NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073514

Metagenome / Metatranscriptome Family F073514

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073514
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 41 residues
Representative Sequence VSERVARSRELVARGFAAAAVARVLQITRQAIYRTPTPR
Number of Associated Samples 112
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 74.36 %
% of genes near scaffold ends (potentially truncated) 95.00 %
% of genes from short scaffolds (< 2000 bps) 94.17 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(14.167 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 35.82%    β-sheet: 0.00%    Coil/Unstructured: 64.18%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF01527HTH_Tnp_1 81.67
PF02371Transposase_20 4.17
PF08388GIIM 1.67
PF13276HTH_21 1.67
PF08241Methyltransf_11 0.83
PF13701DDE_Tnp_1_4 0.83
PF02401LYTB 0.83
PF02769AIRS_C 0.83
PF07702UTRA 0.83
PF07040DUF1326 0.83
PF13683rve_3 0.83
PF06253MTTB 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 4.17
COG07614-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspHLipid transport and metabolism [I] 1.67
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.83
COG5598Trimethylamine:corrinoid methyltransferaseCoenzyme transport and metabolism [H] 0.83

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.00 %
UnclassifiedrootN/A5.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908032|Perma_A_C_ConsensusfromContig54646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria805Open in IMG/M
2124908039|B3_v_NODE_25417_len_1351_cov_5_516654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales1401Open in IMG/M
2140918008|ConsensusfromContig126624Not Available1566Open in IMG/M
2170459009|GA8DASG02IHPLYAll Organisms → cellular organisms → Bacteria504Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101882225All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300001526|A105W1_1094039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia992Open in IMG/M
3300001537|A2065W1_10105642All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300002025|smpD1_1059456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia585Open in IMG/M
3300002071|JGIcombinedJ21915_10121578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1014Open in IMG/M
3300002072|JGIcombinedJ21914_10107058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia855Open in IMG/M
3300002184|JGI24770J26754_10052060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1786Open in IMG/M
3300002548|JGI24974J35850_1014803All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300002551|JGI24135J36437_1032083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia855Open in IMG/M
3300002568|C688J35102_119988163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli837Open in IMG/M
3300003312|P12013IDBA_1076650All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300003313|P32013IDBA_1094509All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300003992|Ga0055470_10034843All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300005904|Ga0075280_10145272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300005985|Ga0081539_10376263All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300005985|Ga0081539_10428373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia549Open in IMG/M
3300006578|Ga0074059_11798897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Actinotalea → Actinotalea ferrariae593Open in IMG/M
3300007004|Ga0079218_11895684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300009012|Ga0066710_101120721All Organisms → cellular organisms → Bacteria1217Open in IMG/M
3300009090|Ga0099827_11594957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia568Open in IMG/M
3300009789|Ga0126307_11151210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia628Open in IMG/M
3300009789|Ga0126307_11783899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales500Open in IMG/M
3300009809|Ga0105089_1081457All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300009840|Ga0126313_11150745All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300010045|Ga0126311_10976657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300010045|Ga0126311_11111533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales650Open in IMG/M
3300010166|Ga0126306_11442025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales570Open in IMG/M
3300010301|Ga0134070_10473789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales504Open in IMG/M
3300010329|Ga0134111_10552209Not Available511Open in IMG/M
3300010333|Ga0134080_10543444All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300010361|Ga0126378_11778171All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300010376|Ga0126381_101967086All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300011244|Ga0137483_118005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales511Open in IMG/M
3300011412|Ga0137424_1067972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales688Open in IMG/M
3300012014|Ga0120159_1203456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300012045|Ga0136623_10394109All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300012046|Ga0136634_10285034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia669Open in IMG/M
3300012187|Ga0136622_10041903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1955Open in IMG/M
3300012188|Ga0136618_10190981All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300012189|Ga0137388_10557189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae1065Open in IMG/M
3300012200|Ga0137382_10022406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium3651Open in IMG/M
3300012201|Ga0137365_10369513All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300012201|Ga0137365_10379499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1043Open in IMG/M
3300012204|Ga0137374_10885591All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300012204|Ga0137374_11117763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales559Open in IMG/M
3300012211|Ga0137377_11047901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia746Open in IMG/M
3300012353|Ga0137367_10853330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia630Open in IMG/M
3300012358|Ga0137368_10025317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5500Open in IMG/M
3300012358|Ga0137368_10511278All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300012680|Ga0136612_10443946All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300012925|Ga0137419_11431038All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300012951|Ga0164300_11072089All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300012975|Ga0134110_10456042All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300013011|Ga0169967_1043274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales823Open in IMG/M
3300013105|Ga0157369_11449492All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300013772|Ga0120158_10127021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1462Open in IMG/M
3300014311|Ga0075322_1130770All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300015264|Ga0137403_10044210All Organisms → cellular organisms → Bacteria4623Open in IMG/M
3300015374|Ga0132255_104255813All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300016341|Ga0182035_11624294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia583Open in IMG/M
3300016404|Ga0182037_11909956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae532Open in IMG/M
3300017657|Ga0134074_1229869All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300017695|Ga0180121_10104870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales1018Open in IMG/M
3300017695|Ga0180121_10278307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas carbonis632Open in IMG/M
3300017695|Ga0180121_10400454All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300018007|Ga0187805_10416130All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300018071|Ga0184618_10481440All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300018481|Ga0190271_12924875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales573Open in IMG/M
3300018482|Ga0066669_11836000All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300019356|Ga0173481_10756675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales532Open in IMG/M
3300020074|Ga0194113_10809713All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300020186|Ga0163153_10177974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1113Open in IMG/M
3300024430|Ga0196962_10084839All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300025314|Ga0209323_10629767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia599Open in IMG/M
3300025319|Ga0209520_10236428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1139Open in IMG/M
3300025322|Ga0209641_10628293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia744Open in IMG/M
3300025857|Ga0209014_10211207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia667Open in IMG/M
3300025915|Ga0207693_10720334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria772Open in IMG/M
3300026297|Ga0209237_1223451All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300026538|Ga0209056_10212512Not Available1404Open in IMG/M
3300027332|Ga0209861_1036069All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300027546|Ga0208984_1137976All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300027618|Ga0208736_1062562All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300027846|Ga0209180_10549380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria643Open in IMG/M
3300027882|Ga0209590_10666998All Organisms → cellular organisms → Bacteria667Open in IMG/M
(restricted) 3300028043|Ga0233417_10054367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1615Open in IMG/M
3300028578|Ga0272482_10170811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales654Open in IMG/M
3300028654|Ga0265322_10232962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300028705|Ga0307276_10159578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales578Open in IMG/M
3300028717|Ga0307298_10206587All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300028778|Ga0307288_10296105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria643Open in IMG/M
3300028819|Ga0307296_10750303All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300028884|Ga0307308_10658116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300028885|Ga0307304_10570205All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300031170|Ga0307498_10218279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia675Open in IMG/M
3300031234|Ga0302325_11612835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria827Open in IMG/M
3300031470|Ga0272432_1017511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces5671Open in IMG/M
3300031572|Ga0318515_10664372All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300031680|Ga0318574_10634897All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300031731|Ga0307405_12117279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales505Open in IMG/M
3300031747|Ga0318502_10831313All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300031763|Ga0318537_10258962All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300031779|Ga0318566_10445996All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300031834|Ga0315290_11475701All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300031949|Ga0214473_11419203All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300031965|Ga0326597_11687907All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300032005|Ga0307411_12043932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales535Open in IMG/M
3300032256|Ga0315271_11499006All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300032423|Ga0325352_122818All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300032438|Ga0325391_109103All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300032896|Ga0335075_11704643All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300033290|Ga0318519_10930197All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300033432|Ga0326729_1076467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.17%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand7.50%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.17%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.33%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.33%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil2.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.50%
Polar DesertEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert1.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.67%
Ore Pile And Mine Drainage Contaminated SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Ore Pile And Mine Drainage Contaminated Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.67%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.67%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.67%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.67%
Plant BiomassHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Plant Biomass1.67%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.83%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.83%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.83%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.83%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.83%
Permafrost And Active Layer SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil0.83%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.83%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.83%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.83%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.83%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.83%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.83%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock0.83%
RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
2124908039Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4EnvironmentalOpen in IMG/M
2140918008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
2170459009Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cmEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001526Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-5cm-1A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002025Permafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_D1EnvironmentalOpen in IMG/M
3300002071Barrow Graham LP Ref core NGADG0011-312 (Barrow Graham LP Ref core NGADG0011-312,NGADG0011-212, ASSEMBLY_DATE=20131010)EnvironmentalOpen in IMG/M
3300002072Barrow Graham LP Ref core NGADG0011-211 (Barrow Graham LP Ref core NGADG0011-211,NGADG0004-312, ASSEMBLY_DATE=20131005)EnvironmentalOpen in IMG/M
3300002184Freshwater and sediment microbial communities from Lake Erie, CanadaEnvironmentalOpen in IMG/M
3300002548Polar desert microbial communities from Antarctic Dry Valleys - UQ255EnvironmentalOpen in IMG/M
3300002551Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003312Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P1 sampleEnvironmentalOpen in IMG/M
3300003313Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P3 sampleEnvironmentalOpen in IMG/M
3300003992Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1EnvironmentalOpen in IMG/M
3300005904Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404EnvironmentalOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009809Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011244Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 18 - S13.2.60.3.a - transect 2, repeat 3, age 113 years, surface depth)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012046Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)EnvironmentalOpen in IMG/M
3300012187Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06)EnvironmentalOpen in IMG/M
3300012188Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013011Gypsum crust endolithic microbial communities from the Atacama Desert, Chile - KM37EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017695Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020186Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1EnvironmentalOpen in IMG/M
3300024430Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20EnvironmentalOpen in IMG/M
3300025314Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025857Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027332Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027546Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027618Polar desert microbial communities from Antarctic Dry Valleys - UQ255 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300028578Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0EnvironmentalOpen in IMG/M
3300028654Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaGHost-AssociatedOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031470Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley nordEnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032423Metatranscriptome of lab enriched sorghum-adapted microbial communities from California, United States - SM_Day2_7 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032438Metatranscriptome of lab enriched sorghum-adapted microbial communities from California, United States - WT_Day14_7 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033432Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Perma_A_C_026721402124908032SoilVIKEGLGVNERVTRSRELVARGFAAASVTRVLQISRQAVY
B3_v_003333602124908039SoilVSVRVARSRRLVAEGYALATVARVLKVSRQALYRTPKPRTVPQRRP
Bog_all_C_040652202140918008SoilVSVRVARSRDLVAAGYPLSAVARAARISRQALYRTPK
F47_108361702170459009Grass SoilVRERVARSRELVARGFALAAVTRVLQVSRQAVYRVPAPRRPPQRRPP
INPhiseqgaiiFebDRAFT_10188222513300000364SoilVRQRVARSRELIAEGHSPSVVARVALISRQALYRVPTPRRLPQRRPPAD
A105W1_109403913300001526PermafrostVRERVARSRVLVARGYAVAAVARVLKVSRQAIYRTPRPR
A2065W1_1010564213300001537PermafrostVRQRVARSRELVAEGHSPSLVARVAQITRQAIYRTPKTQP
smpD1_105945613300002025Permafrost And Active Layer SoilVSVRVARSRVLVAEGDALATVARVMQITRQALYRVPKPRNPPD
JGIcombinedJ21915_1012157813300002071Arctic Peat SoilVRVAQARVLVAQGETLAAVARVMQISRQAVYRTPRPAGAHRSAGR
JGIcombinedJ21914_1010705813300002072Arctic Peat SoilVRVAQARVLVAQGETLAAVARVMQISRQAVYRTPRP
JGI24770J26754_1005206043300002184Freshwater And SedimentVRQRVARSRDLVAAGYKPAAVARVSQISRQAIYRTPTTTPSAARRSRPP
JGI24974J35850_101480333300002548Polar DesertMRVARSRSRELVAQGRPAAVVARVAGISRQAIYRRPKRPADGAA
JGI24135J36437_103208313300002551Arctic Peat SoilVGVSVRVAQARVLVAQGETLAAVARVMQISRQAVYRTPRP
C688J35102_11998816313300002568SoilMRVTRPRELVAEGYRPSAVARVAQISRQAIYRVPKPRRAPPSPSR
P12013IDBA_107665033300003312Ore Pile And Mine Drainage Contaminated SoilVSERVARSRELVARGFPLAAVTRVLQVSRQAVYRTPKPRTA
P32013IDBA_109450913300003313Ore Pile And Mine Drainage Contaminated SoilVSERVARSRELVARGFPLAAVTRVLQVSRQAVYRTPKPRTAPQRRRPA
Ga0055470_1003484313300003992Natural And Restored WetlandsVSERVARSRELVARGFAAATVARVLQITRQAIYRTPTPRSVPQRR
Ga0075280_1014527213300005904Rice Paddy SoilVSERVARSRELVARGFAAATVARVLQISRQAIYRTPRPRTVPQRRSPA
Ga0081539_1037626313300005985Tabebuia Heterophylla RhizosphereVSERVTRSRELVAQGRPAAVVARVAGISRQAIYRRPR
Ga0081539_1042837323300005985Tabebuia Heterophylla RhizosphereVSERVARSRELVARGFAVAAVARVLQVSRQALYRTPTPRRPPP
Ga0074059_1179889723300006578SoilVRLRVARSRELVAEGHSPSVVARVALVSRQALYRTPKPRTVPQRRPPT
Ga0079218_1189568423300007004Agricultural SoilMRVTRSRELVAEGYRPSAVARVAQISRQAIYRVPKPRRSPAAPAR
Ga0099791_1030475833300007255Vadose Zone SoilVSERVARSRELVAGGFAAAAVARVMQITRQAIYRTPTPRAVPQRRPPADAVE
Ga0066710_10112072133300009012Grasslands SoilMRVAQSRVLVAEREAAAAVMRVMQISRQALYRTPK
Ga0099827_1159495723300009090Vadose Zone SoilVSERVARSRELVARGFAAAAVALVLQITRQAIYRTPTPRSVPQRR
Ga0126307_1115121033300009789Serpentine SoilVTQRVARSRDLVAEGHSPSVVARVAHVSRQALYRVPRPR
Ga0126307_1178389913300009789Serpentine SoilVSERVTYARELVAAGHRPAVVARILQISRQAIFRIPKPRRPLA
Ga0105089_108145723300009809Groundwater SandVSERVARSRVLVARGRKLAVVARVMQVSRQAIYRTP
Ga0126313_1115074513300009840Serpentine SoilVKLRVARARELVARGRRAAVVARVLQISRQAIYRTPKPRR
Ga0126311_1097665713300010045Serpentine SoilVSQRVARSRELVAEGESPSVVARVAQISRQAIYRIPKTRPPAARRSAP
Ga0126311_1111153323300010045Serpentine SoilVSERVTRSRELVAQGRPVAVVSRVAGISRQAIYRRPRRPPR
Ga0126306_1144202523300010166Serpentine SoilVSGRVTYARELAAAGHRPAVVARILQISRQAIYRVPKP
Ga0134070_1047378923300010301Grasslands SoilVSTRVTRSRELVARGFAVAAVARVLQISRQALYRTPAPRTVPQRR
Ga0134111_1055220923300010329Grasslands SoilVSERVARSRELVARGFAAAAVARVMQISRQALYRTPTARRPPQRRPVSEP
Ga0134080_1054344423300010333Grasslands SoilMRVARSRELVARGFAVAAVARVMQISRQALYRTPMPR
Ga0126378_1177817133300010361Tropical Forest SoilVSERVARSRELVDRGFKLAAVARVLQVTRQAIYRVPKPRRAPDA*
Ga0126381_10196708633300010376Tropical Forest SoilVRERVARSRELVARGFRVAAVTRVLQVSRQAVYRTPTPRRPPQRRPA
Ga0137483_11800513300011244Glacier Forefield SoilMRVTRSRELVAAGYRPAAVARVAQISRQAIYRKPRSRRVP
Ga0137393_1117053213300011271Vadose Zone SoilVSVRVAQARVLVAEGEVLAVVARVMQISRQAVYRRPRPRRSPQRRPVT
Ga0137424_106797213300011412SoilMRVTRSRELVAEGYRPSAVARVAQISRQAIYRTPKPRRAPASPQKRPADRV
Ga0120159_120345613300012014PermafrostVSVRVARSRRLVAEGYPLASVARVLQVSRQALYRTPTPRRAPQRRRPADL
Ga0136623_1039410923300012045Polar Desert SandVRQRVARSRELVAEGHSPSVVARVALISRQAIYRTPT
Ga0136634_1028503433300012046Polar Desert SandVRVRVARSRELVAAGFACAAVARVMQVSRQALYRVPA
Ga0136622_1004190313300012187Polar Desert SandMRVTRSRELVAEGYRPSAVARVAQISRQAIYRIPKPR
Ga0136618_1019098113300012188Polar Desert SandVTERVAFARELVGRGRKVAPVARVLQISRQAIYRT
Ga0137388_1055718933300012189Vadose Zone SoilVRQRVARSRELVAEGHAPSVVARVAQISRQALYRVPRPRTMPR
Ga0137382_1002240643300012200Vadose Zone SoilVSERVTRSRELVARGFAVATVARVLQISRQALYRTP
Ga0137365_1036951323300012201Vadose Zone SoilMRVARSRELVARGFAAAAVARVMQISRQALYRTPTPR
Ga0137365_1037949923300012201Vadose Zone SoilMRVARSRELVARGFAVAAVARVMQISRQALYRTPMPRGPL*
Ga0137374_1088559123300012204Vadose Zone SoilVSERVARSRELVARGFAAAAVARVMQITRQAIHRRPTPPT
Ga0137374_1111776313300012204Vadose Zone SoilVRERVARSRELVARGLAVATVARVMQISRQALYRTPTP
Ga0137377_1104790113300012211Vadose Zone SoilVSERVARSRELVARGFAAAAVARVLQITRQAIYRTPT
Ga0137367_1085333013300012353Vadose Zone SoilVRVARSRELVARGFAVAAVTRVLQVSRQAVYRTPSPRRPPQ
Ga0137368_1002531783300012358Vadose Zone SoilVRERVARSRELVARGLAVATVARVMQISRQALYRTPTPRRPP
Ga0137368_1051127823300012358Vadose Zone SoilVSERVARSRELVARGFAVAAVARVLQITRQAIYRTPTPRRVPQRRPP
Ga0136635_1023681533300012530Polar Desert SandMQRVAFARELVGRGRKVAPVARTLQISRAAIYRTPKPRRSPQRRPPQ
Ga0136612_1044394613300012680Polar Desert SandVSERVARSRELVARGFAAASVARVLQITRQAIYRIPTPRTVPPRRPLAD
Ga0137419_1143103813300012925Vadose Zone SoilVSERVARSRELVAGGFAATAVARVMQITRQAIYRTPTPR
Ga0164300_1107208923300012951SoilVTQRVARSRHLVAEGHSPSAVARVARISRQALYRTPR
Ga0134110_1045604223300012975Grasslands SoilVRQRVARSRELVAEGHPPSVVARVARITRQALYRTPRPRA
Ga0169967_104327413300013011RockMRVARSRELVAQGRPAALVARVAGISRQAIYRRPRRPPKGQ
Ga0157369_1144949213300013105Corn RhizosphereVSVRVARSRRLVAEGYALATVARVMQVSRQAIYRTPKPRVAPQ
Ga0120158_1012702123300013772PermafrostVIKERLGVNERVTRSRELVAPGFAAATVTRVLQISR
Ga0075322_113077023300014311Natural And Restored WetlandsVSERVARSRELVARGFAAATVARVLQITRQAIYRTP
Ga0137403_1004421013300015264Vadose Zone SoilVSERVARSRELVARGFAVAAVARVLQITRQAIYRTPT
Ga0132255_10425581313300015374Arabidopsis RhizosphereVRERVTRSRELVARGFAVAAVTRVLQVSRQAVYRTPTPRTVPQRRPPVDP
Ga0182035_1162429423300016341SoilVRVAQARVLVAEGEALAGVARVMQISRQAVYRRPR
Ga0182037_1190995623300016404SoilGGSIARLGVSERVARSRELVDRGHKVAVVARGLQVTRQAIYRVPRPRRAPESRS
Ga0134074_122986913300017657Grasslands SoilVSVRVARSRELVARGFAAAAVARVMQISRQALYRTPTARRPPQRRP
Ga0180121_1010487033300017695Polar Desert SandVRQRVARARELVDSGRKAAVVARVLQISRQAIYRTP
Ga0180121_1027830723300017695Polar Desert SandVRERVARSRVLVARGRKPAVVARVMQITRQAIYRTPK
Ga0180121_1040045413300017695Polar Desert SandVRVRVARSRELVARGFAAAAVARVMQVSRQALYRTPT
Ga0187805_1041613033300018007Freshwater SedimentVRERVARSRELVAKGYALAAVARVLQVTRQALYRTPKPRC
Ga0184618_1048144023300018071Groundwater SedimentVRVARSRELVAKGYALATVARVLQVTRQAIYRTPK
Ga0190271_1292487523300018481SoilMRVTRSRELVAEGHSPSAVSRVAQISRQAIYRVPTTR
Ga0066669_1183600013300018482Grasslands SoilVRRRVARSRELVARGFAVAVVVRVMQISRQTLYRTPPRRRP
Ga0173481_1075667513300019356SoilMRVTRSRELVAEGYRPSAVARVAQISRHAMYRVPKPRRAPDSASR
Ga0194113_1080971323300020074Freshwater LakeVTERVAFARDLVGRGRKVAPVARTLQITRQAIYRTPKPRRAPQ
Ga0163153_1017797413300020186Freshwater Microbial MatVRERVARSRQLVARGRKPAVVARVMQISRQAIYRT
Ga0196962_1008483933300024430SoilMRVTRSRELVAEGYRPSAVARVAQISRQAIYRTPKP
Ga0209323_1062976723300025314SoilVSERVARSRELVAGGFAAAVVARVLQISRQAIYRTPTPRRP
Ga0209520_1023642833300025319SoilVSERVARSRELVAGGFAAAVVARVLQISRQAIYRTPTPRRPPLRR
Ga0209641_1062829313300025322SoilVSERVARSRELVAGGFAAAVVARVLQISRQAIYRTPTPRRPPL
Ga0209014_1021120723300025857Arctic Peat SoilVRVAHARVLVAEGEALAAVARVMQISRQALYRTPKP
Ga0207693_1072033413300025915Corn, Switchgrass And Miscanthus RhizosphereVNVRVARSRELVARGFALAAVTRVLQVSRQAVYRTPTPRRPPQRRPPADP
Ga0209237_122345123300026297Grasslands SoilVSERVARSRELVARGFAAAAVARVMQITRQAIYRVPTPRTAPQRRPVRD
Ga0209056_1021251213300026538SoilVSVRVARSRELVARGFAAAAVARVMQISRQALYRT
Ga0209861_103606923300027332Groundwater SandVRVRVARSRELVARGFAAAAVARVMQISRQALYRVPTPRTV
Ga0208984_113797623300027546Forest SoilVSERVARSRELVARGFAAAAVARVLQITRQAIYRTPTPRTV
Ga0208736_106256213300027618Polar DesertMATRVGMCVTRSRELVAEGYALAAVARVAQITRQAIYRKP
Ga0209180_1054938023300027846Vadose Zone SoilMRVARSRELVARGFAVAAVARVLQISRQALYRTPTPRTVPQRRPAV
Ga0209590_1066699813300027882Vadose Zone SoilVSERVARSRELVARGFAAAAVARVMQITRQALYRV
(restricted) Ga0233417_1005436713300028043SedimentVSERVARSRELVARGFAAATAARVLQISRQAVYRTP
Ga0272482_1017081113300028578SoilMRVTRSRELVAEGYYSPSVVARVAQISRQAIYRVPKSRPAAARRGLS
Ga0265322_1023296213300028654RhizosphereVELSVRVARSRDLVAAGYPLSAVARAARISRQALYRTPKPRR
Ga0307276_1015957813300028705SoilMRVTRSRELVAEGYRPSVVARVAQISRQAIYRVPKPR
Ga0307298_1020658723300028717SoilVNERVARSRELVARGFAAATVTRVLQVSRQAVYRTPTPRTVPQRRPVTD
Ga0307288_1029610513300028778SoilVSQRVARSRELVAQGRPAALVARVAGISRQAIYRRPAR
Ga0307296_1075030313300028819SoilVRQRVARSRDLVAEGHSPSLVARVAQVSRQALYRT
Ga0307308_1065811623300028884SoilMRVTRSRELVAEGYRPSVVARVAQISRQAIYRVPKPRRQPASP
Ga0307304_1057020513300028885SoilVSERVARSRELVARGFAAAAVARVLQITRQAIYRTPTPR
Ga0307498_1021827913300031170SoilVSKRVARMLVAEGEALAAVARVLQISRQAVYRTPRPR
Ga0302325_1161283513300031234PalsaVRERVARSRVMAARGRKVAVVARVMQISRQAIYRTPKT
Ga0272432_101751173300031470RockMRVTRSRELVAEGYALSAVARVAQITRQAIYRTPKPRAAPQRRPVS
Ga0318515_1066437223300031572SoilVTKRVAYARELAAAGHRPAVVARVLQISRQAIYRVPRPRKSP
Ga0318574_1063489713300031680SoilVTKRVAYARELAAAGHRPAVVARVLQISRQAIYRVPHGLASHRT
Ga0307405_1211727913300031731RhizosphereMRVTRSRELVAEGFRPAAVARVAQISRQAIYRTPRP
Ga0318502_1083131323300031747SoilVTKRVAYARELAAAGHRPAVVARVLQISRQAIYRVPH
Ga0318537_1025896233300031763SoilVRERVARSRQLIAKGYARASVARVMQITRQALYRTPQPRTA
Ga0318566_1044599633300031779SoilVRERVARSRQLIAKGYARASVARVMQITRQALYRTPQPR
Ga0315290_1147570113300031834SedimentVNERVTRSRELIARGFTAASVTRVLQISRQAVYRV
Ga0214473_1141920333300031949SoilVRERVARSRQLVASGRKVAIVARVMQVSRQAIYRTPKRRTDPGP
Ga0326597_1168790723300031965SoilVRQRVARSRELIAEGYRPSAVARVAKISRQALYRRPQPRAAPQRR
Ga0307411_1204393223300032005RhizosphereVRVTRSRELVAEGFRPAAVARVAQISRQAIYRTPK
Ga0315271_1149900613300032256SedimentVSVRVVRSRELVAAGYPAATVARVALVSRQALYRVPKPRSLPQRRAP
Ga0325352_12281823300032423Plant BiomassVSQRVTHARQLVAEGHSPSVVARVMQISRQAIYRTPKPRRSPQRRPASL
Ga0325391_10910313300032438Plant BiomassVSQRVTHARQLVAEGHSPSVVARVMQISRQAIYRTPKPRRSPQRRP
Ga0335075_1170464323300032896SoilVTVRVARSRDLVAEGHSPSLVARVAQISRQALYRTPTPRQPPLRRPPADPI
Ga0318519_1093019723300033290SoilVTKRVAYARELAAAGHRPAVVARVLQISRQAIYRV
Ga0326729_107646713300033432Peat SoilMRVTRSRELVAEGHSPSVVARVAQISRQAIYRIPKTRPPAARRA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.