in IMG/M |
| 3300010966|Ga0137675_1000013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33077 | Open in IMG/M |
| 3300012000|Ga0119951_1008948 | All Organisms → Viruses → Predicted Viral | 4272 | Open in IMG/M |
| 3300012012|Ga0153799_1102236 | Not Available | 508 | Open in IMG/M |
| 3300012665|Ga0157210_1041348 | Not Available | 710 | Open in IMG/M |
| 3300013004|Ga0164293_10125734 | Not Available | 1935 | Open in IMG/M |
| 3300013004|Ga0164293_10731491 | Not Available | 632 | Open in IMG/M |
| 3300013005|Ga0164292_10298232 | All Organisms → Viruses → Predicted Viral | 1104 | Open in IMG/M |
| 3300013006|Ga0164294_10048471 | All Organisms → Viruses → Predicted Viral | 3309 | Open in IMG/M |
| 3300014050|Ga0119952_1125397 | Not Available | 574 | Open in IMG/M |
| 3300017723|Ga0181362_1070708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
| 3300017723|Ga0181362_1115641 | Not Available | 527 | Open in IMG/M |
| 3300017736|Ga0181365_1158565 | Not Available | 534 | Open in IMG/M |
| 3300017761|Ga0181356_1064512 | All Organisms → Viruses → Predicted Viral | 1239 | Open in IMG/M |
| 3300017761|Ga0181356_1067991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1200 | Open in IMG/M |
| 3300017761|Ga0181356_1113350 | Not Available | 872 | Open in IMG/M |
| 3300017761|Ga0181356_1208015 | Not Available | 576 | Open in IMG/M |
| 3300017774|Ga0181358_1017874 | All Organisms → Viruses → Predicted Viral | 2856 | Open in IMG/M |
| 3300017777|Ga0181357_1041776 | All Organisms → Viruses → Predicted Viral | 1801 | Open in IMG/M |
| 3300017784|Ga0181348_1279836 | Not Available | 566 | Open in IMG/M |
| 3300019784|Ga0181359_1047285 | All Organisms → Viruses → Predicted Viral | 1662 | Open in IMG/M |
| 3300020550|Ga0208600_1043384 | Not Available | 684 | Open in IMG/M |
| 3300021961|Ga0222714_10262157 | Not Available | 964 | Open in IMG/M |
| 3300021962|Ga0222713_10217813 | Not Available | 1265 | Open in IMG/M |
| 3300021963|Ga0222712_10001152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33748 | Open in IMG/M |
| 3300022752|Ga0214917_10024735 | All Organisms → Viruses → Predicted Viral | 4745 | Open in IMG/M |
| 3300022752|Ga0214917_10171739 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
| 3300022752|Ga0214917_10249168 | Not Available | 829 | Open in IMG/M |
| 3300022752|Ga0214917_10367816 | Not Available | 607 | Open in IMG/M |
| 3300023179|Ga0214923_10262958 | Not Available | 963 | Open in IMG/M |
| 3300025818|Ga0208542_1111400 | Not Available | 777 | Open in IMG/M |
| 3300025889|Ga0208644_1023167 | Not Available | 3869 | Open in IMG/M |
| 3300027608|Ga0208974_1052514 | Not Available | 1168 | Open in IMG/M |
| 3300027608|Ga0208974_1117594 | Not Available | 697 | Open in IMG/M |
| 3300027708|Ga0209188_1056123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1725 | Open in IMG/M |
| 3300027708|Ga0209188_1163050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
| 3300027712|Ga0209499_1255558 | Not Available | 604 | Open in IMG/M |
| 3300027732|Ga0209442_1128748 | Not Available | 994 | Open in IMG/M |
| 3300027734|Ga0209087_1008786 | Not Available | 5267 | Open in IMG/M |
| 3300027749|Ga0209084_1041756 | All Organisms → Viruses → Predicted Viral | 2269 | Open in IMG/M |
| 3300027798|Ga0209353_10411939 | Not Available | 553 | Open in IMG/M |
| 3300027963|Ga0209400_1208414 | Not Available | 804 | Open in IMG/M |
| 3300028025|Ga0247723_1000379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30812 | Open in IMG/M |
| 3300028025|Ga0247723_1000862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19079 | Open in IMG/M |
| 3300028025|Ga0247723_1001472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13739 | Open in IMG/M |
| 3300028025|Ga0247723_1005285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5849 | Open in IMG/M |
| 3300028025|Ga0247723_1007249 | All Organisms → Viruses → Predicted Viral | 4724 | Open in IMG/M |
| 3300028025|Ga0247723_1023226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 2055 | Open in IMG/M |
| 3300028025|Ga0247723_1115755 | Not Available | 660 | Open in IMG/M |
| 3300031758|Ga0315907_10092978 | All Organisms → Viruses → Predicted Viral | 2591 | Open in IMG/M |
| 3300031758|Ga0315907_10772994 | Not Available | 721 | Open in IMG/M |
| 3300031787|Ga0315900_10460494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Williamsia → unclassified Williamsia → Williamsia sp. DF01-3 | 979 | Open in IMG/M |
| 3300031787|Ga0315900_10484610 | Not Available | 943 | Open in IMG/M |
| 3300031857|Ga0315909_10162354 | Not Available | 1822 | Open in IMG/M |
| 3300031857|Ga0315909_10614301 | Not Available | 723 | Open in IMG/M |
| 3300031951|Ga0315904_10510322 | Not Available | 1058 | Open in IMG/M |
| 3300031999|Ga0315274_11908408 | Not Available | 539 | Open in IMG/M |
| 3300032092|Ga0315905_10000956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31419 | Open in IMG/M |
| 3300032092|Ga0315905_10032201 | All Organisms → cellular organisms → Bacteria | 5324 | Open in IMG/M |
| 3300032092|Ga0315905_10095886 | All Organisms → Viruses → Predicted Viral | 2995 | Open in IMG/M |
| 3300032092|Ga0315905_10281792 | All Organisms → Viruses → Predicted Viral | 1601 | Open in IMG/M |
| 3300032092|Ga0315905_10327470 | All Organisms → Viruses → Predicted Viral | 1461 | Open in IMG/M |
| 3300032092|Ga0315905_10354981 | Not Available | 1390 | Open in IMG/M |
| 3300032116|Ga0315903_10572574 | Not Available | 874 | Open in IMG/M |
| 3300033993|Ga0334994_0050406 | All Organisms → Viruses → Predicted Viral | 2604 | Open in IMG/M |
| 3300033993|Ga0334994_0171625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1199 | Open in IMG/M |
| 3300033996|Ga0334979_0513115 | Not Available | 647 | Open in IMG/M |
| 3300034061|Ga0334987_0000768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30109 | Open in IMG/M |
| 3300034061|Ga0334987_0433549 | Not Available | 822 | Open in IMG/M |
| 3300034101|Ga0335027_0043544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 3672 | Open in IMG/M |
| 3300034101|Ga0335027_0596251 | Not Available | 674 | Open in IMG/M |
| 3300034101|Ga0335027_0858999 | Not Available | 519 | Open in IMG/M |
| 3300034103|Ga0335030_0000585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33765 | Open in IMG/M |
| 3300034104|Ga0335031_0000929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22513 | Open in IMG/M |
| 3300034104|Ga0335031_0010418 | Not Available | 6865 | Open in IMG/M |
| 3300034104|Ga0335031_0060531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2715 | Open in IMG/M |
| 3300034104|Ga0335031_0320597 | Not Available | 1001 | Open in IMG/M |
| 3300034106|Ga0335036_0099703 | All Organisms → Viruses → Predicted Viral | 2134 | Open in IMG/M |
| 3300034120|Ga0335056_0247915 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
| 3300034122|Ga0335060_0218555 | Not Available | 1076 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 21.01% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 11.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.92% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.56% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 5.88% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.04% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.36% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.36% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.52% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.68% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.68% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.84% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559021 | Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from peak-bloom 2 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010966 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LBLPB2_01596550 | 2166559021 | Freshwater | MHNWNWTPRAKMIGTVLQAIAFIGITYILFVGTWYALGGN |
| B570J29032_1094235434 | 3300002408 | Freshwater | MRNWNWTPRAKMIGTTLQAISVVGIVYVLFIGTWFALGGN* |
| B570J40625_1002546984 | 3300002835 | Freshwater | MRNWNWTPKARFIGNLLSAFAVVGTMWVLFVGTWFALGGN* |
| B570J40625_1005733394 | 3300002835 | Freshwater | MRNWNWTPRAKAIGAVLQALAVIGAAWVLFVGTWFALGGN* |
| B570J40625_1012709061 | 3300002835 | Freshwater | CIMTNWNWTPRAKMIGTLLQAIAVVGIGYVLFVGTWFALGGN* |
| Ga0049081_101341691 | 3300005581 | Freshwater Lentic | MSDWNWTPRARMIGTVIQAFAVIGIGWILFVGLWSALGGN* |
| Ga0049081_101797293 | 3300005581 | Freshwater Lentic | MRDWNWTPRARFIGEVLKAVAVIGAAWILFAGTWFA |
| Ga0079957_100931514 | 3300005805 | Lake | MKSNWNWTPRARLIGELLTAIGVVATGCVLFVGTWFALGGN* |
| Ga0079957_11029292 | 3300005805 | Lake | MRNWNWTPRARMIGELLTALAVIAAGWVLFVGTWYALGGN* |
| Ga0070749_100074278 | 3300006802 | Aqueous | MSNWNWTPRAKMIGTLLQAVAVVGIGWVLFVGTWFALGGN* |
| Ga0075460_100322807 | 3300007234 | Aqueous | WTPRAKMIGTLLQAVAVVGIGWVLFVGTWFALGGN* |
| Ga0075460_102337543 | 3300007234 | Aqueous | MRNWNWTPRAKMIGTLFQAIAFIGISYVLFVGTWFALGGN* |
| Ga0099846_12127733 | 3300007542 | Aqueous | MSKWNWTRRARMIGTLLQAFAVVGIGWFLFAGIWFALGGY* |
| Ga0114340_10139115 | 3300008107 | Freshwater, Plankton | MQNWNWTPRAKMIGALLQAVAVVGIGWVLFVGTWFALGGN* |
| Ga0114340_12027293 | 3300008107 | Freshwater, Plankton | MTNWNWTPRAKMIGALLQAVAVVGIGWVLFVGTWFALGGN* |
| Ga0114350_10195519 | 3300008116 | Freshwater, Plankton | MTNWNWTPRAKMIGALLQAVAVVGIGYVLFVGTWFALGGN* |
| Ga0114350_10988602 | 3300008116 | Freshwater, Plankton | MQNWNWTPRAKMIGALLQAIAVVGIGWVLFVGTWFALGGN* |
| Ga0114363_100147113 | 3300008266 | Freshwater, Plankton | MTNWNWTPRARFIGEILTALALVGAGWVLFVGTWFALGGN* |
| Ga0114363_101085510 | 3300008266 | Freshwater, Plankton | MRNWNWTPRAKMIGALLQAVAVVGIGYVLFVGTWYALGGN* |
| Ga0114363_11111734 | 3300008266 | Freshwater, Plankton | MRNWNWTSRAKMIGALLQAVAVVGIGWVLFVGTWFALGGN* |
| Ga0114363_11579991 | 3300008266 | Freshwater, Plankton | MRNWKWTPRAKMIGALLQAIAVVGIGWVLFVGTWFALGGN* |
| Ga0114363_11863872 | 3300008266 | Freshwater, Plankton | MRNWNWTPRAKMIGALLQAVAVVGIGWVLFVGTWYALGGN* |
| Ga0114880_10114169 | 3300008450 | Freshwater Lake | MRDWNWTPLARTLGLVIEAVLVIGIGYVLFIGTWFALGGK* |
| Ga0114880_10143726 | 3300008450 | Freshwater Lake | MRNWNWTPLARTIGLVIEAALILGIGWVLFVGTWFALGGS* |
| Ga0114880_10152454 | 3300008450 | Freshwater Lake | MRNWNWTPRAKMIGLLLQAVAIIGIGWILFVGTWFALGGN* |
| Ga0104242_10177244 | 3300008962 | Freshwater | MRDWNWTPLARTIGLLIEAVLVIGIGYVLFVGTWYALGGS* |
| Ga0114973_1001867315 | 3300009068 | Freshwater Lake | MMKNLPWTPRARMIGLFIQATACAGVWWLLFVGTWFALGGK* |
| Ga0105098_105442111 | 3300009081 | Freshwater Sediment | QNTCLPMTDWWSCTMRNWNWTPRAKMIGTTLQAIAVVGIGYVLFVGTWFALGGN* |
| Ga0114962_100131948 | 3300009151 | Freshwater Lake | MRNLPWTPLARLIGLVIEAVLVIGIGWVLFVGTWFILGGQ* |
| Ga0114962_101523773 | 3300009151 | Freshwater Lake | MRNWNWTPRAKMIGESIIAFATIAAIWILFVGTWFALGGN* |
| Ga0114968_102883113 | 3300009155 | Freshwater Lake | MSNWNWTPRARFIGELLTAVAVVAAGWVLFVGTWFALGGN* |
| Ga0114978_108452992 | 3300009159 | Freshwater Lake | MRDWNWTPLARTIGLLIEAALVVGIGYVLFVGTWYALGGN* |
| Ga0105102_106027542 | 3300009165 | Freshwater Sediment | MMRTWNWTPRAKMIGTFLQAIAVVGIGYVLFVGIWFALGGN* |
| Ga0105102_106503462 | 3300009165 | Freshwater Sediment | MRNWNWTPRAKTIGALLQAVAVVGIGWVLFVGTWFALGGN* |
| Ga0105097_102022423 | 3300009169 | Freshwater Sediment | MHNWNWTPRARFIGELLTAIGVVAAGWVLFVGTWFALGGN* |
| Ga0105097_107229561 | 3300009169 | Freshwater Sediment | MQNWNWTPRAKMIGTVLQAVAVIGIGYVLFVGTWFALGGN* |
| Ga0114959_1000082536 | 3300009182 | Freshwater Lake | MRNWNWTPRAKFIGESIIAFATIAAIWIFFVGTWFALGGN* |
| Ga0114959_100891684 | 3300009182 | Freshwater Lake | MRNWNWTPRAKMIGESLIAFATIAAIWILFVGTWFALGGN* |
| Ga0114974_105261862 | 3300009183 | Freshwater Lake | MMRDWNWTPRAKMIGTLLQAVAVVGIGWILFVGTWHALGGN* |
| Ga0114976_101483224 | 3300009184 | Freshwater Lake | MRDWNWTPLARTIGLVIEAVLVIGIGYVLFVGTWFALGGS* |
| Ga0137675_100001315 | 3300010966 | Pond Fresh Water | MRNWNWTPRAKFLGTLLQAGIVISIIWILFMGTWYALGGN* |
| Ga0119951_10089487 | 3300012000 | Freshwater | MRNWNWTPRAKFIGESLIAFATIAAIWILFVGTWFALGGS* |
| Ga0153799_11022362 | 3300012012 | Freshwater | MSNWNWTPRARFIGELLTAVAVVAAGWVLFVGTWFALGGS* |
| Ga0157210_10413483 | 3300012665 | Freshwater | SYRMRNWNWTPRARFIGELLTAITVVAAGWVLFVGTWFALGGN* |
| Ga0164293_101257342 | 3300013004 | Freshwater | MRNWNWTPRARFIGTLLQAVAVVGIGWVLFVGTWYALGGN* |
| Ga0164293_107314913 | 3300013004 | Freshwater | MRNWNWTPRTKMIGTLLQAIAVVGIGYVLFVGTWFALGGN* |
| Ga0164292_102982323 | 3300013005 | Freshwater | MTNWNWTPRAKAIGAVLQALVVIGAAWVLFVGTWFALGGV* |
| Ga0164294_100484715 | 3300013006 | Freshwater | MRNLPWTPRARMIGELLAAVATVAGIWVLFVGTWFALGGH* |
| Ga0119952_11253972 | 3300014050 | Freshwater | MRNWNWTPRAKMIGTLLQAIAFIGISYILFVGTWYALGGN* |
| Ga0181362_10707083 | 3300017723 | Freshwater Lake | MTMSDWNWTPRARMIGTVIQAFAVIGIGWILFVGLWSALGGN |
| Ga0181362_11156412 | 3300017723 | Freshwater Lake | MMRDWNWTPLARTIGLLIEAVAVIGIGWILFVGLWSALGGN |
| Ga0181365_11585651 | 3300017736 | Freshwater Lake | MSKLPWTPRARMIGLFLQAIATVGIMWLLFVGTWF |
| Ga0181356_10645125 | 3300017761 | Freshwater Lake | WTPRARFIGEVLKAVAVIGAAWILFAGTWFALGGY |
| Ga0181356_10679911 | 3300017761 | Freshwater Lake | MRNWNWTPLARTIGLLIEAVAVIGIGWIVFVGLWSALG |
| Ga0181356_11133504 | 3300017761 | Freshwater Lake | LSTLRKWSCKMHDWNWTPLARAIGLLIEATLVIGIGWVLFVGTWFALGGN |
| Ga0181356_12080151 | 3300017761 | Freshwater Lake | MRNWNWTPLARTIGLFIEAVAVIGIGWILFVGLWSALGG |
| Ga0181358_10178746 | 3300017774 | Freshwater Lake | MSDWNWTPRARMIGTVIQAFAVIGIGWILFVGLWSALGGN |
| Ga0181357_10417761 | 3300017777 | Freshwater Lake | CQMRNWNWTPLARTIGLLIEAALVVGIGYVLFVGTWFALGGN |
| Ga0181348_12798361 | 3300017784 | Freshwater Lake | MTMSDWNWTPLARTIGLFIKAVAVIGIGWILFVGLWSALGGK |
| Ga0181359_10472854 | 3300019784 | Freshwater Lake | MRTNWNWTPLARTIGLVIEAVLVIGIGYVLFVGTWFALGGN |
| Ga0208600_10433842 | 3300020550 | Freshwater | MTDWWSWTMRNWNWTPRAKMIGALLQAVAVVGIGWVLFVGTWFALGGN |
| Ga0222714_102621573 | 3300021961 | Estuarine Water | MRNWNWTPRAKMIGALLQALAVIGIAYVLFVGTWFALGGN |
| Ga0222713_102178133 | 3300021962 | Estuarine Water | MSNWNWTPRAKMIGVFLQAVAAVGIIWVLFVGTWYALGGN |
| Ga0222712_1000115243 | 3300021963 | Estuarine Water | MRNWNWTPRARFIGELLTAIGLVAAGWVLFVGTWFALGGN |
| Ga0214917_100247353 | 3300022752 | Freshwater | MRDWNWTPLARTIGLVIEAVLVIGIGYVLFVGTWYALGGS |
| Ga0214917_101717393 | 3300022752 | Freshwater | MRNWNWTPRAKFIGESLIAFATIAAIWILFVGTWFALGGS |
| Ga0214917_102491683 | 3300022752 | Freshwater | MRDWNWTPLARTIGLLIEAVLVIGIGYVLFVGTWYALGGS |
| Ga0214917_103678162 | 3300022752 | Freshwater | MRNLNWTPQAKMIGTLLQAVAVVGIGWILFVGTWFALGGN |
| Ga0214923_102629583 | 3300023179 | Freshwater | MRDWNWTPLARTIGLVIEAVLVIGIGWVLFVGTWFILGGQ |
| Ga0208542_11114003 | 3300025818 | Aqueous | MRNWNWTPRAKMIGTLFQAIAFIGISYVLFVGTWFALGGN |
| Ga0208644_10231676 | 3300025889 | Aqueous | MSNWNWTPRAKMIGTLLQAVAVVGIGWVLFVGTWFALGGN |
| Ga0208974_10525144 | 3300027608 | Freshwater Lentic | MSSWNWTPRAKMIGTLLQAIAVVGIGYVLFVGTWFALGGN |
| Ga0208974_11175943 | 3300027608 | Freshwater Lentic | MRNWNWTARARFLGNVLAAMAVISTGWVLFVGTWFAL |
| Ga0209188_10561235 | 3300027708 | Freshwater Lake | MRNWNWTPRAKMIGESLIAFATIAAIWILFVGTWFALGGN |
| Ga0209188_11630502 | 3300027708 | Freshwater Lake | MRNWNWTPRAKFIGESIIAFATIAAIWIFFVGTWFALGGN |
| Ga0209499_12555581 | 3300027712 | Freshwater Lake | MRNLPWTPLARLIGLVIEAVLVIGIGWVLFVGTWFI |
| Ga0209442_11287481 | 3300027732 | Freshwater Lake | ISMTNWNWTPRARFIGEVLKAVVVIGAAWILFAGTWFALGGY |
| Ga0209087_100878611 | 3300027734 | Freshwater Lake | MRDWNWTPLARTIGLVIEAVLVIGIGYVLFVGTWFALGGS |
| Ga0209084_10417563 | 3300027749 | Freshwater Lake | MRNLPWTPLARLIGLVIEAVLVIGIGWVLFVGTWFILGGQ |
| Ga0209353_104119391 | 3300027798 | Freshwater Lake | VMTMSDWNWTPRARMIGTVIQAFAVIGIGWILFVGLWSALGGN |
| Ga0209400_12084142 | 3300027963 | Freshwater Lake | MSNWNWTPRARFIGELLTAVAVVAAGWVLFVGTWFALGGN |
| Ga0247723_100037918 | 3300028025 | Deep Subsurface Sediment | MRDWNWTPRAKMIGIVCQAVAVVGISWVLFVGTWYALGGN |
| Ga0247723_100086229 | 3300028025 | Deep Subsurface Sediment | MTNWNWTPRARMIGAVLQALAVIGAAWVLFVGTWFALGGV |
| Ga0247723_100147223 | 3300028025 | Deep Subsurface Sediment | MSNWNWTPRARFIGELLVAIAVVGAAWVLFVGTWFALGGN |
| Ga0247723_10052855 | 3300028025 | Deep Subsurface Sediment | MRNWNWTPRARFIGDLLTALAVVGAVWVLFVGTWFALGGN |
| Ga0247723_10072496 | 3300028025 | Deep Subsurface Sediment | MRDWNWTPRARFIGELITALAVIGAGWVLFVGTWFALGGN |
| Ga0247723_10232263 | 3300028025 | Deep Subsurface Sediment | MRNWNWTPRARFIGNLLVAAGVVAAGWVLFVGTWFALGGN |
| Ga0247723_11157551 | 3300028025 | Deep Subsurface Sediment | MRDWNWTPRAKMIGTLLQAIAVIGIGYVLFVGTWFALGGN |
| Ga0315907_100929784 | 3300031758 | Freshwater | MTNWNWTPRARFIGEILTALALVGAGWVLFVGTWFALGGN |
| Ga0315907_107729941 | 3300031758 | Freshwater | MTNWNWTPRAKMIGALLQAIAVVGIGWVLFVGTWFALGGN |
| Ga0315900_104604942 | 3300031787 | Freshwater | MQNWNWTPRAKMIGALLQAVAVVGIGWVLFVGTWFALGGN |
| Ga0315900_104846103 | 3300031787 | Freshwater | MTNWNWTPRAKMIGALLQAVAVVGIGWVLFVGTWFALGGN |
| Ga0315909_101623545 | 3300031857 | Freshwater | MRNWNWTPRAKMIGALLQAVAVVGIGWVLFVGTWYALGGN |
| Ga0315909_106143012 | 3300031857 | Freshwater | MRNWKWTPRAKMIGALLQAIAVVGIGWVLFVGTWFALGGN |
| Ga0315904_105103223 | 3300031951 | Freshwater | MRNWNWTPRAKMIGALLQAVAVVGIGYVLFVGTWYALGGN |
| Ga0315274_119084081 | 3300031999 | Sediment | SSARWWTFLMTNWNWTPRAKAIGAVLQALGVIGVAWVLFVGTWFALGGV |
| Ga0315905_1000095613 | 3300032092 | Freshwater | MRNWNWTPRAKMIGLLLQAVAIIGIGWILFVGTWFALGGN |
| Ga0315905_100322015 | 3300032092 | Freshwater | MRDWNWTPLARTLGLVIEAVLVIGIGYVLFIGTWFALGGK |
| Ga0315905_100958867 | 3300032092 | Freshwater | MRDWNWTPLARTIGLVIEAALILGIGWVLFVGTWFALGGS |
| Ga0315905_102817923 | 3300032092 | Freshwater | MRNWNWTPLARTIGLVIEAALILGIGWVLFVGTWFALGGS |
| Ga0315905_103274703 | 3300032092 | Freshwater | MMRDWNWTPLARTIGLVIEAVLILGIGWVLFVGTWFVIGGR |
| Ga0315905_103549814 | 3300032092 | Freshwater | MRNWNWTPRARMIGKVLQALAVIGIGWVLFVGTWYALGGN |
| Ga0315903_105725742 | 3300032116 | Freshwater | MRNWNWTSRAKMIGALLQAVAVVGIGWVLFVGTWFALGGN |
| Ga0334994_0050406_327_473 | 3300033993 | Freshwater | MTDWWSWTMRNWNWTPRAKMIGTTLQAISVVGIVYVLFIGTWFALGGN |
| Ga0334994_0171625_71_193 | 3300033993 | Freshwater | MTNWNWTPRAKMIGTLLQAIAVVGIGYVLFVGTWFALGGN |
| Ga0334979_0513115_389_511 | 3300033996 | Freshwater | MTNWNWTPRAKAIGAVLQALVVIGAAWVLFVGTWFALGGV |
| Ga0334987_0000768_4596_4718 | 3300034061 | Freshwater | MRNWNWTPRARLIGNLLAAIAVVGAGWVLFVGTWFALGGN |
| Ga0334987_0433549_19_141 | 3300034061 | Freshwater | MTNWNWTPRAKVIGAVLQALAVIGAAWVLFVGTWFALGGV |
| Ga0335027_0043544_2451_2573 | 3300034101 | Freshwater | MSNWNWTPRARFIGNLLGAAGVVAVGWVLFVGTWFALGGN |
| Ga0335027_0596251_340_462 | 3300034101 | Freshwater | MSNWNWTPRARMIGAVLQALAVIGAAWVLFVGTWFALGGV |
| Ga0335027_0858999_44_166 | 3300034101 | Freshwater | MRNWNWTPRAKMIGTLLQALAFIGIGYVLFVGTWFALGGN |
| Ga0335030_0000585_12531_12653 | 3300034103 | Freshwater | MTNWNWTPRARFIGELLTALAVIGAGWVLFVGTWFALGGN |
| Ga0335031_0000929_17942_18064 | 3300034104 | Freshwater | MRNWNWTPRARFIGNLITAVSVVAAGWVLFVGTWFALGGN |
| Ga0335031_0010418_5043_5165 | 3300034104 | Freshwater | MTNWNWTPRAKIIGTILQAIAVVGIGYVLFVGIWFALGGN |
| Ga0335031_0060531_3_125 | 3300034104 | Freshwater | MNNWNWTTRAKMIGTLLEAVAVVGISWILFVGTWYALGGN |
| Ga0335031_0320597_633_755 | 3300034104 | Freshwater | MKDWNWTPRAKFIGNLLAAAGVIAAGWVLFVGTWFALGGN |
| Ga0335036_0099703_1537_1659 | 3300034106 | Freshwater | MHNWNWTPRARFIGELLTALAVVGAGWVLFVGTWFALGGN |
| Ga0335056_0247915_119_241 | 3300034120 | Freshwater | MRDWNWTPRARFIGELLIAIGVVAAGWVLFVGTWFALGGN |
| Ga0335060_0218555_451_573 | 3300034122 | Freshwater | MRNWNWTPRAKMIGALLQAVAFIGIGWVLFVGTWYALGGN |
| ⦗Top⦘ |