Basic Information | |
---|---|
Family ID | F072476 |
Family Type | Metagenome |
Number of Sequences | 121 |
Average Sequence Length | 51 residues |
Representative Sequence | MTLRIKSKKILIPDVPPPSARTTKQGLVIAGIGAFCASVVVAAALFVFFGA |
Number of Associated Samples | 112 |
Number of Associated Scaffolds | 121 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 37.19 % |
% of genes near scaffold ends (potentially truncated) | 27.27 % |
% of genes from short scaffolds (< 2000 bps) | 66.94 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.430 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands (6.612 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.835 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (28.099 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.97% β-sheet: 0.00% Coil/Unstructured: 62.03% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 121 Family Scaffolds |
---|---|---|
PF05168 | HEPN | 20.66 |
PF08239 | SH3_3 | 8.26 |
PF00701 | DHDPS | 8.26 |
PF00535 | Glycos_transf_2 | 3.31 |
PF09586 | YfhO | 3.31 |
PF01738 | DLH | 1.65 |
PF08241 | Methyltransf_11 | 0.83 |
PF00398 | RrnaAD | 0.83 |
PF02120 | Flg_hook | 0.83 |
PF13701 | DDE_Tnp_1_4 | 0.83 |
PF00857 | Isochorismatase | 0.83 |
PF13231 | PMT_2 | 0.83 |
PF13633 | Obsolete Pfam Family | 0.83 |
PF02597 | ThiS | 0.83 |
PF00990 | GGDEF | 0.83 |
PF12762 | DDE_Tnp_IS1595 | 0.83 |
PF07592 | DDE_Tnp_ISAZ013 | 0.83 |
COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
---|---|---|---|
COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 20.66 |
COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 20.66 |
COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 16.53 |
COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.83 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.83 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.83 |
COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.83 |
COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.83 |
COG3144 | Flagellar hook-length control protein FliK | Cell motility [N] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.43 % |
Unclassified | root | N/A | 11.57 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918013|NODE_12420_length_1404_cov_6.893162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1436 | Open in IMG/M |
2162886013|SwBSRL2_contig_5622444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1793 | Open in IMG/M |
2199352025|deepsgr__Contig_3948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 945 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0799783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2478 | Open in IMG/M |
3300000559|F14TC_100722671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3251 | Open in IMG/M |
3300000891|JGI10214J12806_11245224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 594 | Open in IMG/M |
3300003324|soilH2_10102756 | All Organisms → cellular organisms → Bacteria | 5550 | Open in IMG/M |
3300003324|soilH2_10289512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2126 | Open in IMG/M |
3300003987|Ga0055471_10022464 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
3300003992|Ga0055470_10109778 | Not Available | 690 | Open in IMG/M |
3300004049|Ga0055493_10020331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1060 | Open in IMG/M |
3300004052|Ga0055490_10000789 | All Organisms → cellular organisms → Bacteria | 4604 | Open in IMG/M |
3300004114|Ga0062593_102202373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 617 | Open in IMG/M |
3300004157|Ga0062590_100902723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 827 | Open in IMG/M |
3300004463|Ga0063356_100310898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1961 | Open in IMG/M |
3300004463|Ga0063356_100932909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1230 | Open in IMG/M |
3300004463|Ga0063356_101417280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1024 | Open in IMG/M |
3300004463|Ga0063356_101582939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 974 | Open in IMG/M |
3300004463|Ga0063356_105320739 | Not Available | 553 | Open in IMG/M |
3300004480|Ga0062592_100390270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1102 | Open in IMG/M |
3300004643|Ga0062591_100082322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2003 | Open in IMG/M |
3300004778|Ga0062383_10072220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1416 | Open in IMG/M |
3300004779|Ga0062380_10033985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1634 | Open in IMG/M |
3300004780|Ga0062378_10254805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
3300004781|Ga0062379_10207204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
3300004782|Ga0062382_10354297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 682 | Open in IMG/M |
3300005171|Ga0066677_10123472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1395 | Open in IMG/M |
3300005294|Ga0065705_10066404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 842 | Open in IMG/M |
3300005336|Ga0070680_100077590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2736 | Open in IMG/M |
3300005445|Ga0070708_100743635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 922 | Open in IMG/M |
3300005446|Ga0066686_10011286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4660 | Open in IMG/M |
3300005458|Ga0070681_10249441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1688 | Open in IMG/M |
3300005529|Ga0070741_10000285 | All Organisms → cellular organisms → Bacteria | 193150 | Open in IMG/M |
3300005530|Ga0070679_100094319 | All Organisms → cellular organisms → Bacteria | 2979 | Open in IMG/M |
3300005836|Ga0074470_10322290 | All Organisms → cellular organisms → Bacteria | 10216 | Open in IMG/M |
3300005836|Ga0074470_11378441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2760 | Open in IMG/M |
3300005841|Ga0068863_100397727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1347 | Open in IMG/M |
3300005874|Ga0075288_1000964 | All Organisms → cellular organisms → Bacteria | 3769 | Open in IMG/M |
3300005886|Ga0075286_1000753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4264 | Open in IMG/M |
3300005895|Ga0075277_1010744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1197 | Open in IMG/M |
3300006224|Ga0079037_102642002 | Not Available | 500 | Open in IMG/M |
3300006797|Ga0066659_11604348 | Not Available | 547 | Open in IMG/M |
3300006845|Ga0075421_101910728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 635 | Open in IMG/M |
3300006876|Ga0079217_10003988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4283 | Open in IMG/M |
3300006894|Ga0079215_10012742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2619 | Open in IMG/M |
3300006903|Ga0075426_10047115 | All Organisms → cellular organisms → Bacteria | 3081 | Open in IMG/M |
3300006904|Ga0075424_101684405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 672 | Open in IMG/M |
3300006918|Ga0079216_10662597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 734 | Open in IMG/M |
3300009053|Ga0105095_10138328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1327 | Open in IMG/M |
3300009078|Ga0105106_10439018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 940 | Open in IMG/M |
3300009143|Ga0099792_11210830 | Not Available | 513 | Open in IMG/M |
3300009156|Ga0111538_10730545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1254 | Open in IMG/M |
3300009597|Ga0105259_1042873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 996 | Open in IMG/M |
3300009678|Ga0105252_10028309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2039 | Open in IMG/M |
3300010040|Ga0126308_10997694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 587 | Open in IMG/M |
3300010362|Ga0126377_10068362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3153 | Open in IMG/M |
3300010373|Ga0134128_11875846 | Not Available | 660 | Open in IMG/M |
3300010401|Ga0134121_10107019 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 2350 | Open in IMG/M |
3300010403|Ga0134123_10029443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3984 | Open in IMG/M |
3300010938|Ga0137716_10009018 | All Organisms → cellular organisms → Bacteria | 19531 | Open in IMG/M |
3300011431|Ga0137438_1098936 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300011434|Ga0137464_1141637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 723 | Open in IMG/M |
3300012208|Ga0137376_10001856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 12190 | Open in IMG/M |
3300012349|Ga0137387_10586693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 808 | Open in IMG/M |
3300012349|Ga0137387_10932345 | Not Available | 626 | Open in IMG/M |
3300012503|Ga0157313_1046847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
3300012685|Ga0137397_10010561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Croceibacterium → Croceibacterium atlanticum | 6423 | Open in IMG/M |
3300012922|Ga0137394_11341717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
3300012927|Ga0137416_10748101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 861 | Open in IMG/M |
3300012960|Ga0164301_10205833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1258 | Open in IMG/M |
3300012972|Ga0134077_10017482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2427 | Open in IMG/M |
3300014263|Ga0075324_1131796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 563 | Open in IMG/M |
3300014317|Ga0075343_1098008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 665 | Open in IMG/M |
3300017930|Ga0187825_10006120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4024 | Open in IMG/M |
3300017997|Ga0184610_1137804 | Not Available | 795 | Open in IMG/M |
3300018054|Ga0184621_10092280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1063 | Open in IMG/M |
3300018061|Ga0184619_10167826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1005 | Open in IMG/M |
3300018081|Ga0184625_10026904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2795 | Open in IMG/M |
3300018084|Ga0184629_10480769 | Not Available | 649 | Open in IMG/M |
3300018422|Ga0190265_11267926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 854 | Open in IMG/M |
3300018433|Ga0066667_11174361 | Not Available | 667 | Open in IMG/M |
3300018469|Ga0190270_12046962 | Not Available | 631 | Open in IMG/M |
3300021073|Ga0210378_10015887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3080 | Open in IMG/M |
3300022309|Ga0224510_10149424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1375 | Open in IMG/M |
3300022756|Ga0222622_10254590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1191 | Open in IMG/M |
3300025559|Ga0210087_1003997 | All Organisms → cellular organisms → Bacteria | 3425 | Open in IMG/M |
3300025912|Ga0207707_10088117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2711 | Open in IMG/M |
3300025912|Ga0207707_10229880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1614 | Open in IMG/M |
3300025921|Ga0207652_10108095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2464 | Open in IMG/M |
3300025925|Ga0207650_10888759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 756 | Open in IMG/M |
3300025951|Ga0210066_1002519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2399 | Open in IMG/M |
3300025964|Ga0210127_1011673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 985 | Open in IMG/M |
3300025971|Ga0210102_1031427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1145 | Open in IMG/M |
3300026058|Ga0208421_1010062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 815 | Open in IMG/M |
3300026320|Ga0209131_1105861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1476 | Open in IMG/M |
3300026327|Ga0209266_1273120 | Not Available | 535 | Open in IMG/M |
3300027639|Ga0209387_1004448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2397 | Open in IMG/M |
3300027691|Ga0209485_1026860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1362 | Open in IMG/M |
3300027691|Ga0209485_1351324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
3300027715|Ga0208665_10239037 | Not Available | 571 | Open in IMG/M |
3300027735|Ga0209261_10135094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 651 | Open in IMG/M |
3300027815|Ga0209726_10055500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2701 | Open in IMG/M |
3300027831|Ga0209797_10238900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 765 | Open in IMG/M |
3300027843|Ga0209798_10043236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2365 | Open in IMG/M |
3300027909|Ga0209382_10048395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 5072 | Open in IMG/M |
3300028145|Ga0247663_1090806 | Not Available | 551 | Open in IMG/M |
3300030006|Ga0299907_10945009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 638 | Open in IMG/M |
3300031226|Ga0307497_10235017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 811 | Open in IMG/M |
3300031229|Ga0299913_10342017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1484 | Open in IMG/M |
3300031446|Ga0170820_14462644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 776 | Open in IMG/M |
3300031538|Ga0310888_10722896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 612 | Open in IMG/M |
3300031547|Ga0310887_10393905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 814 | Open in IMG/M |
3300031548|Ga0307408_100064894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2676 | Open in IMG/M |
3300031731|Ga0307405_10051755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2550 | Open in IMG/M |
3300031740|Ga0307468_100957243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 748 | Open in IMG/M |
3300031908|Ga0310900_11102334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 657 | Open in IMG/M |
3300033417|Ga0214471_10474948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1002 | Open in IMG/M |
3300033433|Ga0326726_10038094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4193 | Open in IMG/M |
3300033475|Ga0310811_10021687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8490 | Open in IMG/M |
3300034194|Ga0370499_0082378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 790 | Open in IMG/M |
3300034257|Ga0370495_0128724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 796 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 6.61% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 6.61% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.96% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.96% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.13% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 4.13% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.13% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.31% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.48% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.48% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.48% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.65% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.65% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.65% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.65% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.65% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.65% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.83% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.83% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.83% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.83% |
Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment | 0.83% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.83% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.83% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
3300004049 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 | Environmental | Open in IMG/M |
3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
3300004781 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh | Environmental | Open in IMG/M |
3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010938 | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 | Environmental | Open in IMG/M |
3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025951 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025964 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026058 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
3300027735 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300034194 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17 | Environmental | Open in IMG/M |
3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Iowa-Corn-GraphCirc_00859090 | 2140918013 | Soil | MALRVKSRKILIPDVRPPVGEATTYQGLVIAGIGVFCGSVVIAAVLFVFLGV |
SwBSRL2_0708.00006000 | 2162886013 | Switchgrass Rhizosphere | MAIQFGRAKKIPIPDVPSPDARESEAGLVIAGIGIFCASVVIAAMVFVFLA |
deepsgr_00318480 | 2199352025 | Soil | MTLRIKSKKILIPDVPPPSAHTTKQGLVIAGIGAFCASVVVTAALFXXXGA |
ICChiseqgaiiDRAFT_07997833 | 3300000033 | Soil | MAIHFGRAKKIPIPDVPPPDARESEAGLVIAGIGIFCASVVIAAMVFVFLA* |
F14TC_1007226711 | 3300000559 | Soil | MTLKSNARKILIPDVPPPRAMHEDWVIAGIGLFCATFVIAALVVVFFGA* |
JGI10214J12806_112452242 | 3300000891 | Soil | MALRARPRKILIPDVPPVVRSTPKQGLVIAGIGVFCMSMVIAAVLFVFFGA* |
soilH2_101027566 | 3300003324 | Sugarcane Root And Bulk Soil | MMLRMKSKKILISDMPPPSMRDARQSLVIAGIGALCASVVIAAVLFVFFGA* |
soilH2_102895123 | 3300003324 | Sugarcane Root And Bulk Soil | VTLRRKRKKILIPDVPPPIAGGAKQRLVIAGIGAFCASVVIAAVLFVFFGA* |
Ga0055471_100224642 | 3300003987 | Natural And Restored Wetlands | MALRVKSRKILIPDVPPVGESTTYQGLVIAGIGVFCGSVVIAAVLFVFLGV* |
Ga0055470_101097781 | 3300003992 | Natural And Restored Wetlands | MALRVKSRKILIPDVPPVAKSTTYQGLVIAGIGVFCGSVVIAAVLFVFLGV* |
Ga0055493_100203312 | 3300004049 | Natural And Restored Wetlands | MTLPFSKTKKILIPDVPPLSARETEAGIVITGIGIFCAAVVIAAMLFVFLGA* |
Ga0055490_100007892 | 3300004052 | Natural And Restored Wetlands | MTLPFSKTKKILIPDVPPLSARETEAGIVIAGIGIFCAAVVIAAMLFVFLGA* |
Ga0062593_1022023731 | 3300004114 | Soil | MILPFIKTKKILIPDVPPSSGREQEAGIVIAGIGIFCASVVIAAML |
Ga0062590_1009027232 | 3300004157 | Soil | MAIQFGRAKKIPIPDVPSPDARESEAGLVIAGIGIFCASVVIAAMVFVFLA* |
Ga0063356_1003108982 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MALPLRTKSRRILIPDVSPAVKTITRQGVVIAGIGVFCATVVIVAVLFVFLGA* |
Ga0063356_1009329092 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MILPFIKTKKILIPDVPPSSGREQEAGIVIAGIGIFCASVVIAAMLFVFLGS* |
Ga0063356_1014172803 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MALRVKSRKILIPDVRPPVGEATTYQGLVIAGIGVFCGSVVIAAVLFVFLGV* |
Ga0063356_1015829391 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIFPFLKTKKILIPDVPPPSARESEAGLVIAGIGIFCASVVIAAMLFVFLGA* |
Ga0063356_1053207391 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MALRAKSRKILIPDVPPVVKSTTKQGLVIAGIGVFCMSMVIVAVLFVFLGA* |
Ga0062592_1003902702 | 3300004480 | Soil | MAIQFGRAKKIPIPDVPPPDARESEAGLVIAGIGIFCASVVIAAMVFVFLA* |
Ga0062591_1000823223 | 3300004643 | Soil | AIQFGRAKKIPIPDVPPPDARESEAGLVIAGIGIFCASVVIAAMVFVFLA* |
Ga0062383_100722203 | 3300004778 | Wetland Sediment | MAIPFIKSKRIPIPDVPPPSARDSEPGLVIAGIGIFCASVVIAAMLFVFLGA* |
Ga0062380_100339854 | 3300004779 | Wetland Sediment | MTLPFIKSKRILIPDVPPPTARESEPGLVIAGIGIFCASVVIAAVLFVFLGA* |
Ga0062378_102548052 | 3300004780 | Wetland Sediment | IKSKRIPIPDVPPPSARDSEPGLVIAGIGIFCASVVIAAMLFVFLGA* |
Ga0062379_102072041 | 3300004781 | Wetland Sediment | LHLQAMTLPFVKSKRILIPDVPPPSVRESDPGLVIAGIGVFCGLVVIAAMLFVFLGA* |
Ga0062382_103542971 | 3300004782 | Wetland Sediment | VASKLLHLQAMTLPFVKSKRILIPDVPPPSVRESDPGLVIAGIGVFCGLVVIAAMLFVFLGA* |
Ga0066677_101234723 | 3300005171 | Soil | MTLRSKSRKILIPDVPPSVQAINQGVVIAGIGVFCATLVIAAVLFVFFGG* |
Ga0065705_100664041 | 3300005294 | Switchgrass Rhizosphere | MALRANSRKILIPDVPPVVKSTTKQGLVIAGIGVFCMSMVIVAVLFVFLG |
Ga0070680_1000775903 | 3300005336 | Corn Rhizosphere | MMLPTKSKKILIPDVPPPSMCDARQSWVIAGIGAFCASVVIAAVLFVFFGA* |
Ga0070708_1007436351 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTFRQKSKKILIPNVPPRPLLAHQDLVIAGIGVFCATVVIAAVVFVFFGA* |
Ga0066686_100112865 | 3300005446 | Soil | MTFRQKSKKILIPDVPPRPLLAHQDLVIAGIGVFCATVVIAAVVFVFFGA* |
Ga0070681_102494412 | 3300005458 | Corn Rhizosphere | MMLRTKSKKILIPDVPPPSMRDARQSLVIAGIGAFCASVVIAAALFVFFGA* |
Ga0070741_10000285107 | 3300005529 | Surface Soil | MTLRRKRILIPDVPPPIARGAKQSLVIAGIGAFCASVVIAAVLFVFFGA* |
Ga0070679_1000943194 | 3300005530 | Corn Rhizosphere | MMLPTKSKKILIPDVPPPSMCDARQSWVIAGIGAFCASVVIAAALFVFFGA* |
Ga0074470_103222908 | 3300005836 | Sediment (Intertidal) | MRLRFIKTKKILIPDVPPSSAPETEAGLVIAGIGIFCASVVIAAMLFVFLGA* |
Ga0074470_113784415 | 3300005836 | Sediment (Intertidal) | MTLHFFKTKKILIPDVPPTSAPETEAGLVIAGIGIFCASVVIAAMLFVFLGA* |
Ga0068863_1003977271 | 3300005841 | Switchgrass Rhizosphere | MTLRIKSKKILIPDVPPPLARTTKQGLVIAGIGGFCASVVVAAALFVFFGA* |
Ga0075288_10009642 | 3300005874 | Rice Paddy Soil | MALRVKSRNILIPDVPPVGESTTYQGLVIAGIGVFCGSVVIAAVLFVFLGV* |
Ga0075286_10007534 | 3300005886 | Rice Paddy Soil | MALGVKSRNILIPDVPPVGESTTYQGLVIAGIGVFCGSVVIAAVLFVFLGV* |
Ga0075277_10107442 | 3300005895 | Rice Paddy Soil | MLSNFRMALFTKSRKILIPDVPPAVKQTSQQGLVIAGIGVFCASVVLAAVLFVFLGT* |
Ga0079037_1026420021 | 3300006224 | Freshwater Wetlands | PFIKTKKILIPDTPPPTARETEPGLVIAGIGIFCAAAVITAMLFVFLGG* |
Ga0066659_116043481 | 3300006797 | Soil | AHMTLRSKSRKILIPDVPPSVQAINQGVVIAGIGVFCATLVIAAVLFVFFGG* |
Ga0075421_1019107281 | 3300006845 | Populus Rhizosphere | MALRIKSKKILFPDVPSPAMRKQQDLVIAGIGVFCATLVVQLRSLFF |
Ga0079217_100039886 | 3300006876 | Agricultural Soil | MALRTKSRRILIPDVPPAVETITHQGVVIAGIGVFCVSVVIVAVLFVFLGA* |
Ga0079215_100127425 | 3300006894 | Agricultural Soil | MALRKKSRKILIPDVPPTVETITHQGVVIAGIGAFCVSVVIVAVLVVFLGA* |
Ga0075426_100471155 | 3300006903 | Populus Rhizosphere | MTLRIKSKKILIPDVPPPSARTTKQGLVIAGIGAFCASVVVAAALFVFFGA* |
Ga0075424_1016844051 | 3300006904 | Populus Rhizosphere | IPDVPPRPLRAHHDLVVAGIGVFCATVVIAAVVFVFFGA* |
Ga0079216_106625971 | 3300006918 | Agricultural Soil | MALRTKSRKILIPDVPPTVETITHQGVVIAGIGAFCVSVVIVAVLVVFLGA* |
Ga0105095_101383282 | 3300009053 | Freshwater Sediment | MTLPFIKTKKILIPDAAPPSARETEPGLVIAGIGIFCAAVVITAMLFVFLGG* |
Ga0105106_104390182 | 3300009078 | Freshwater Sediment | MTLPFIKTKKILIPDAPPPSARETEPGLVIAGIGIFCAAVVITAMLFVFLGG* |
Ga0099792_112108301 | 3300009143 | Vadose Zone Soil | RGSPMTLRIKSKKILIPDVPPPLARTIKQGLVLAGIGAFCASVVVAAALFVFFGA* |
Ga0111538_107305453 | 3300009156 | Populus Rhizosphere | GAFPRMASKMLNESPMRLRLKSKKILIPDVPPRSAHTTKQGLVIAGIGALCASVVVAAALFVFFGA* |
Ga0105259_10428732 | 3300009597 | Soil | MTLPFIKTKKILIPDAPPPSARETEPGLVIAGIGIFCAAVVITAMLFVFLG |
Ga0105252_100283092 | 3300009678 | Soil | MTLPFIKTKKILISDVPPTSSREQEVGLVIAGIGIFCASVVIAAMLFVLIGT* |
Ga0126308_109976942 | 3300010040 | Serpentine Soil | MALPSIKPKKILIPDVPPPNDRESEAGLVIAGIGILCASVAIAAMLFVFLGA* |
Ga0126377_100683621 | 3300010362 | Tropical Forest Soil | PFRTKKIAIPDVPPPAKRLHQDWVVAGIGVFCATVVIIAVAFVFFGA* |
Ga0134128_118758461 | 3300010373 | Terrestrial Soil | MMLRTKSKKILIPDVPPPTMRDARQSLVIAGIGAFCASVVIAAALFVFFGA* |
Ga0134121_101070193 | 3300010401 | Terrestrial Soil | MMRLWKSKRILIPDVPPKTIKEINQDLVVAGIGFLCATVVIAAVVFVFIGA* |
Ga0134123_100294432 | 3300010403 | Terrestrial Soil | MTLRIKSKKILIPDVPPPLARTTKQGLVIAGIGAFCASVVVAAALFVFFGA* |
Ga0137716_1000901810 | 3300010938 | Hot Spring Fe-Si Sediment | MAFKMLCAIPVTFRFKRRKILIPDVPPPSPRAQQEWVIAGIGLFCATVVVAAVALVFFGA |
Ga0137438_10989361 | 3300011431 | Soil | MMRLWKSKRILIPDVPPKTVKEINQDLVVAGIGFLCATVVIAAVVFVFIGA* |
Ga0137464_11416372 | 3300011434 | Soil | MTLPFIKSKKILIPDVPPTSSREKEVGLVIAGIGIFCASVVIAAMLFVFLGA* |
Ga0137376_100018565 | 3300012208 | Vadose Zone Soil | MTLRSKFRKILIPDVPPSLQAINQGGVIAGIGVFCATLVIAAVLFVFFGG* |
Ga0137387_105866932 | 3300012349 | Vadose Zone Soil | RTKSKKILIPDVPPPSTRTAKQGLVIAGIGVFCAAVVVAAVLIVFLGV* |
Ga0137387_109323451 | 3300012349 | Vadose Zone Soil | QKSKKILIPDVPPRPLLAHQDLVIAGIGVFCATVVIAAVVFVFFGA* |
Ga0157313_10468471 | 3300012503 | Arabidopsis Rhizosphere | SKMLNESPMRLRLKSKKILIPDVPPRSAHTTKQGLVIAGIGALCASVVVAAALFVFFGA* |
Ga0137397_100105613 | 3300012685 | Vadose Zone Soil | MTLRIKSKKILIPDVPPPLARTTKQGLVLAGIGAFCASVVVAAALFVFFGA* |
Ga0137394_113417172 | 3300012922 | Vadose Zone Soil | KSKKILIPDVPPPSAGTTKQGLVIAGIGAFCASVVVAAALFVFFGA* |
Ga0137416_107481011 | 3300012927 | Vadose Zone Soil | MTLRIKSKKILIPDVPPPLARTTKQGLVLAGIGAFCASVVVAATL |
Ga0164301_102058331 | 3300012960 | Soil | MTLRIKSKKILIPDVPPPLARTTKQGLVIAGIGAFCASVVVAAALF |
Ga0134077_100174821 | 3300012972 | Grasslands Soil | RCSTEVPMTFRQKSKKILIPDVPPRPLLAHQDLVIAGIGVFCATVVIAAVVFVFFGA* |
Ga0075324_11317962 | 3300014263 | Natural And Restored Wetlands | MALRVKSRKILIPDVPPVAKSTPYQGLVIAGIGDFCGSVVIAAVLFVFLGV* |
Ga0075343_10980082 | 3300014317 | Natural And Restored Wetlands | MTLPFSKTKKILIPDVPPLSARETEAGIVIAGIGIFCAAVVIAAMLFVFLG |
Ga0187825_100061203 | 3300017930 | Freshwater Sediment | MALFTKSRRILIPDVPPTVKQTTQQGLVIAGIGVFCASVVLAAVLFVFLGT |
Ga0184610_11378041 | 3300017997 | Groundwater Sediment | VTFRSKSKKILILDVPPPAARKHQDLVIAGIGVFCATGVIAAVVFVFFGA |
Ga0184621_100922801 | 3300018054 | Groundwater Sediment | YLVTFKSKPKKILIPDVPPPTARTHQDLVIASIGVFCATVVIAAVAFVFFGA |
Ga0184619_101678261 | 3300018061 | Groundwater Sediment | VTFRSKSKKILIPDVPPPAARKHQDLVIAGIGVFCATVVIAAVVFVFFGA |
Ga0184625_100269043 | 3300018081 | Groundwater Sediment | MTLRIKSKKILIPDVPPPLARTTKQGLVIAGIGAFCASVVVAAALFVFFGA |
Ga0184629_104807692 | 3300018084 | Groundwater Sediment | MAFPIAKSKKILIPDVPPPTTRKSEPGLVIAGIGILCGSVVIAAMLFVFLGA |
Ga0190265_112679261 | 3300018422 | Soil | MLLQFKSKRILVPDVPPRTTRSSNQGLVIAGIGVFCASVVIAAALFVFLSV |
Ga0066667_111743611 | 3300018433 | Grasslands Soil | MTLRSKSRKILIPDVPPSVQAINQGVVIAGMGVFCATLVVAAVLFVFFVV |
Ga0190270_120469621 | 3300018469 | Soil | MRFPVAKSKKIFISDFPPPTIRKSEPGLIIAGIEILCGSVMIAAMLLVFLGA |
Ga0210378_100158871 | 3300021073 | Groundwater Sediment | VTFKSKPKKILIPDVPPSTARTHQDLVIASIGVFCATVVIAAVAFVF |
Ga0224510_101494243 | 3300022309 | Sediment | LYFGRRWVAPKLLHLQAMTLPFVKSRRILIPDVPPRSVRESDPGLVIAGIGVFCASVVIAAMLFVFLGA |
Ga0222622_102545901 | 3300022756 | Groundwater Sediment | VTFRSKSKKILIPDVPPPAARKHQDLVIAGIGVFCATVVMAAVVFVFFGA |
Ga0210087_10039973 | 3300025559 | Natural And Restored Wetlands | MALRVKSRKILIPDVPPVGESTTYQGLVIAGIGVFCGSVVIAAVLFVFLGV |
Ga0207707_100881172 | 3300025912 | Corn Rhizosphere | MMLPTKSKKILIPDVPPPSMCDARQSWVIAGIGAFCASVVIAAVLFVFFGA |
Ga0207707_102298802 | 3300025912 | Corn Rhizosphere | MMLRTKSKKILIPDVPPPSMRDARQSLVIAGIGAFCASVVIAAALFVFFGA |
Ga0207652_101080951 | 3300025921 | Corn Rhizosphere | MMLPTKSKKILIPDVPPPSMCDARQSWVIAGIGAFCASVVIA |
Ga0207650_108887591 | 3300025925 | Switchgrass Rhizosphere | MAIQFGRAKKIPIPDVPPPDARESEAGLVIAGIGIFCASVVIAAMVFVFLA |
Ga0210066_10025193 | 3300025951 | Natural And Restored Wetlands | MTLPFSKTKKILIPDVPPLSARETEAGIVIAGIGIFCAAVVIAAMLFVFLGA |
Ga0210127_10116732 | 3300025964 | Natural And Restored Wetlands | MTLPFSKTKKILIPDVPPLSARETEAGIVITGIGIFCAAVVIAAMLFVFLGA |
Ga0210102_10314273 | 3300025971 | Natural And Restored Wetlands | LPFSKTKKILIPDVPPLSARETEAGIVIAGIGIFCAAVVIAAMLFVFLGA |
Ga0208421_10100622 | 3300026058 | Natural And Restored Wetlands | MALRVKSRKILIPDVPPVGESTTYQGLVIAGIGVFCGSVVIAAVLFV |
Ga0209131_11058612 | 3300026320 | Grasslands Soil | MMRLWKSTRILIPDVPPKTVKEINQDLVVAGIGFLCATVVIAAVVFVFIGA |
Ga0209266_12731202 | 3300026327 | Soil | MTFRQKSKKILIPDVPPRPLLAHQDLVIAGIGVFCATVVIAAVVFVFFGA |
Ga0209387_10044481 | 3300027639 | Agricultural Soil | MALRKKSRKILIPDVPPTVETITHQGVVIAGIGAFCVSVVIVAVLVVFLGA |
Ga0209485_10268601 | 3300027691 | Agricultural Soil | MALRTKSRKILIPDVPPTVETITHQGVVIAGIGAFCVSVVIVAVLVVFLGA |
Ga0209485_13513241 | 3300027691 | Agricultural Soil | MALRTKSRRILIPDVPPAVETITHQGVVIAGIGVFCVSVVIVAVLFVFLGA |
Ga0208665_102390371 | 3300027715 | Deep Subsurface | MTLPFIKTKKILIPDVAPTSSRETEAGLVIAGIGIFCASVVIAAMLFVFIGT |
Ga0209261_101350942 | 3300027735 | Wetland Sediment | FIKSKRIPIPDVPPPSARDSEPGLVIAGIGIFCASVVIAAMLFVFLGA |
Ga0209726_100555002 | 3300027815 | Groundwater | MALKLLYHAPMTPPFSKSKRIPIPDVPPPTARSTELGLVIAGIGIFCASVVIAAMLLVFLGA |
Ga0209797_102389001 | 3300027831 | Wetland Sediment | MAIPFIKSKRIPIPDVPPPSARDSEPGLVIAGIGIFCASVVIAAMLFVFLGA |
Ga0209798_100432365 | 3300027843 | Wetland Sediment | MTLPFIKSKRILIPDVPPPTARESEPGLVIAGIGIFCASVVIAAVLFVFLGA |
Ga0209382_100483956 | 3300027909 | Populus Rhizosphere | MTLRIKSKKILIPDVPPPLARTTKQGLVIAGIGGFCASVVVAAALFVFFGA |
Ga0247663_10908062 | 3300028145 | Soil | MMQLFKPKRILIPDVPPKARRELDQDLVVAGIGVLCATIAIAAVVFVFIGA |
Ga0299907_109450091 | 3300030006 | Soil | MALRTKSRKILIPDVPPAVKPITHQSVVIAGIGVFCVSVVIVAVLFVFFGA |
Ga0307497_102350171 | 3300031226 | Soil | MIFPFLKTKKILIPDVPPPSARESEAGLVIAGIGIFCASVVIAAMLFVFLGA |
Ga0299913_103420173 | 3300031229 | Soil | MHVVMLRPKSRKILIPDVPPRVKSSARQGLVIAGIGVFCASLVIVAVALVFLDA |
Ga0170820_144626441 | 3300031446 | Forest Soil | LRIKSKKILIPDVPPPSAHTTKQGLVIAGIGAFCASVVVSAALFVFFGA |
Ga0310888_107228962 | 3300031538 | Soil | MALPSIKPKKIPIPDVPPPNHRESEAGLLIAGIGILCASVVIAAMLFVFLGT |
Ga0310887_103939052 | 3300031547 | Soil | MALPSIKPKKIPIPDVPPPNHRGSEAGLLIAGIGILCASVVIAAMLFVFLGT |
Ga0307408_1000648943 | 3300031548 | Rhizosphere | MALPSIKPKKILIPDVTPPNDRESKAGLVIAGIGILCASVVIAAMLFVFLGA |
Ga0307405_100517555 | 3300031731 | Rhizosphere | ALPSIKPKKILIPDVTPPNDRESKAGLVIAGIGILCASVVIAAMLFVFLGA |
Ga0307468_1009572432 | 3300031740 | Hardwood Forest Soil | KSKKILIPDVPPPLARTTKQGLVIAGIGGFCASVVVAAALFVFFGA |
Ga0310900_111023341 | 3300031908 | Soil | SIKPKKIPIPDVPPPNHRESEAGLLIAGIGILCASVVIAAMLFVFLGT |
Ga0214471_104749482 | 3300033417 | Soil | MVLRAKSKKILIPDVPPPVKSPNRQSLVIAGIGIFCATVVIAAVVLVFLGA |
Ga0326726_100380943 | 3300033433 | Peat Soil | MTLPFNKTKKILIPDVPPPNARDTEPGLVIAGIGIFCASVVIAAMLYVFLGA |
Ga0310811_1002168711 | 3300033475 | Soil | MMLRTKSKKILIPDVPPPTMRDARQSLVIAGIGAFCASVVIAAALFVFFGA |
Ga0370499_0082378_491_649 | 3300034194 | Untreated Peat Soil | MTLPFIKTKKILIPDASPPSDRETEPGLVIAGIGIFCASVVIAAMLFVFFGG |
Ga0370495_0128724_564_722 | 3300034257 | Untreated Peat Soil | MPFPIAKSKKILIPDVPPRITRKSEPELVIAGIGILCGSVMIAAMLFVFLDA |
⦗Top⦘ |