Basic Information | |
---|---|
Family ID | F068095 |
Family Type | Metagenome |
Number of Sequences | 125 |
Average Sequence Length | 39 residues |
Representative Sequence | MRDWLFLLAPPALIFYFIAFPDQFYAFVFWARHLIG |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 125 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 63.20 % |
% of genes near scaffold ends (potentially truncated) | 28.80 % |
% of genes from short scaffolds (< 2000 bps) | 71.20 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (64.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (12.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.800 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.400 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 125 Family Scaffolds |
---|---|---|
PF07238 | PilZ | 33.60 |
PF00027 | cNMP_binding | 14.40 |
PF00126 | HTH_1 | 6.40 |
PF13545 | HTH_Crp_2 | 1.60 |
PF03401 | TctC | 0.80 |
PF13191 | AAA_16 | 0.80 |
PF09084 | NMT1 | 0.80 |
PF03480 | DctP | 0.80 |
PF00535 | Glycos_transf_2 | 0.80 |
PF07690 | MFS_1 | 0.80 |
PF13563 | 2_5_RNA_ligase2 | 0.80 |
PF02321 | OEP | 0.80 |
PF09423 | PhoD | 0.80 |
PF13439 | Glyco_transf_4 | 0.80 |
PF06035 | Peptidase_C93 | 0.80 |
PF04115 | Ureidogly_lyase | 0.80 |
PF00528 | BPD_transp_1 | 0.80 |
COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
---|---|---|---|
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.60 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.80 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.80 |
COG3194 | Ureidoglycolate hydrolase (allantoin degradation) | Nucleotide transport and metabolism [F] | 0.80 |
COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 0.80 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.80 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.00 % |
Unclassified | root | N/A | 36.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886007|SwRhRL2b_contig_654925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2159 | Open in IMG/M |
2199352025|deepsgr__Contig_1728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5480 | Open in IMG/M |
3300000041|ARcpr5oldR_c000045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 22863 | Open in IMG/M |
3300000881|JGI10215J12807_1141152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2386 | Open in IMG/M |
3300002906|JGI25614J43888_10192094 | Not Available | 552 | Open in IMG/M |
3300005158|Ga0066816_1017868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 579 | Open in IMG/M |
3300005165|Ga0066869_10064649 | Not Available | 672 | Open in IMG/M |
3300005330|Ga0070690_100554842 | Not Available | 867 | Open in IMG/M |
3300005341|Ga0070691_11040510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 513 | Open in IMG/M |
3300005365|Ga0070688_101465798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 555 | Open in IMG/M |
3300005434|Ga0070709_10057196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2469 | Open in IMG/M |
3300005439|Ga0070711_100318012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1243 | Open in IMG/M |
3300005440|Ga0070705_101768837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 524 | Open in IMG/M |
3300005458|Ga0070681_10310486 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
3300005543|Ga0070672_100093103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2434 | Open in IMG/M |
3300005564|Ga0070664_100073674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2931 | Open in IMG/M |
3300005713|Ga0066905_100606589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 927 | Open in IMG/M |
3300005764|Ga0066903_100001926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 15730 | Open in IMG/M |
3300005764|Ga0066903_100307111 | All Organisms → cellular organisms → Bacteria | 2517 | Open in IMG/M |
3300005764|Ga0066903_101703818 | Not Available | 1200 | Open in IMG/M |
3300005764|Ga0066903_106897533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 590 | Open in IMG/M |
3300005764|Ga0066903_107359373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 569 | Open in IMG/M |
3300006028|Ga0070717_10054055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3311 | Open in IMG/M |
3300006050|Ga0075028_100024159 | Not Available | 2719 | Open in IMG/M |
3300006172|Ga0075018_10088028 | Not Available | 1359 | Open in IMG/M |
3300006172|Ga0075018_10431193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 676 | Open in IMG/M |
3300006173|Ga0070716_100698618 | Not Available | 775 | Open in IMG/M |
3300006175|Ga0070712_100174175 | Not Available | 1672 | Open in IMG/M |
3300006755|Ga0079222_10655020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 818 | Open in IMG/M |
3300006804|Ga0079221_10508339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 784 | Open in IMG/M |
3300006806|Ga0079220_10069840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1727 | Open in IMG/M |
3300006806|Ga0079220_10465294 | Not Available | 851 | Open in IMG/M |
3300006954|Ga0079219_10339940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 957 | Open in IMG/M |
3300009166|Ga0105100_10050925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2403 | Open in IMG/M |
3300009545|Ga0105237_10233285 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
3300009792|Ga0126374_10369334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 991 | Open in IMG/M |
3300010043|Ga0126380_10413380 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300010046|Ga0126384_10352097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1228 | Open in IMG/M |
3300010046|Ga0126384_11462362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 639 | Open in IMG/M |
3300010048|Ga0126373_10640350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1118 | Open in IMG/M |
3300010358|Ga0126370_11891561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 580 | Open in IMG/M |
3300010361|Ga0126378_12899038 | Not Available | 547 | Open in IMG/M |
3300010362|Ga0126377_10170084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2064 | Open in IMG/M |
3300010362|Ga0126377_10294740 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
3300010366|Ga0126379_13261109 | Not Available | 543 | Open in IMG/M |
3300010371|Ga0134125_10199062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2230 | Open in IMG/M |
3300010373|Ga0134128_10168655 | Not Available | 2472 | Open in IMG/M |
3300010373|Ga0134128_13046124 | Not Available | 515 | Open in IMG/M |
3300010398|Ga0126383_10233987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1790 | Open in IMG/M |
3300010401|Ga0134121_11414566 | Not Available | 707 | Open in IMG/M |
3300011269|Ga0137392_11268071 | Not Available | 596 | Open in IMG/M |
3300012490|Ga0157322_1002574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1035 | Open in IMG/M |
3300012908|Ga0157286_10018623 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
3300012957|Ga0164303_10265469 | Not Available | 992 | Open in IMG/M |
3300012971|Ga0126369_10733702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1067 | Open in IMG/M |
3300012989|Ga0164305_10058017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2303 | Open in IMG/M |
3300013307|Ga0157372_10104140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3243 | Open in IMG/M |
3300013308|Ga0157375_10848604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1060 | Open in IMG/M |
3300014745|Ga0157377_10576107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 799 | Open in IMG/M |
3300015371|Ga0132258_10174807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5181 | Open in IMG/M |
3300015371|Ga0132258_10412349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3358 | Open in IMG/M |
3300015371|Ga0132258_10678654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2593 | Open in IMG/M |
3300015371|Ga0132258_11125474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1985 | Open in IMG/M |
3300015373|Ga0132257_104591091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 502 | Open in IMG/M |
3300015374|Ga0132255_101243743 | Not Available | 1122 | Open in IMG/M |
3300017930|Ga0187825_10127764 | Not Available | 890 | Open in IMG/M |
3300017936|Ga0187821_10154105 | Not Available | 869 | Open in IMG/M |
3300017939|Ga0187775_10007978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2628 | Open in IMG/M |
3300017944|Ga0187786_10002500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4164 | Open in IMG/M |
3300017944|Ga0187786_10128344 | Not Available | 890 | Open in IMG/M |
3300017944|Ga0187786_10509618 | Not Available | 547 | Open in IMG/M |
3300017959|Ga0187779_10009834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5500 | Open in IMG/M |
3300017961|Ga0187778_10046681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2644 | Open in IMG/M |
3300017973|Ga0187780_10030916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3779 | Open in IMG/M |
3300017974|Ga0187777_10000541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 25686 | Open in IMG/M |
3300017994|Ga0187822_10277549 | Not Available | 584 | Open in IMG/M |
3300018029|Ga0187787_10000101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10916 | Open in IMG/M |
3300018058|Ga0187766_11404453 | Not Available | 512 | Open in IMG/M |
3300018060|Ga0187765_10067303 | Not Available | 1885 | Open in IMG/M |
3300020004|Ga0193755_1211728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 545 | Open in IMG/M |
3300021560|Ga0126371_10097499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2921 | Open in IMG/M |
3300021560|Ga0126371_10413959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1491 | Open in IMG/M |
3300021560|Ga0126371_11203922 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300023069|Ga0247751_1024959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 946 | Open in IMG/M |
3300025290|Ga0207673_1015061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1022 | Open in IMG/M |
3300025898|Ga0207692_10408390 | Not Available | 848 | Open in IMG/M |
3300025899|Ga0207642_10950008 | Not Available | 552 | Open in IMG/M |
3300025900|Ga0207710_10042342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2022 | Open in IMG/M |
3300025986|Ga0207658_10211005 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
3300026304|Ga0209240_1050387 | Not Available | 1570 | Open in IMG/M |
3300026319|Ga0209647_1018787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4335 | Open in IMG/M |
3300026345|Ga0257148_1015373 | Not Available | 606 | Open in IMG/M |
3300026745|Ga0207576_103154 | Not Available | 565 | Open in IMG/M |
3300026788|Ga0207579_101325 | Not Available | 532 | Open in IMG/M |
3300026944|Ga0207570_1000516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2052 | Open in IMG/M |
3300027011|Ga0207740_1046207 | Not Available | 502 | Open in IMG/M |
3300027424|Ga0209984_1036301 | Not Available | 704 | Open in IMG/M |
3300027552|Ga0209982_1083342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 528 | Open in IMG/M |
3300027665|Ga0209983_1012717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1728 | Open in IMG/M |
3300027765|Ga0209073_10050243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1366 | Open in IMG/M |
3300027765|Ga0209073_10158785 | Not Available | 839 | Open in IMG/M |
3300027787|Ga0209074_10572398 | Not Available | 500 | Open in IMG/M |
3300027894|Ga0209068_10133659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1332 | Open in IMG/M |
3300027915|Ga0209069_10395780 | Not Available | 756 | Open in IMG/M |
3300028577|Ga0265318_10342344 | Not Available | 546 | Open in IMG/M |
3300028802|Ga0307503_10229502 | Not Available | 896 | Open in IMG/M |
3300031716|Ga0310813_11452112 | Not Available | 637 | Open in IMG/M |
3300031719|Ga0306917_10651762 | Not Available | 828 | Open in IMG/M |
3300031820|Ga0307473_10553830 | Not Available | 786 | Open in IMG/M |
3300031910|Ga0306923_10405582 | Not Available | 1551 | Open in IMG/M |
3300031913|Ga0310891_10000588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6675 | Open in IMG/M |
3300031942|Ga0310916_11151069 | Not Available | 643 | Open in IMG/M |
3300031947|Ga0310909_10381941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1183 | Open in IMG/M |
3300031996|Ga0308176_11174416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 813 | Open in IMG/M |
3300032174|Ga0307470_10021361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2921 | Open in IMG/M |
3300032205|Ga0307472_100009512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4810 | Open in IMG/M |
3300032770|Ga0335085_11107643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 848 | Open in IMG/M |
3300033004|Ga0335084_10673604 | Not Available | 1055 | Open in IMG/M |
3300033412|Ga0310810_10121545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3080 | Open in IMG/M |
3300033433|Ga0326726_10082196 | Not Available | 2857 | Open in IMG/M |
3300033475|Ga0310811_10669679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1015 | Open in IMG/M |
3300033480|Ga0316620_11614145 | Not Available | 642 | Open in IMG/M |
3300033513|Ga0316628_100301525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1992 | Open in IMG/M |
3300033513|Ga0316628_102012601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 767 | Open in IMG/M |
3300033810|Ga0314872_005491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 834 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.00% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.40% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.40% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.40% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.60% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.60% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.20% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.40% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.40% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.40% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.60% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.60% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.80% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.80% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.80% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.80% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.80% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.80% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.80% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.80% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.80% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.80% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
3300005158 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAA | Environmental | Open in IMG/M |
3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Host-Associated | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300023069 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5 | Environmental | Open in IMG/M |
3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Host-Associated | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026345 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-A | Environmental | Open in IMG/M |
3300026745 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08K1-12 (SPAdes) | Environmental | Open in IMG/M |
3300026788 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07.2A5-10 (SPAdes) | Environmental | Open in IMG/M |
3300026944 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12 (SPAdes) | Environmental | Open in IMG/M |
3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033810 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_E | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
SwRhRL2b_0813.00008160 | 2162886007 | Switchgrass Rhizosphere | MRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG |
deepsgr_02965530 | 2199352025 | Soil | MRFRLQEPPMRDWLFLLAPPALIFYFIVFPDRFYAFVSWARTLIG |
ARcpr5oldR_0000459 | 3300000041 | Arabidopsis Rhizosphere | MRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
JGI10215J12807_11411521 | 3300000881 | Soil | PMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
JGI25614J43888_101920941 | 3300002906 | Grasslands Soil | MASLLQEPPMRDWLFLLAPPAVIFYFIAFPEQFYAFVAWARYLI* |
Ga0066816_10178682 | 3300005158 | Soil | TQGPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
Ga0066869_100646491 | 3300005165 | Soil | MGSLIQEPPMRDWLFLLAPPAVIFYFIAFPEQFYAFVAWARYLI |
Ga0070690_1005548422 | 3300005330 | Switchgrass Rhizosphere | MCATQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
Ga0070691_110405102 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | QEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
Ga0070688_1014657981 | 3300005365 | Switchgrass Rhizosphere | TQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
Ga0070709_100571964 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFCSQEPPMREWLFLLAPPALIFYFIAFPAQFYAFVAWARVMIG* |
Ga0070711_1003180121 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFCSQEPPMREWLFLLAPPALIFYFIAYPAQFYAFVAWARVMMG* |
Ga0070705_1017688372 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | ATQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
Ga0070681_103104864 | 3300005458 | Corn Rhizosphere | RCATTQGPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
Ga0070672_1000931036 | 3300005543 | Miscanthus Rhizosphere | PPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
Ga0070664_1000736745 | 3300005564 | Corn Rhizosphere | MRDWLFLLAPPALIFYFIVFPDRFYAFVSWARTLIG* |
Ga0066905_1006065891 | 3300005713 | Tropical Forest Soil | CAAMQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
Ga0066903_10000192615 | 3300005764 | Tropical Forest Soil | MRDWLFLLAPPAVIFYFIAFPDRFYSLVTWARTLLG* |
Ga0066903_1003071113 | 3300005764 | Tropical Forest Soil | MRDWLFLLAPPALIFFFLVFPETFYALVSWARTVIG* |
Ga0066903_1017038183 | 3300005764 | Tropical Forest Soil | MRDWLFLLAPPALIFYFIAFPDQFYALVTWARTMIG* |
Ga0066903_1068975332 | 3300005764 | Tropical Forest Soil | MRSCSQEPPMRDWLFLLAPPALIFYFIAYPEQFYAFVNWARHVIG* |
Ga0066903_1073593731 | 3300005764 | Tropical Forest Soil | PPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLMG* |
Ga0070717_100540555 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MREWLFLLAPPALIFYFIAFPAQFYAFVAWARVMIG* |
Ga0075028_1000241591 | 3300006050 | Watersheds | MCFCSQEPPMREWLFLLAPPALIFYFIAYPAQFYAFVAWARTMMG* |
Ga0075018_100880281 | 3300006172 | Watersheds | MREWLFLLAPPALIFYFIAYPAQFYAFVAWARTMMG* |
Ga0075018_104311932 | 3300006172 | Watersheds | MRFRLQEPPMRDWLFLLAPPALIFYFIVFPDRFYAFVSWARTLIG* |
Ga0070716_1006986181 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TMGFCSQEPPMREWLFLLAPPALIFYFIAFPAQFYAFVAWARVMIG* |
Ga0070712_1001741754 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MREWLFLLAPPALIFYFIAYPAQFYAFVAWARVMMG* |
Ga0079222_106550203 | 3300006755 | Agricultural Soil | MRDWLFLLAPPALIFYFIANPNSFYAFVGWAKTLVG* |
Ga0079221_105083392 | 3300006804 | Agricultural Soil | MGFYLQEPPMRDWLFLLTPPAMIFYFIAFPDQFYAFVAWAKNLI* |
Ga0079220_100698403 | 3300006806 | Agricultural Soil | MRDWLFLLAPPALIFYFVVFPDQFYAFMIWARNMM* |
Ga0079220_104652942 | 3300006806 | Agricultural Soil | MRDWLFLLTPPAMIFYFIAFPDRFDAFVAWARTLI* |
Ga0079219_103399401 | 3300006954 | Agricultural Soil | MRDWLFLLAPPALIFYFIANPNSFYAFVGWAKALVG* |
Ga0105100_100509253 | 3300009166 | Freshwater Sediment | MRDWLFLLAPPALIFYFIAFPHQFYAFVAWARTMIG* |
Ga0105237_102332851 | 3300009545 | Corn Rhizosphere | RRCATTQGPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
Ga0126374_103693343 | 3300009792 | Tropical Forest Soil | QEPPMRDWLFLLAPPALIFYFIAFPEGFYALVSWARTLIG* |
Ga0126380_104133802 | 3300010043 | Tropical Forest Soil | MRDWLFLLAPPALIFFFLVFPDAFYALVSWARTVIG* |
Ga0126384_103520971 | 3300010046 | Tropical Forest Soil | MRDWLFLLAPPELIFYFIAFPEGFHALVGWARMLIG* |
Ga0126384_114623622 | 3300010046 | Tropical Forest Soil | MRDWLFLLAPPALIFYFIAFPESFYALVSWARTLIG* |
Ga0126373_106403501 | 3300010048 | Tropical Forest Soil | MMSACLQEPPMRDWLFLLAPPALIFYFIAFPDRFYALVTWARTMIG* |
Ga0126370_118915612 | 3300010358 | Tropical Forest Soil | MRDWLFLLAPPALIFYFIAFPEGFYALVSWARTLIG* |
Ga0126378_128990381 | 3300010361 | Tropical Forest Soil | CLQEPPMRDWLFLLAPPALIFYFIAFPDQFYALVTWARTMIG* |
Ga0126377_101700843 | 3300010362 | Tropical Forest Soil | MRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKKLIG* |
Ga0126377_102947405 | 3300010362 | Tropical Forest Soil | MQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
Ga0126379_132611092 | 3300010366 | Tropical Forest Soil | MRDWLFLLAPPGLIFYFIAYPEQFYAFVNWARHVIG* |
Ga0134125_101990621 | 3300010371 | Terrestrial Soil | MCASVQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
Ga0134128_101686553 | 3300010373 | Terrestrial Soil | MGSYLQEPPMRDWLFLLTPPAMIFYFIAFPDQFYAFVAWARNLI* |
Ga0134128_130461242 | 3300010373 | Terrestrial Soil | MREWLFLLAPPALIFYFIAYPSQFYAFVAWARVMMG* |
Ga0126383_102339872 | 3300010398 | Tropical Forest Soil | MRDWLFLLAPPALIFYFIAYPEQFYAFVNWARHVIG* |
Ga0134121_114145662 | 3300010401 | Terrestrial Soil | MGFYLQEPPMRDWLFLLTPPAMIFYFIAFPDQFYAFVAWARNLI* |
Ga0137392_112680711 | 3300011269 | Vadose Zone Soil | MASLLQEPPMRDWLFLLAPPAVIFYFIAFPEQFYAFVAWARY |
Ga0157322_10025741 | 3300012490 | Arabidopsis Rhizosphere | MWLCSQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
Ga0157286_100186235 | 3300012908 | Soil | RDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
Ga0164303_102654692 | 3300012957 | Soil | QEPPMRDWLFLLAPPALIFYFIAYPNSFYAFVGWARTLVG* |
Ga0126369_107337021 | 3300012971 | Tropical Forest Soil | MRDWLFLLAPPALIFYFIAFPEGFYALVGWARMLIG* |
Ga0164305_100580173 | 3300012989 | Soil | MRDWLFLLAPPALIFYFIAYPNSFYAFVGWARTLVG* |
Ga0157372_101041404 | 3300013307 | Corn Rhizosphere | MRDWLFLLAPPALIFYFIVFPDMFYAFVSWARTLIG* |
Ga0157375_108486044 | 3300013308 | Miscanthus Rhizosphere | DWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
Ga0157377_105761073 | 3300014745 | Miscanthus Rhizosphere | ATTQGPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG* |
Ga0132258_101748076 | 3300015371 | Arabidopsis Rhizosphere | MRDWLFLLAPPALIFYFIVFPDRFYAFISWARTLIG* |
Ga0132258_104123494 | 3300015371 | Arabidopsis Rhizosphere | MRDWLFLLAPPGLIFYFVAFPDQFHAFVIWARNIMM* |
Ga0132258_106786545 | 3300015371 | Arabidopsis Rhizosphere | MLLRLQEPPMRDWLFLLAPPALIFYFVAFPDQFHTFVMWARNMM* |
Ga0132258_111254742 | 3300015371 | Arabidopsis Rhizosphere | MRDWLFLLAPPALIFYFIVFPESFYALVSWARTVIG* |
Ga0132257_1045910912 | 3300015373 | Arabidopsis Rhizosphere | LQEPPMRDWLFLLAPPALIFYFIVFPDRFYAFVSWARTLIG* |
Ga0132255_1012437433 | 3300015374 | Arabidopsis Rhizosphere | MRDWLFLLAPPALIFYFIVFPETFYALVTWARTMMG* |
Ga0187825_101277641 | 3300017930 | Freshwater Sediment | MGLYLQEPPMRDWLFLLTPPAMIFYFIAFPDQFYAFVAWAKNLI |
Ga0187821_101541052 | 3300017936 | Freshwater Sediment | MREWLFLLGPPALIFYFIAYPTQFYAFVAWARVMMG |
Ga0187775_100079784 | 3300017939 | Tropical Peatland | MRDWLFLLAPPALIFYFVAFPDQFYAFVTWARNMM |
Ga0187786_100025004 | 3300017944 | Tropical Peatland | MREWLFMLAPPALIFYFIAYPAQFYAFVAWARTVMG |
Ga0187786_101283442 | 3300017944 | Tropical Peatland | MREWLFLLAPPALIFYFIAYPTQFYAFVAWARVMMG |
Ga0187786_105096182 | 3300017944 | Tropical Peatland | MREWLFLLAPPALIFYFIAYPNQFYAFVAWARIMMG |
Ga0187779_100098347 | 3300017959 | Tropical Peatland | MRDWLFLLAPPALIFYFVAFPDQFHAFMIWARNMM |
Ga0187778_100466814 | 3300017961 | Tropical Peatland | MPFCSQEPPMRDWLFLLAPPALIFYFVIYPNQFHAFVIWAKYIIG |
Ga0187780_100309163 | 3300017973 | Tropical Peatland | MREWLFMLAPPALIFYFIAYPVQFYAFVAWARTVMG |
Ga0187777_1000054117 | 3300017974 | Tropical Peatland | MRDWLFLLAPPALIFYFVIYPNQFHAFVIWAKYIIG |
Ga0187822_102775492 | 3300017994 | Freshwater Sediment | LQEPPMRDWLFLLTPPAMIFYFIAFPDRFDAFVAWARTLI |
Ga0187787_100001014 | 3300018029 | Tropical Peatland | MRDWLFLLAPPALIFYFIAFPDQFYAFVFWARHLIG |
Ga0187766_114044531 | 3300018058 | Tropical Peatland | RDWLFLLAPPAQIFYFIAFPETFYALVTWARTMIG |
Ga0187765_100673033 | 3300018060 | Tropical Peatland | MRRYLQEPPMRDWLFLLAPPALIFYFIAFPETFYALVTWARTMIG |
Ga0193755_12117282 | 3300020004 | Soil | MRDWLFLLAPPALIFYFIVFPDRFYAFVSWARTLIG |
Ga0126371_100974991 | 3300021560 | Tropical Forest Soil | MRFCSQEPPMRNWLFLLAPPALIFYFVAFPGQFDAFVFWMKNIMG |
Ga0126371_104139591 | 3300021560 | Tropical Forest Soil | MMSACLQEPPMRDWLFLFAPPALIFYFIAFPDQFYALVTWARTMIG |
Ga0126371_112039221 | 3300021560 | Tropical Forest Soil | MRDWLFLLAPPALIFYFIAFPEGFYALVGWARMLIG |
Ga0247751_10249591 | 3300023069 | Soil | CATTQGPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG |
Ga0207673_10150613 | 3300025290 | Corn, Switchgrass And Miscanthus Rhizosphere | TTQGPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG |
Ga0207692_104083903 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFCSQEPPMREWLFLLAPPALIFYFIAFPAQFYAFVAWARVMIG |
Ga0207642_109500082 | 3300025899 | Miscanthus Rhizosphere | MRDWLFLLAPPALIFYFIVFPDRFYAFVSWARTLIGE |
Ga0207710_100423425 | 3300025900 | Switchgrass Rhizosphere | MCATQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG |
Ga0207658_102110055 | 3300025986 | Switchgrass Rhizosphere | TQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG |
Ga0209240_10503872 | 3300026304 | Grasslands Soil | MASLLQEPPMRDWLFLLAPPAVIFYFIAFPEQFYAFVAWARYLI |
Ga0209647_10187873 | 3300026319 | Grasslands Soil | MRDWLFLLAPPAVIFYFIAFPEQFYAFVAWARYLI |
Ga0257148_10153732 | 3300026345 | Soil | MRDWLFLLAPPALIFYFIANPEQFYAFVAWAKTMVG |
Ga0207576_1031542 | 3300026745 | Soil | MRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLI |
Ga0207579_1013251 | 3300026788 | Soil | TTQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG |
Ga0207570_10005161 | 3300026944 | Soil | ATTQGPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG |
Ga0207740_10462072 | 3300027011 | Tropical Forest Soil | REWLFLLAPPALIFYFIAYPAQFYAFVAWARTVMG |
Ga0209984_10363013 | 3300027424 | Arabidopsis Thaliana Rhizosphere | RCATTQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG |
Ga0209982_10833422 | 3300027552 | Arabidopsis Thaliana Rhizosphere | CGATQGPPMRDWLFLLAPPALIFYFIAYPNKFYEFVFWAKRLIG |
Ga0209983_10127172 | 3300027665 | Arabidopsis Thaliana Rhizosphere | MRDWLFLLAPPALIFYFIAYPNKFYEFVFWAKRLIG |
Ga0209073_100502433 | 3300027765 | Agricultural Soil | MRRCLQEPSMRDWLFLLAPPALIFYFVVFPDQFYAFMIWARNMM |
Ga0209073_101587852 | 3300027765 | Agricultural Soil | MRDWLFLLTPPAMIFYFIAFPDRFDAFVAWARTLI |
Ga0209074_105723982 | 3300027787 | Agricultural Soil | MRDWLFLLAPPALIFYFIANPNSFYAFVGWAKTLVG |
Ga0209068_101336592 | 3300027894 | Watersheds | MREWLFLLAPPALIFYFVAYPAKFYAFVAWARTMMG |
Ga0209069_103957801 | 3300027915 | Watersheds | MREWLFLLAPPALIFYFVAYPAKFYAFVAWARVMMG |
Ga0265318_103423441 | 3300028577 | Rhizosphere | MREWLFLLAPPALIFYFIAYPSQFYAFVAWARVMMG |
Ga0307503_102295021 | 3300028802 | Soil | KALRKWSIRIMGSLIQEPPMRDWLFLLAPPAVIFYFIAFPEQFYAFVAWARYLI |
Ga0310813_114521121 | 3300031716 | Soil | MRDWLFLLAPPALIFYFIAYPDKFHEFVFWAKRLIG |
Ga0306917_106517622 | 3300031719 | Soil | MMSACLQEPPMRDWLFLLAPPALIFYFIAFPDQFYALVTWARTMIG |
Ga0307473_105538301 | 3300031820 | Hardwood Forest Soil | MRDWLFLLAPPALIFYFIVFPDMFYAFLNWARTLIG |
Ga0306923_104055822 | 3300031910 | Soil | MRDWLFLLAPPAVIFYFIAFPDRFYSLVTWARTLLG |
Ga0310891_100005884 | 3300031913 | Soil | MRDWLFLLAPPALIFYFSAYPDKFYEFVFWAKRLIG |
Ga0310916_111510691 | 3300031942 | Soil | MMSACLQEPPMRDWLFLLAPPALIFYFIASPDQFYALVTWARTMIG |
Ga0310909_103819412 | 3300031947 | Soil | MRDWLFLLAPPALIFYFIAFPDQFYALVTWARTMIG |
Ga0308176_111744162 | 3300031996 | Soil | MREWLFLLAPPALIFYFVAYPAQFYAFVAWARVMMG |
Ga0307470_100213612 | 3300032174 | Hardwood Forest Soil | MRDWLFLLAPPALIFYFIAYPHKFYEFVFWAKRLIG |
Ga0307472_1000095126 | 3300032205 | Hardwood Forest Soil | MRDWLFLLAPPALILYFVTFPDQFHSFMIWARTMM |
Ga0335085_111076432 | 3300032770 | Soil | MREWLFLLAPPALIFYFIAYPAQFYAFVAWARTVMG |
Ga0335084_106736042 | 3300033004 | Soil | MGLCLQEPPMRDWLFLLGPPALIFYFVAFPDQFHTFVTWARNVM |
Ga0310810_101215455 | 3300033412 | Soil | MRDWLFLLTPPAMIFYFIAFPDQFYAFVAWARNLI |
Ga0326726_100821967 | 3300033433 | Peat Soil | MREWLFLLGPPALIFYFIAYPAQFYAFVAWARVMMG |
Ga0310811_106696794 | 3300033475 | Soil | ATTQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG |
Ga0316620_116141452 | 3300033480 | Soil | PMREWLFLLAPPALIFYFIAFPAQFYAFVAWARILIG |
Ga0316628_1003015252 | 3300033513 | Soil | MRDWLFLLAPPALIFYFIAYPDKFIEFVDWAKRLIG |
Ga0316628_1020126012 | 3300033513 | Soil | MRDWLFLLAPPALIFYFIAYPTQFYAFVAWARTLIG |
Ga0314872_005491_352_459 | 3300033810 | Peatland | MRDWLFLLAPPALIFYFVAFPDQFHAFVMWARNML |
⦗Top⦘ |