Basic Information | |
---|---|
Family ID | F073771 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 43 residues |
Representative Sequence | MNKNITVVLLLVLAAGCSSKPQDGAYAPPMDPTRKVSEQECSR |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 90.83 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (58.333 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (32.500 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.80% β-sheet: 0.00% Coil/Unstructured: 66.20% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF03401 | TctC | 5.83 |
PF00990 | GGDEF | 3.33 |
PF01979 | Amidohydro_1 | 2.50 |
PF01425 | Amidase | 2.50 |
PF03480 | DctP | 1.67 |
PF02782 | FGGY_C | 1.67 |
PF13531 | SBP_bac_11 | 1.67 |
PF04545 | Sigma70_r4 | 1.67 |
PF06071 | YchF-GTPase_C | 0.83 |
PF14319 | Zn_Tnp_IS91 | 0.83 |
PF12796 | Ank_2 | 0.83 |
PF13620 | CarboxypepD_reg | 0.83 |
PF00561 | Abhydrolase_1 | 0.83 |
PF05496 | RuvB_N | 0.83 |
PF00266 | Aminotran_5 | 0.83 |
PF00211 | Guanylate_cyc | 0.83 |
PF11142 | DUF2917 | 0.83 |
PF14031 | D-ser_dehydrat | 0.83 |
PF13517 | FG-GAP_3 | 0.83 |
PF02594 | DUF167 | 0.83 |
PF04909 | Amidohydro_2 | 0.83 |
PF03951 | Gln-synt_N | 0.83 |
PF13738 | Pyr_redox_3 | 0.83 |
PF00303 | Thymidylat_synt | 0.83 |
PF01799 | Fer2_2 | 0.83 |
PF12681 | Glyoxalase_2 | 0.83 |
PF07769 | PsiF_repeat | 0.83 |
PF00441 | Acyl-CoA_dh_1 | 0.83 |
PF13544 | Obsolete Pfam Family | 0.83 |
PF00724 | Oxidored_FMN | 0.83 |
PF03928 | HbpS-like | 0.83 |
PF07963 | N_methyl | 0.83 |
PF01855 | POR_N | 0.83 |
PF00476 | DNA_pol_A | 0.83 |
PF08282 | Hydrolase_3 | 0.83 |
PF02322 | Cyt_bd_oxida_II | 0.83 |
PF00072 | Response_reg | 0.83 |
PF04365 | BrnT_toxin | 0.83 |
PF00891 | Methyltransf_2 | 0.83 |
PF01734 | Patatin | 0.83 |
PF02423 | OCD_Mu_crystall | 0.83 |
PF02775 | TPP_enzyme_C | 0.83 |
PF06277 | EutA | 0.83 |
PF07681 | DoxX | 0.83 |
PF00892 | EamA | 0.83 |
PF00909 | Ammonium_transp | 0.83 |
PF15919 | HicB_lk_antitox | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 5.83 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 2.50 |
COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.83 |
COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 0.83 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.83 |
COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.83 |
COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.83 |
COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.83 |
COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.83 |
COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.83 |
COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.83 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.83 |
COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 0.83 |
COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.83 |
COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.83 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.83 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.83 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.83 |
COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 0.83 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.83 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.83 |
COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.83 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.83 |
COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.83 |
COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.83 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.83 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.83 |
COG4819 | Ethanolamine utilization protein EutA, possible chaperonin | Amino acid transport and metabolism [E] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 59.17 % |
Unclassified | root | N/A | 40.83 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004047|Ga0055499_10018665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 903 | Open in IMG/M |
3300004156|Ga0062589_100988925 | Not Available | 784 | Open in IMG/M |
3300005167|Ga0066672_10032719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2858 | Open in IMG/M |
3300005178|Ga0066688_10747610 | Not Available | 616 | Open in IMG/M |
3300005184|Ga0066671_10362108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 922 | Open in IMG/M |
3300005554|Ga0066661_10865010 | Not Available | 529 | Open in IMG/M |
3300005557|Ga0066704_10850548 | Not Available | 565 | Open in IMG/M |
3300005558|Ga0066698_10700944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 668 | Open in IMG/M |
3300005615|Ga0070702_101791543 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300006046|Ga0066652_100631656 | Not Available | 1013 | Open in IMG/M |
3300006177|Ga0075362_10591297 | Not Available | 573 | Open in IMG/M |
3300006755|Ga0079222_10533679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
3300006794|Ga0066658_10817409 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300006796|Ga0066665_11091416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 608 | Open in IMG/M |
3300006804|Ga0079221_11508909 | Not Available | 540 | Open in IMG/M |
3300006845|Ga0075421_100246468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2192 | Open in IMG/M |
3300006852|Ga0075433_10653399 | Not Available | 922 | Open in IMG/M |
3300006854|Ga0075425_102321651 | Not Available | 596 | Open in IMG/M |
3300006880|Ga0075429_101830067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 526 | Open in IMG/M |
3300006894|Ga0079215_11226449 | Not Available | 573 | Open in IMG/M |
3300006953|Ga0074063_12105323 | All Organisms → cellular organisms → Bacteria | 2532 | Open in IMG/M |
3300006954|Ga0079219_11975002 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300007004|Ga0079218_10539538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfitobacterium → Desulfitobacterium metallireducens → Desulfitobacterium metallireducens DSM 15288 | 1045 | Open in IMG/M |
3300007258|Ga0099793_10456358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 632 | Open in IMG/M |
3300007775|Ga0102953_1450695 | Not Available | 535 | Open in IMG/M |
3300009012|Ga0066710_100474476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1880 | Open in IMG/M |
3300009037|Ga0105093_10574520 | Not Available | 635 | Open in IMG/M |
3300009053|Ga0105095_10575291 | Not Available | 626 | Open in IMG/M |
3300009082|Ga0105099_10518036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Paralysiella → Paralysiella testudinis | 724 | Open in IMG/M |
3300009147|Ga0114129_10711262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1290 | Open in IMG/M |
3300009162|Ga0075423_10570918 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300009171|Ga0105101_10064294 | Not Available | 1783 | Open in IMG/M |
3300009171|Ga0105101_10100148 | Not Available | 1406 | Open in IMG/M |
3300009806|Ga0105081_1027335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 737 | Open in IMG/M |
3300009814|Ga0105082_1092905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas nitrosa | 560 | Open in IMG/M |
3300009840|Ga0126313_11578772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 546 | Open in IMG/M |
3300010304|Ga0134088_10114158 | Not Available | 1276 | Open in IMG/M |
3300010329|Ga0134111_10020253 | Not Available | 2236 | Open in IMG/M |
3300010403|Ga0134123_13399999 | Not Available | 514 | Open in IMG/M |
3300011397|Ga0137444_1066081 | Not Available | 566 | Open in IMG/M |
3300011420|Ga0137314_1083213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas nitrosa | 782 | Open in IMG/M |
3300011424|Ga0137439_1011115 | Not Available | 1342 | Open in IMG/M |
3300011425|Ga0137441_1073453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas nitrosa | 801 | Open in IMG/M |
3300011442|Ga0137437_1121575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 898 | Open in IMG/M |
3300012122|Ga0137332_1033011 | Not Available | 603 | Open in IMG/M |
3300012167|Ga0137319_1054075 | Not Available | 805 | Open in IMG/M |
3300012189|Ga0137388_11191970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 699 | Open in IMG/M |
3300012189|Ga0137388_11901924 | Not Available | 525 | Open in IMG/M |
3300012208|Ga0137376_10778392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 824 | Open in IMG/M |
3300012212|Ga0150985_107304397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 604 | Open in IMG/M |
3300012226|Ga0137447_1113096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
3300012353|Ga0137367_10403160 | Not Available | 969 | Open in IMG/M |
3300012358|Ga0137368_10630547 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300012582|Ga0137358_10060799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2525 | Open in IMG/M |
3300012917|Ga0137395_11263687 | Not Available | 512 | Open in IMG/M |
3300012918|Ga0137396_10103880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14 | 2032 | Open in IMG/M |
3300012922|Ga0137394_10583795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 946 | Open in IMG/M |
3300012922|Ga0137394_10599487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14 | 932 | Open in IMG/M |
3300012923|Ga0137359_10324667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1369 | Open in IMG/M |
3300012929|Ga0137404_11096412 | Not Available | 730 | Open in IMG/M |
3300012944|Ga0137410_10117343 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
3300012944|Ga0137410_11516442 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300012972|Ga0134077_10184873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
3300012975|Ga0134110_10398493 | Not Available | 610 | Open in IMG/M |
3300012975|Ga0134110_10511785 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300014149|Ga0181613_1025133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1744 | Open in IMG/M |
3300014883|Ga0180086_1119479 | Not Available | 679 | Open in IMG/M |
3300015054|Ga0137420_1283620 | Not Available | 575 | Open in IMG/M |
3300015253|Ga0180081_1106307 | Not Available | 515 | Open in IMG/M |
3300015358|Ga0134089_10350933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 622 | Open in IMG/M |
3300018076|Ga0184609_10269706 | Not Available | 796 | Open in IMG/M |
3300018083|Ga0184628_10707706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
3300018422|Ga0190265_12826201 | Not Available | 580 | Open in IMG/M |
3300019377|Ga0190264_12251956 | Not Available | 510 | Open in IMG/M |
3300019872|Ga0193754_1005657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1238 | Open in IMG/M |
3300019883|Ga0193725_1036352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1298 | Open in IMG/M |
3300020060|Ga0193717_1108336 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300021082|Ga0210380_10116726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1186 | Open in IMG/M |
3300021329|Ga0210362_1558262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 569 | Open in IMG/M |
3300021363|Ga0193699_10248768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
3300022213|Ga0224500_10063162 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
3300022226|Ga0224512_10012773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 6043 | Open in IMG/M |
3300022534|Ga0224452_1137442 | Not Available | 752 | Open in IMG/M |
3300024430|Ga0196962_10318238 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300025563|Ga0210112_1048555 | Not Available | 893 | Open in IMG/M |
3300025790|Ga0210075_1092967 | Not Available | 530 | Open in IMG/M |
3300025792|Ga0210143_1006626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2202 | Open in IMG/M |
3300025917|Ga0207660_10890054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 726 | Open in IMG/M |
3300026323|Ga0209472_1103832 | Not Available | 1131 | Open in IMG/M |
3300026485|Ga0256805_1008878 | Not Available | 1028 | Open in IMG/M |
3300026524|Ga0209690_1218097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 601 | Open in IMG/M |
3300026540|Ga0209376_1178997 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300026550|Ga0209474_10266248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1043 | Open in IMG/M |
3300027360|Ga0209969_1015156 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1125 | Open in IMG/M |
3300027526|Ga0209968_1095972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 539 | Open in IMG/M |
3300027643|Ga0209076_1202374 | Not Available | 544 | Open in IMG/M |
3300027731|Ga0209592_1215401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Paralysiella → Paralysiella testudinis | 673 | Open in IMG/M |
3300027792|Ga0209287_10215908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 732 | Open in IMG/M |
3300027882|Ga0209590_10837335 | Not Available | 583 | Open in IMG/M |
3300027886|Ga0209486_11084443 | Not Available | 543 | Open in IMG/M |
3300027964|Ga0256864_1175499 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300027979|Ga0209705_10022191 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3504 | Open in IMG/M |
3300028596|Ga0247821_10272708 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300028596|Ga0247821_11058329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 546 | Open in IMG/M |
3300028771|Ga0307320_10201855 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300028792|Ga0307504_10064220 | Not Available | 1086 | Open in IMG/M |
3300028812|Ga0247825_10265216 | Not Available | 1196 | Open in IMG/M |
3300028884|Ga0307308_10307207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 760 | Open in IMG/M |
3300031740|Ga0307468_100400090 | Not Available | 1048 | Open in IMG/M |
3300032044|Ga0318558_10070739 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
3300032157|Ga0315912_10344023 | Not Available | 1177 | Open in IMG/M |
3300032180|Ga0307471_100713204 | Not Available | 1168 | Open in IMG/M |
3300032180|Ga0307471_101650510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
3300033407|Ga0214472_10150257 | Not Available | 2282 | Open in IMG/M |
3300033407|Ga0214472_10505242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11 | 1121 | Open in IMG/M |
3300033550|Ga0247829_10013549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4896 | Open in IMG/M |
3300033550|Ga0247829_11345108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
3300034147|Ga0364925_0106953 | Not Available | 996 | Open in IMG/M |
3300034150|Ga0364933_131511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
3300034178|Ga0364934_0306146 | Not Available | 602 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.17% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 8.33% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.17% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.33% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.50% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.50% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.67% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.67% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.67% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.67% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.83% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.83% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.83% |
Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water | 0.83% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.83% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.83% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.83% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004047 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007775 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D2_MG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011397 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2 | Environmental | Open in IMG/M |
3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
3300011424 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2 | Environmental | Open in IMG/M |
3300011425 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT244_2 | Environmental | Open in IMG/M |
3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
3300012122 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT200_2 | Environmental | Open in IMG/M |
3300012167 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014149 | In situ water column microbial community from the vent pool of Chocolate Pots hot spring, Yellowstone National Park, Wyoming, USA - CP Vent Pool | Environmental | Open in IMG/M |
3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015253 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10D | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019872 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1 | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022226 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13 | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
3300025563 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025790 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026485 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 F6 | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027964 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeq | Environmental | Open in IMG/M |
3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0055499_100186653 | 3300004047 | Natural And Restored Wetlands | MNKIMTIVFLLLAAGCSSTSQEAYAPPMDPGRKVSELDCSREGETGGANLMCRQV |
Ga0062589_1009889251 | 3300004156 | Soil | MNKNKNIAVVLVLVLVLAAGCSSRPQDGAYAPPMDPSRKVSEQDCSRSIGTDGGNLL |
Ga0066672_100327193 | 3300005167 | Soil | MNRNITVVLVLVLAAPCSSRSQDGAYVPPPMDPARRVSRQVCTRIIHMDGG |
Ga0066688_107476101 | 3300005178 | Soil | MNKNITVVLLLVLAAGCSSTPQDGAYLPPMDPTRKVSKQDCTRAI |
Ga0066671_103621081 | 3300005184 | Soil | MNKNITVVLLLVLAAGCSSTPQDGAYLPPMDPTRKVSEQE |
Ga0066661_108650101 | 3300005554 | Soil | MNKNITVVLLLVLAAGCSSKPQDGAYAPPMDPTRKVS |
Ga0066704_108505483 | 3300005557 | Soil | MNKNITVVLVLVLAAPCSSRSQDGAYVPPPMDPTRKV |
Ga0066698_107009441 | 3300005558 | Soil | MNKNITVVLLLVLAAGCSSTPQDGAYLPPMDPTRKV |
Ga0070702_1017915433 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKNITAVLLLVLAAGCSSTPREGTVPSMDPTRKVSEQDCSR |
Ga0066652_1006316561 | 3300006046 | Soil | MNKNITVVLVLVLAAPCSSRSQDGAYVPPPMDPTRKVSRQ |
Ga0075362_105912971 | 3300006177 | Populus Endosphere | MNKNIPVVLVLVLAAGCSSSLQRETTAPPMAASRKVSEQDCSKASNADGGNL |
Ga0079222_105336791 | 3300006755 | Agricultural Soil | MNKKITVVLGFVLAAGCSSGPQVGGDLPPMDPTRKVSQQDCT |
Ga0066658_108174092 | 3300006794 | Soil | MNKNITVVLLLALAAGCSSKPQYGAYAPPMDSTRKVSEQDCSRSIDT |
Ga0066665_110914161 | 3300006796 | Soil | MNKNITVVLVLVLAAPCSSGSQDGAYVPPPMDPTRKVSRQV |
Ga0079221_115089093 | 3300006804 | Agricultural Soil | MNKNMTAVLLLVLAAGCSTKPQDGAYGPSMEPAMDPTRKVSEQDCT |
Ga0075421_1002464686 | 3300006845 | Populus Rhizosphere | MNKNKSIVLLVLVLAAGCSSRAPDGPYVPPMDPTRKIAEQDCARPIV |
Ga0075433_106533991 | 3300006852 | Populus Rhizosphere | MNKNITVVLLLALAAGCSSTPQDATYAAEGGAPMDPTRKVS |
Ga0075425_1023216512 | 3300006854 | Populus Rhizosphere | MNKKIIVLVFVSAAGCSSGPQYEGDPPMISSRKVSEQECIRPLKDDGG |
Ga0075429_1018300671 | 3300006880 | Populus Rhizosphere | MNKNKSIVLLVLVLAAGCSSRAPDGPYVPPMDPTRKIAEQDCARP |
Ga0079215_112264491 | 3300006894 | Agricultural Soil | MKKNITVVLLLVLAAGCSSTPRDGASAPPMDPTRKVSEQDCSRALNND |
Ga0074063_121053233 | 3300006953 | Soil | MNKNITVVVLLILAAGCSSSSRDGVFAPPMDTGRKVSEQECARPFDTGGANLLC |
Ga0079219_119750022 | 3300006954 | Agricultural Soil | MNKNISVVLLLLLAGGCSTQPQDEAYVPRMDPTRKVSEQD |
Ga0079218_105395381 | 3300007004 | Agricultural Soil | MNKNISVILLVLAAGCSSTPRDGASAPPMDPTRKVSEQ |
Ga0099793_104563582 | 3300007258 | Vadose Zone Soil | MNKNITVLLLLVLAAGCSTNPQDGAYPPMDPARKVSVQVCTRQIDTADG |
Ga0102953_14506951 | 3300007775 | Soil | MNKNIAVVLLLVLAAGCSSNPRDEAYAPPPMDPTRTVSEQVCTRTITVEGG |
Ga0066710_1004744762 | 3300009012 | Grasslands Soil | MNKNITVVLVLVLAAPCSSRSQDGAYVPPPMDPTRKVS |
Ga0105093_105745201 | 3300009037 | Freshwater Sediment | MNKNITVVLLLVLAAGCSSKPQDGAYPPPMDPSRKVS |
Ga0105095_105752913 | 3300009053 | Freshwater Sediment | MNKNITVVLLLVLAAGCSSKPQDGAYAPPMDPSRK |
Ga0105099_105180361 | 3300009082 | Freshwater Sediment | MNKNITVVLLLVLAAGCSSKPQDGAYAPPMDPSRKVSEQDCSRPFDTDGGNLMC |
Ga0114129_107112625 | 3300009147 | Populus Rhizosphere | MNKNITVALLLVLAAGCISTPQDGAYLPPMDPTRKVSEQDC |
Ga0075423_105709182 | 3300009162 | Populus Rhizosphere | MNKNITVVLLLVLSAGCSSRPQDGAYAPPQDGAYVPPMDPARTVSEQDCSRAIGTAGA |
Ga0105101_100642945 | 3300009171 | Freshwater Sediment | MNKNIAVVLLLVLAAGCSSKPQDGAYAPPMDPSRKVSEQDCSRPF |
Ga0105101_101001483 | 3300009171 | Freshwater Sediment | MNKNITVVLLLVLAAGCSSTSQDGAYAPPMDPTRKVSEQDCSGPIDTD |
Ga0105081_10273351 | 3300009806 | Groundwater Sand | MNKNIAVVLLLVLAAGCSSKPQDGADAPPMDPTRK |
Ga0105082_10929053 | 3300009814 | Groundwater Sand | MNKNITVVLLVLAAGCSITAQEGADAPPMDPTRKVSEQDCARPIDTAGAGNLM |
Ga0126313_115787722 | 3300009840 | Serpentine Soil | MNKNRTVVFVLALAAGCTSNPQYGDSAPPMASGRTVSEQDCSRP |
Ga0134088_101141581 | 3300010304 | Grasslands Soil | MNKNITVVLLLVLAAGCSSKPQDGAYAPRMDPTRKVSEQDCSRQIGTDGGNLM |
Ga0134111_100202534 | 3300010329 | Grasslands Soil | MNKNITVVLLLVLAAGCSSKPQDGAYAPRMDPTRKV |
Ga0134123_133999991 | 3300010403 | Terrestrial Soil | MNKNRTVVLLLVLAAGCSSTPQDGADAPPLDPTRRISEQD |
Ga0137444_10660812 | 3300011397 | Soil | MNKNITVVLVLVLAAPCSSRSQGEAYVPPPMDPTR |
Ga0137314_10832131 | 3300011420 | Soil | MNRNIIVVLLLVLAAGCSSRPQEAYAPPMDPGRKVSELDCSREFETGGANLM |
Ga0137439_10111152 | 3300011424 | Soil | MNKIITVVLLLLAAGCSSKPQDAYAPPMDPGRRVSELDCSRET |
Ga0137441_10734534 | 3300011425 | Soil | MNKNMTVVLLLVLAAGCSSKPQEAYAPPMDPSRRVSEQDCSGPFDTGGLNLMC |
Ga0137437_11215751 | 3300011442 | Soil | MNKNIAVVLLLVLAVGCSTNPRDGAYPPSMDPTRK |
Ga0137332_10330112 | 3300012122 | Soil | MNKNKTVVLLLVLAAGCGTKLQEGAYPPPMDATRKVSEQDCSRVFDT |
Ga0137319_10540752 | 3300012167 | Soil | MSKNKNKNMTVVLVLVLAAGCSSRLQDGAYLPPMDPTRK |
Ga0137388_111919702 | 3300012189 | Vadose Zone Soil | VNKNITVVLLLVLAAGCSTNPQDGAYPPMDPARKVSVQVCT |
Ga0137388_119019241 | 3300012189 | Vadose Zone Soil | MNKNITVVLLLVLAAGCSTNPQDGAYPPMDPARKVSVQVCT |
Ga0137376_107783922 | 3300012208 | Vadose Zone Soil | MNKNLTVVLLLVLAAGCSSKPQDGAYAPPMDLTRKVSEQDCSGP |
Ga0150985_1073043973 | 3300012212 | Avena Fatua Rhizosphere | MNKKITAVLLLVLAAGCSTSSQDGTMDPTRKVAGQDCTRPIIGD |
Ga0137447_11130961 | 3300012226 | Soil | MNKNITVVLLLVLAAGCSTTPRDGPSAPPMDPSRTVSEQDCSRPI |
Ga0137367_104031601 | 3300012353 | Vadose Zone Soil | MNKNITVALLLVLAAGCSSKPQDGDYALPMDPTRKVSEQDCSRPIDTDG |
Ga0137368_106305472 | 3300012358 | Vadose Zone Soil | MNKNITAVLLLVLAAGCGTKPQDGAYESSMDPTRKV |
Ga0137358_100607995 | 3300012582 | Vadose Zone Soil | MNKNITVVLLLVLAAGCSSGPQDGAYLKPMDPTRKVSKEDCTRAILPDGNLMC |
Ga0137395_112636872 | 3300012917 | Vadose Zone Soil | MNKNITVVLLLVLAAGCSSKPRDGAYASPMDPTRKVSEQDCTR |
Ga0137396_101038801 | 3300012918 | Vadose Zone Soil | MNKNITVVLVLVLAAPCSSRSQDGAYVPPPMDSTRKVSRQVCT |
Ga0137394_105837951 | 3300012922 | Vadose Zone Soil | MNKSITVVLVLVLAAPCSSRSQDKANVPPPMDPTRKVS |
Ga0137394_105994872 | 3300012922 | Vadose Zone Soil | MNKNITVVLLLVLAAGCSSQPQDGAYAPPMDPTRKVSEQECSRPIDSD |
Ga0137359_103246671 | 3300012923 | Vadose Zone Soil | MNKNITVVLLLVLAAGCSTNPQDGAYPPMDPTRKVSR |
Ga0137404_110964121 | 3300012929 | Vadose Zone Soil | MNKNITVVLVLVLATPCISRSQDGAYVPPPMDPTRKVSRQVCTRI |
Ga0137410_101173434 | 3300012944 | Vadose Zone Soil | MNKNITVVLLLVLAAGCSSKPRDGAYGPPLDPTRKVSEQDCSGPIGTDG |
Ga0137410_115164421 | 3300012944 | Vadose Zone Soil | MNKNIVVVLLVLAAGCSSNPPDGADAPKMDPTRKVSEQDCSRSFDTG |
Ga0134077_101848731 | 3300012972 | Grasslands Soil | MNKNITVVLLLVLAAGCSSKPQDGAYAPSMDPTRKVS |
Ga0134110_103984932 | 3300012975 | Grasslands Soil | MNKNITVFLLLVLAAGCSSTPQDGAYLPPMDPTRKVSKQDC |
Ga0134110_105117852 | 3300012975 | Grasslands Soil | MNKNITVVLLLVLAVGCSSKPQDGAYAPPMDSTRKVSEQDCSRSIDTD |
Ga0181613_10251331 | 3300014149 | Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water | MNKHITAVLLLLLAAGCSTAPQDGAFPPPLDPTRKVSEQEC |
Ga0180086_11194791 | 3300014883 | Soil | MNKIITVVLLLLAAGCSSKPQEAYAPPMDPGRKVSELDCSRESETG |
Ga0137420_12836202 | 3300015054 | Vadose Zone Soil | MNKNITVVLLLVLAAGCSSTPQDGAYPPPMDPTRK |
Ga0180081_11063071 | 3300015253 | Soil | MTKNITVVFLLLLAAGCSSKPQEAYAPPMDPGRKVSEL |
Ga0134089_103509333 | 3300015358 | Grasslands Soil | MNKNITVVLLLVLAAGCSSKPQDGAYAPRMDPTRKVSE |
Ga0184609_102697061 | 3300018076 | Groundwater Sediment | MNKNITVVLVLVLAAPCSSRSQDGAYVPPPMDPTRKVSRQV |
Ga0184628_107077061 | 3300018083 | Groundwater Sediment | MNKNMTALLLVLAAGCAQDGAYVPSMDPTRKVSEQDCSRPILDD |
Ga0190265_128262011 | 3300018422 | Soil | MNKNMTVVLILVLAAGCSSKPQEGAYPPPMDGSRKVIEQDCSRPIDT |
Ga0190264_122519561 | 3300019377 | Soil | MNNNKNITVVLVLVLAAGCSSSRRQEGDYVPPMSAGRMVSE |
Ga0193754_10056571 | 3300019872 | Soil | MSKNITVLLLLVFAAGCSTNPRDEGYPPMDPARKVSVQVCT |
Ga0193725_10363521 | 3300019883 | Soil | MNKNITVVLLLVLAAGCSTNPQDGAYPPMDPARKVSAQDCTR |
Ga0193717_11083363 | 3300020060 | Soil | MNKNITVVLLLALAAGCSSQPQDGVFVPPMDPSRMVSEQDCSRQID |
Ga0210380_101167261 | 3300021082 | Groundwater Sediment | MNKNMTALLLVLAAGCAQDGAYAPSMDPTRKVSEQDCSRPILDDRGGNL |
Ga0210362_15582622 | 3300021329 | Estuarine | MNKSITVVLLLVLAAGCSSTPRDEASAPPMDAARKV |
Ga0193699_102487681 | 3300021363 | Soil | MNKNITVVLLLVLAAGCSTNPRDEGYPPMDPARKVSVQVCTRQIDTTDGGNL |
Ga0224500_100631623 | 3300022213 | Sediment | MNKIITVVLLLLAAGCSSKPQDAYAPPLDPGRKVSELDC |
Ga0224512_100127737 | 3300022226 | Sediment | MKKYITVALLLVLAAGCSSKPRDGAYAPPMDPARRVSEQDC |
Ga0224452_11374421 | 3300022534 | Groundwater Sediment | MNKNITVVLVLVLAAPCSSGSQDGAYVPPPMDPTRKVS |
Ga0196962_103182382 | 3300024430 | Soil | MKKNMTVVVLLALAAGCSSTPQDGPSVPPMDPTRKVAEQDCS |
Ga0210112_10485551 | 3300025563 | Natural And Restored Wetlands | MNKSIAVVLLLVLAAGCSSTPRDEIYAPPMDEARKVSEQDCTGVIADD |
Ga0210075_10929671 | 3300025790 | Natural And Restored Wetlands | MNKRIAVALLLVLAAGCTSTPRDQVDVPPLDAARKVSEQD |
Ga0210143_10066263 | 3300025792 | Natural And Restored Wetlands | MNKSLSFVLLLALAAGCSSSPRDGAKVPPLDASRTVSE |
Ga0207660_108900541 | 3300025917 | Corn Rhizosphere | MNKNMTAVLVLVLGAGCSSTEYRAPPMDSSRKVSEQDCARTIGYDG |
Ga0209472_11038321 | 3300026323 | Soil | MNKTMTVVLVLVLAAPCSSRSQDGTYVPPLMDPARKVSRQVCTRIIH |
Ga0256805_10088782 | 3300026485 | Sediment | MHKNIIVVVLLLAAGCSSGPQEAYAPPMDPGRRVSELDCSRESDTGGNN |
Ga0209690_12180971 | 3300026524 | Soil | MNKNITVVLVLVLAAPCSSRSQVGAYVPPSLDPTRKVSRQVCTRIIHM |
Ga0209376_11789971 | 3300026540 | Soil | MNKNITVVLLLALAAGCSSKPQYGAYAPPMDSTRKV |
Ga0209474_102662481 | 3300026550 | Soil | MNKNITVVLLLVVAAGCSSTPQDGAYLPPMDPTRKVSEQECTKPIN |
Ga0209969_10151561 | 3300027360 | Arabidopsis Thaliana Rhizosphere | MNKKNMTVVLLLVLAAGCSSTPQEGADAPAMDPSRKVSEEDCS |
Ga0209968_10959722 | 3300027526 | Arabidopsis Thaliana Rhizosphere | MNKNKSIVLLVVVLAAGCSSRAPDGPYVPPMDPTRKIAEQDCAR |
Ga0209076_12023741 | 3300027643 | Vadose Zone Soil | MNKNITVVLVLVLAAPCSSGSQDGAYVPPPMDPTRKVSRQVC |
Ga0209592_12154011 | 3300027731 | Freshwater Sediment | MNKNITVVLLLVLAAGCSSRPQDGAYAPPMDPSRKVSEQDC |
Ga0209287_102159081 | 3300027792 | Freshwater Sediment | MNKNITVVLLLVLAAGCSSKPQDGAYAPPMDPSRKVSEQDCSRPFDT |
Ga0209590_108373351 | 3300027882 | Vadose Zone Soil | MNKNITVVLLLVLAAGCSSKPQDGAYAPPMDPTRKVSEQECSR |
Ga0209486_110844431 | 3300027886 | Agricultural Soil | MNKNITVVLLLVLAAGCSSKPQDGAYTSPMDPTRKVSEQDCSRAIDTDGGNL |
Ga0256864_11754991 | 3300027964 | Soil | MNKNVTVVLLLVLAAGCSSKPQDPYAVGEAYAPPMDPARRVSEQDCSRPIDTDGANL |
Ga0209705_100221911 | 3300027979 | Freshwater Sediment | MNKNITVVLLLVLAAGCSSKPQDGAYAPPMDPSRKVSEQDCSRPFDTD |
Ga0247821_102727081 | 3300028596 | Soil | MNKNITAVLLLVLAAGCSSNPRDGAPVPPMDATRKVSEQDCSRPI |
Ga0247821_110583291 | 3300028596 | Soil | MKKNITVVLLLVLAAGCSSTPRDGASAPPMDPTRKV |
Ga0307320_102018552 | 3300028771 | Soil | MNKNITVVLLLVLAAGCSTNPQDGAYPPMDPARKVSVQVCTRQIDATD |
Ga0307504_100642203 | 3300028792 | Soil | MNKNITVVLLLVLAAGCSTNPQDGAYPPMDPTRKVSVQVCIRQI |
Ga0247825_102652162 | 3300028812 | Soil | MKKNIAVVFLLVLAAGCSSNPREGAPVPPMDATRKVS |
Ga0307308_103072071 | 3300028884 | Soil | MNKNITVVLVLVLAAPCSSGSQDGAYVPPPMDPTRKVSR |
Ga0307468_1004000901 | 3300031740 | Hardwood Forest Soil | MNKKITVVLLLVLAAGCSSQPRDGAPVPSMDPTRKVSEQDCSR |
Ga0318558_100707391 | 3300032044 | Soil | MKKNVTVLLLLVLAAGCRSLDGDATPPPPPMDPSRKVSQQVCTRIL |
Ga0315912_103440231 | 3300032157 | Soil | MNKNISVVLLLLVLAAGCSSTPRDGANAPPMDPTRKV |
Ga0307471_1007132042 | 3300032180 | Hardwood Forest Soil | MNKNMTAVLFLVLAAGCGTQPRDEAYAPPMDPSRKVS |
Ga0307471_1016505101 | 3300032180 | Hardwood Forest Soil | MNKNIAALLLLVLAAGCASAPQDGANPPPMDPSRKVSEQDCSRST |
Ga0214472_101502571 | 3300033407 | Soil | MNKKIAVVLFLVLAAGCSSNPRDGAYAPPMDESRKVSEQDCTRPLDVDG |
Ga0214472_105052421 | 3300033407 | Soil | MNKNIAVVLFLVLAAGCSSNPRDGAYAPPMDESRKVSEQDCTRPLDVDG |
Ga0247829_100135491 | 3300033550 | Soil | MNKNIAVVLLLVLAAGCSAISQDGAPTPPMDATRKVSEQDCSRPVDTGGVGAPS |
Ga0247829_113451082 | 3300033550 | Soil | MNKNITTVVLVLLLAAGCSSKPRDEAPAAPMDPTRKVSEQDCSR |
Ga0364925_0106953_1_114 | 3300034147 | Sediment | MNKNITVVLLLVLAAGCVTQDGPSAPPMDPRRKVSEQD |
Ga0364933_131511_1_150 | 3300034150 | Sediment | MNKSITVVLLLVLAAGCGTNPQDGAYPMDPTRKVSVQDCTRQVDTTDGGN |
Ga0364934_0306146_497_601 | 3300034178 | Sediment | MNKNITVVLVLVLAAPCSSRSQDGVYVPPPMDPTR |
⦗Top⦘ |