NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063725

Metagenome / Metatranscriptome Family F063725

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063725
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 58 residues
Representative Sequence FAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
Number of Associated Samples 108
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 1.55 %
% of genes near scaffold ends (potentially truncated) 95.35 %
% of genes from short scaffolds (< 2000 bps) 92.25 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (96.124 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(20.155 % of family members)
Environment Ontology (ENVO) Unclassified
(44.961 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(42.636 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.26%    β-sheet: 50.88%    Coil/Unstructured: 43.86%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF04865Baseplate_J 7.75
PF06841Phage_T4_gp19 6.20


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.45 %
UnclassifiedrootN/A1.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000401|BB_Man_B_Liq_inBBDRAFT_1000194All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM111561Open in IMG/M
3300000401|BB_Man_B_Liq_inBBDRAFT_1000207All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM111320Open in IMG/M
3300001267|B570J13875_107048All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1548Open in IMG/M
3300001282|B570J14230_10208299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1537Open in IMG/M
3300001720|JGI24513J20088_1020616All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1719Open in IMG/M
3300001823|ACM25_110877All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1584Open in IMG/M
3300001848|RCM47_1132206All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1700Open in IMG/M
3300004112|Ga0065166_10012259All Organisms → Viruses → Predicted Viral2345Open in IMG/M
3300004457|Ga0066224_1001720Not Available1157Open in IMG/M
3300004457|Ga0066224_1140140All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1551Open in IMG/M
3300004775|Ga0007798_10124291All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1585Open in IMG/M
3300004787|Ga0007755_1489974All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1654Open in IMG/M
3300004792|Ga0007761_11119505All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1603Open in IMG/M
3300005662|Ga0078894_10325867All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11392Open in IMG/M
3300005805|Ga0079957_1337672All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1665Open in IMG/M
3300005820|Ga0078747_187456All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1647Open in IMG/M
3300006378|Ga0075498_1357474All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Aurunvirus → Synechococcus virus STIM5670Open in IMG/M
3300006641|Ga0075471_10030987All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM13081Open in IMG/M
3300006641|Ga0075471_10171166All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Aurunvirus → Synechococcus virus STIM5 → Cyanophage S-TIM51141Open in IMG/M
3300006789|Ga0098054_1306585All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1567Open in IMG/M
3300006790|Ga0098074_1096159All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1787Open in IMG/M
3300006790|Ga0098074_1107974All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1733Open in IMG/M
3300006868|Ga0075481_10096128All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11103Open in IMG/M
3300006916|Ga0070750_10467747All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Aurunvirus → Synechococcus virus STIM5520Open in IMG/M
3300007541|Ga0099848_1055542All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11586Open in IMG/M
3300007541|Ga0099848_1252892All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1616Open in IMG/M
3300007541|Ga0099848_1268006All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1593Open in IMG/M
3300009009|Ga0105105_10145866All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11187Open in IMG/M
3300009082|Ga0105099_10589068All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1681Open in IMG/M
3300009154|Ga0114963_10312574All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1872Open in IMG/M
3300009182|Ga0114959_10040871All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM12753Open in IMG/M
3300009183|Ga0114974_10680329All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1560Open in IMG/M
3300009184|Ga0114976_10080362All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11881Open in IMG/M
3300009223|Ga0103850_1034863All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1600Open in IMG/M
3300009346|Ga0103839_1014099All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1509Open in IMG/M
3300009608|Ga0115100_10299432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1535Open in IMG/M
3300010150|Ga0098056_1029072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11944Open in IMG/M
3300010150|Ga0098056_1141085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1815Open in IMG/M
3300010334|Ga0136644_10393166All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1787Open in IMG/M
3300010354|Ga0129333_10289727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11467Open in IMG/M
3300010885|Ga0133913_13563622All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11013Open in IMG/M
3300011253|Ga0151671_1044205All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1637Open in IMG/M
3300011268|Ga0151620_1040556All Organisms → Viruses → Predicted Viral1557Open in IMG/M
3300012394|Ga0123365_1125320All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1636Open in IMG/M
3300012528|Ga0129352_11016905All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1668Open in IMG/M
3300012720|Ga0157613_1074775All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1639Open in IMG/M
3300012726|Ga0157597_1308003All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1601Open in IMG/M
3300012729|Ga0157625_1029497All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1660Open in IMG/M
3300012729|Ga0157625_1252920All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1653Open in IMG/M
3300012734|Ga0157615_1351585All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1646Open in IMG/M
3300012762|Ga0157554_1072541All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1649Open in IMG/M
3300012777|Ga0138292_1072049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1605Open in IMG/M
3300012781|Ga0138286_1440925All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1553Open in IMG/M
3300012959|Ga0157620_1124442All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1627Open in IMG/M
(restricted) 3300013126|Ga0172367_10650349All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1560Open in IMG/M
(restricted) 3300013128|Ga0172366_10819251All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1541Open in IMG/M
(restricted) 3300013132|Ga0172372_10260109All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11263Open in IMG/M
(restricted) 3300013133|Ga0172362_10570637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1770Open in IMG/M
3300013295|Ga0170791_10499337All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1642Open in IMG/M
3300013295|Ga0170791_12243057All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1582Open in IMG/M
3300013722|Ga0116824_105655All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1541Open in IMG/M
3300016695|Ga0180059_1194379All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1627Open in IMG/M
3300017727|Ga0181401_1072706All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1906Open in IMG/M
3300017727|Ga0181401_1122959All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1647Open in IMG/M
3300017749|Ga0181392_1134780All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1727Open in IMG/M
3300017761|Ga0181356_1132829All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1784Open in IMG/M
3300017960|Ga0180429_10830962Not Available625Open in IMG/M
3300018039|Ga0181579_10325252All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1852Open in IMG/M
3300018424|Ga0181591_10668388All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1735Open in IMG/M
3300019708|Ga0194016_1045457All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1548Open in IMG/M
3300019784|Ga0181359_1001299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM16584Open in IMG/M
3300019784|Ga0181359_1233760All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1569Open in IMG/M
3300020084|Ga0194110_10317670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11091Open in IMG/M
3300020214|Ga0194132_10236767All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11006Open in IMG/M
3300020578|Ga0194129_10412982All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1702Open in IMG/M
3300021092|Ga0194122_10292332All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1838Open in IMG/M
3300021389|Ga0213868_10345979All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1838Open in IMG/M
3300022176|Ga0212031_1072308All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1586Open in IMG/M
3300022914|Ga0255767_1179132All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1882Open in IMG/M
(restricted) 3300023210|Ga0233412_10578808All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1511Open in IMG/M
3300024262|Ga0210003_1145855All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11020Open in IMG/M
3300024262|Ga0210003_1362401All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1536Open in IMG/M
3300024346|Ga0244775_10467986All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11032Open in IMG/M
3300025108|Ga0208793_1192122All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1516Open in IMG/M
3300025646|Ga0208161_1000312All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM127569Open in IMG/M
3300025646|Ga0208161_1042671All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11509Open in IMG/M
3300025646|Ga0208161_1160483All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1551Open in IMG/M
3300025647|Ga0208160_1066888All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1987Open in IMG/M
3300025653|Ga0208428_1196685All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1518Open in IMG/M
3300025872|Ga0208783_10195646All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1839Open in IMG/M
3300026447|Ga0247607_1073627All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1602Open in IMG/M
3300026461|Ga0247600_1081294All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1638Open in IMG/M
3300026471|Ga0247602_1164427All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1513Open in IMG/M
3300027581|Ga0209651_1189152All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1542Open in IMG/M
3300027708|Ga0209188_1257450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1600Open in IMG/M
3300027747|Ga0209189_1279094All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1657Open in IMG/M
3300027747|Ga0209189_1286216All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1646Open in IMG/M
3300027782|Ga0209500_10208493All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1878Open in IMG/M
3300027782|Ga0209500_10256522All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1760Open in IMG/M
3300027973|Ga0209298_10024832All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM12958Open in IMG/M
3300027973|Ga0209298_10184073All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1861Open in IMG/M
3300027974|Ga0209299_1218106All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1692Open in IMG/M
3300028106|Ga0247596_1105712All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1637Open in IMG/M
(restricted) 3300028114|Ga0247835_1153915All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1829Open in IMG/M
3300028337|Ga0247579_1091903All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1597Open in IMG/M
3300028393|Ga0304728_1052777All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11678Open in IMG/M
(restricted) 3300028553|Ga0247839_1119130All Organisms → Viruses → Predicted Viral1212Open in IMG/M
(restricted) 3300028553|Ga0247839_1304812All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1596Open in IMG/M
(restricted) 3300028569|Ga0247843_1112748All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11202Open in IMG/M
(restricted) 3300029268|Ga0247842_10329095All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1811Open in IMG/M
3300031569|Ga0307489_11390844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1510Open in IMG/M
3300031707|Ga0315291_11436242All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1547Open in IMG/M
3300031758|Ga0315907_11187889All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1535Open in IMG/M
3300032053|Ga0315284_12363879All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1523Open in IMG/M
3300032156|Ga0315295_10056000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM13715Open in IMG/M
3300032173|Ga0315268_10003447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM117422Open in IMG/M
3300032275|Ga0315270_10223094All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11162Open in IMG/M
3300033521|Ga0316616_104334602All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1534Open in IMG/M
3300034018|Ga0334985_0247893All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11145Open in IMG/M
3300034020|Ga0335002_0562184All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1598Open in IMG/M
3300034021|Ga0335004_0644892All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1554Open in IMG/M
3300034062|Ga0334995_0366342All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1916Open in IMG/M
3300034062|Ga0334995_0789648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1521Open in IMG/M
3300034066|Ga0335019_0671719All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1598Open in IMG/M
3300034103|Ga0335030_0612568All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1667Open in IMG/M
3300034272|Ga0335049_0199727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11404Open in IMG/M
3300034272|Ga0335049_0313008All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM11058Open in IMG/M
3300034272|Ga0335049_0421439All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1869Open in IMG/M
3300034284|Ga0335013_0808425All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1524Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater20.16%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake13.18%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.40%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.98%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake6.20%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.43%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.65%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.10%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.33%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.33%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.55%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.55%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.55%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.55%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.55%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.55%
Bioluminescent BayEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay1.55%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.78%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.78%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.78%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.78%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.78%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.78%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.78%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.78%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.78%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.78%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.78%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.78%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000401Marine microbial community from La Parguera, Puerto Rico - BB Mangrove B LiquidEnvironmentalOpen in IMG/M
3300001267Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnionEnvironmentalOpen in IMG/M
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300001720Marine viral communities from the Pacific Ocean - LP-36EnvironmentalOpen in IMG/M
3300001823Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM25, ROCA_DNA015_2.0um_2oEnvironmentalOpen in IMG/M
3300001848Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3aEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300004775Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA17MEnvironmentalOpen in IMG/M
3300004787Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004792Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005820Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf, PM2EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009223Microbial communities of water from Amazon river, Brazil - RCM3EnvironmentalOpen in IMG/M
3300009346Microbial communities of water from the North Atlantic ocean - ACM14EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012394Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_201_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012720Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012726Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012729Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012734Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012762Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES046 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012777Freshwater microbial communities from Lake Simoncouche, Canada - S_140709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012781Freshwater microbial communities from Lake Simoncouche, Canada - S_130712_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012959Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES150 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013133 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013722Marine hypoxic microbial communities from the Gulf of Mexico, USA - 2m_Station4_GOM_MetagenomeEnvironmentalOpen in IMG/M
3300016695Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES164 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017960Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_1 metaGEnvironmentalOpen in IMG/M
3300018039Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019708Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MGEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020214Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80mEnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300021092Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10mEnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022914Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027581Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027747Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027974Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028114 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5mEnvironmentalOpen in IMG/M
3300028337Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 38R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028393Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028553 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16mEnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300029268 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19mEnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BB_Man_B_Liq_inBBDRAFT_100019413300000401Bioluminescent BayTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS*
BB_Man_B_Liq_inBBDRAFT_1000207113300000401Bioluminescent BayAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS*
B570J13875_10704823300001267FreshwaterYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMISNILG*
B570J14230_1020829913300001282FreshwaterTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMISNILG*
JGI24513J20088_102061613300001720MarineTPAVRPEYYIRERRVVRAEITVERIANVTGLGATGKYGSGFFIANVLA*
ACM25_11087713300001823Marine PlanktonTGTPAVRPEYYIRERRVVRAEITVERTINMTGLGGTGLIGSAFYIDNVFSD*
RCM47_113220613300001848Marine PlanktonYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNLVGLGATGLIGSGAMITNILA*
Ga0065166_1001225913300004112Freshwater LakeTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0066224_100172013300004457MarineAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGSFGSGFFVADVFA*
Ga0066224_114014023300004457MarineAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERIANITGLGGTGKIGSGFFIGNVFA*
Ga0007798_1012429123300004775FreshwaterANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0007755_148997413300004787Freshwater LakeGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0007761_1111950513300004792Freshwater LakeGTPAVRPEYYIRERRVVRAEITVERVINLVGLGATGLIGSGAMVTDILS*
Ga0078894_1032586733300005662Freshwater LakePAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILSL
Ga0079957_133767223300005805LakeAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVHPVGLGTTGLIGSGAMITNILA*
Ga0078747_18745613300005820Marine SedimentAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGANGLYGSGFFCADVFA*
Ga0075498_135747423300006378AqueousFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVHPVGLGTTGLIGSGAMITDILA*
Ga0075471_1003098713300006641AqueousYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0075471_1017116613300006641AqueousYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGFIGSGAMITDILS*
Ga0098054_130658513300006789MarinePAVRPEYYIRERRVVRAEITVERAVNITGIGATGAFGSGFFVADVFA*
Ga0098074_109615933300006790MarineAYAYTYQLTGTPAVRPEYYIRERRVVRAEITVERIVNITGLGATGQIGSGFYVADVLA*
Ga0098074_110797423300006790MarineASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGQYGSGFFCADVFQ*
Ga0075481_1009612833300006868AqueousYQLTGTPAVRPEYYIRERRVVRAEITVERAVNIVGLGATGLCGSGAFINDILA*
Ga0070750_1046774713300006916AqueousAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0099848_105554243300007541AqueousANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS*
Ga0099848_125289213300007541AqueousTPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS
Ga0099848_126800623300007541AqueousGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0105105_1014586613300009009Freshwater SedimentPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0105099_1058906823300009082Freshwater SedimentATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITNILG*
Ga0114963_1031257433300009154Freshwater LakeAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLLSSGAMITNILS*
Ga0114959_1004087143300009182Freshwater LakeGGANAATPAFSYTYQLTGTPAVRPEYYIRERRVVRAEITVERIINLVGLGANGAIGSGAMVTDILS*
Ga0114974_1068032913300009183Freshwater LakeTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0114976_1008036213300009184Freshwater LakeNAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITNVLS*
Ga0103850_103486313300009223River WaterVMPAGGANGATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITNILG*
Ga0103839_101409913300009346River WaterPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAINMTGLGGTGLIGSAFYIDNVFSD
Ga0115100_1029943223300009608MarineTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGASGAFGSGFYVADVFA*
Ga0098056_102907253300010150MarineTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNIVGLGATGLGGSGAFINDILA*
Ga0098056_114108523300010150MarineFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGANGLYGSGFFCADVFA*
Ga0136644_1039316623300010334Freshwater LakeMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLLGSGAMITNILS*
Ga0129333_1028972713300010354Freshwater To Marine Saline GradientPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGGFGSGFYIDDVFA*
Ga0133913_1356362213300010885Freshwater LakeKHTDDNIIDQLTGTPAVRPEYYIRERRVVRAEITVERIINLVGLGATGLIGSGAMITDILS*
Ga0151671_104420513300011253MarineASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERIANVTGLGATGRYGSGFFIANVLA*
Ga0151620_104055623300011268FreshwaterVRPEYYIRERRVVRAEITVERAVNVVGLGATGLGGSGAFINDILA*
Ga0123365_112532023300012394MarineLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGAQGSFGSGFFIADVFA*
Ga0129352_1101690513300012528AqueousSYTYQLTGTPAVRPEYYIRERRVVRAEVTVERTINMTGLGGTGLIGSAFYIDNVFSD*
Ga0157613_107477513300012720FreshwaterQLTGTPAVRPEYYIRERRVVRAEITIERVVNLVGLGATGLIGSGAMITNILS*
Ga0157597_130800313300012726FreshwaterLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS*
Ga0157625_102949713300012729FreshwaterTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS*
Ga0157625_125292013300012729FreshwaterNAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGVIGSGAMITDILS*
Ga0157615_135158513300012734FreshwaterTPAVRPEYYIRERRVVRAEITVERAVHPVGLGTTGLIGSGAMITDILA*
Ga0157554_107254113300012762FreshwaterTPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITNILS
Ga0138292_107204913300012777Freshwater LakeQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITNILS*
Ga0138286_144092513300012781Freshwater LakeQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0157620_112444213300012959FreshwaterNDQLTGTPAVRPEYYIRERRVVRAEITIERVVNLVGLGATGLIGSGAMITNILS*
(restricted) Ga0172367_1065034923300013126FreshwaterYTYQLTGTPAVRPEYYIRERRVVRAEITVERIVNLVGLGATGAIGSGAMVTDILS*
(restricted) Ga0172366_1081925113300013128SedimentAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
(restricted) Ga0172372_1026010933300013132FreshwaterFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERIVNLVGLGATGAIGSGAMVTDILS*
(restricted) Ga0172362_1057063713300013133SedimentMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS*
Ga0170791_1049933713300013295FreshwaterATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITNILS*
Ga0170791_1224305713300013295FreshwaterTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITNILS*
Ga0116824_10565523300013722MarineGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGSTGAFGSGFYIDDVFA*
Ga0180059_119437913300016695FreshwaterQLTGTPAVRPEYYIRERRVVRAEITIERVVNLVGLGATGLIGSGAMITNILS
Ga0181401_107270633300017727SeawaterYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGKYGSGFFIADVFG
Ga0181401_112295923300017727SeawaterGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGSFGSGFFVADVFA
Ga0181392_113478023300017749SeawaterGGASAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGASGAFGSGFFVADVFA
Ga0181356_113282913300017761Freshwater LakeTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
Ga0180429_1083096213300017960Hypersaline Lake SedimentLAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS
Ga0181579_1032525213300018039Salt MarshATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAINMTGLGGTGKIGSGFYIDNVFSD
Ga0181591_1066838833300018424Salt MarshAYTYQLTGTPAVLPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS
Ga0194016_104545713300019708SedimentYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGASGLIGSGAMVSDILTNP
Ga0181359_100129963300019784Freshwater LakePSGGANAATPAFSYTYQLTGTPAVRPEYYIREKRVVRAEITIERVVNLVGLGATGLIGSGAMITDILS
Ga0181359_123376013300019784Freshwater LakeVMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
Ga0194110_1031767013300020084Freshwater LakeAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGAFGSGFYINNVFA
Ga0194132_1023676713300020214Freshwater LakeGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
Ga0194129_1041298223300020578Freshwater LakeAATPAYAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVINITGLGATGAFGSGFYIDDVFA
Ga0194122_1029233213300021092Freshwater LakeTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGAFGSGFYINNVFA
Ga0213868_1034597933300021389SeawaterQLTGTPAVRPEYYIRERRVVRAEVTVERTINMTGLGGTGLIGSGFYIDNVFSD
Ga0212031_107230823300022176AqueousPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS
Ga0255767_117913233300022914Salt MarshAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAINMTGLGGTGKIGSGFYIDNVFSD
(restricted) Ga0233412_1057880823300023210SeawaterQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGSFGSGFFVADVFA
Ga0210003_114585513300024262Deep SubsurfaceYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGLYGSGFFCADVFA
Ga0210003_136240123300024262Deep SubsurfaceTPAFAYTYQLTGTSAVRPEYYIRERRVVRAEITVERIANVTGLGATGRYGSGFFISNVLA
Ga0244775_1046798633300024346EstuarineMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITIERVVNLVGLGATGLIGSGAMITNILA
Ga0208793_119212213300025108MarineTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGKYGSGFFIADVFA
Ga0208161_1000312323300025646AqueousTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS
Ga0208161_104267143300025646AqueousANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS
Ga0208161_116048323300025646AqueousMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGANGLIGSGSMITDILS
Ga0208160_106688833300025647AqueousAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMVTDILS
Ga0208428_119668523300025653AqueousYQLTGTPAVRPEYYIRERRVVRAEITVERAVNIVGLGATGLCGSGAFINDILA
Ga0208783_1019564623300025872AqueousANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGFIGSGAMITDILS
Ga0247607_107362713300026447SeawaterTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGAYGSGFYVADVFA
Ga0247600_108129413300026461SeawaterTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGSNGKYGSGFYCADVFA
Ga0247602_116442713300026471SeawaterGTPAVRPEYYIRERRVVRAEITVERAVNITGLGASGAYGSGFFVNNVFA
Ga0209651_118915213300027581Freshwater LakeAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
Ga0209188_125745013300027708Freshwater LakeAFSYTYQLTGTPAVRPEYYIRERRVVRAEITVERIINLVGLGANGAIGSGAMVTDILS
Ga0209189_127909423300027747Freshwater LakeMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLLGSGAMITNILS
Ga0209189_128621623300027747Freshwater LakeTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS
Ga0209500_1020849313300027782Freshwater LakeGANAATPAFAYTYQLTGTPAVRPEYYVRERRVVRAEITVERVINLVGLGATNLIGSGAMVTNILGV
Ga0209500_1025652213300027782Freshwater LakeTYQLTGTPAVRPEYYIRERRVVRAEITVERAVHPVGLGTTGLIGSGAMITDILA
Ga0209298_1002483213300027973Freshwater LakeSYTYQLTGTPAVRPEYYIRERRVVRAEITVERIINLVGLGANGAIGSGAMVTDILS
Ga0209298_1018407333300027973Freshwater LakeFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITNILS
Ga0209299_121810623300027974Freshwater LakeGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS
Ga0247596_110571223300028106SeawaterYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGATGSFGSGFFVADVFA
(restricted) Ga0247835_115391513300028114FreshwaterFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVHPVGLGTTGLIGSGAMITNILA
Ga0247579_109190323300028337SeawaterYQLTGTPAVRPEYYIRERRVVRAEITVERAVNITGLGASGAYGSGFFVNNVFA
Ga0304728_105277713300028393Freshwater LakeGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS
(restricted) Ga0247839_111913033300028553FreshwaterTYQLTGTPAVRPEYYIRERRVVRAEITVERIINLVGLGATGAIGSGAMVTNILS
(restricted) Ga0247839_130481223300028553FreshwaterANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVHPVGLGTTGLIGSGAMITNILA
(restricted) Ga0247843_111274833300028569FreshwaterPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITNVLS
(restricted) Ga0247842_1032909523300029268FreshwaterGANAATPAFSYTYQLTGTPAVRPEYYIRERRVVRAEITVERIINLVGLGATGAIGSGAMVTNILS
Ga0307489_1139084423300031569Sackhole BrineLTGTPAVRPEYYIRERRVVRAEITVERIANVTGLGATGRYGSGFFISNVLA
Ga0315291_1143624223300031707SedimentNAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMISNILG
Ga0315907_1118788923300031758FreshwaterTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMISNILG
Ga0315284_1236387923300032053SedimentTYQLTGTPAVRPEYYIRERRVVRAEITIERVVNLVGLGATSLIGSGAMITNILS
Ga0315295_1005600053300032156SedimentAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNITGLGSTGLFGSGFYIDDVFA
Ga0315268_10003447163300032173SedimentMETCRSKDKEPYDNIIDTYQLTGTPAVRPEYYIRERRVVRAEITIERVVNLVGLGATSLIGSGAMITNILS
Ga0315270_1022309433300032275SedimentMETCRSKDKEPYDNIIDTYQLTGTPAVRPEYYIRERRVVRAEITIERVVNLVGLGATSLIGSGAMITNI
Ga0316616_10433460213300033521SoilYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMITDVLS
Ga0334985_0247893_31_2403300034018FreshwaterMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVHPVGLGTTGLIGSGAMITDILA
Ga0335002_0562184_39_2483300034020FreshwaterMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGSTGLIGSGAMITDILS
Ga0335004_0644892_3_2123300034021FreshwaterMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS
Ga0334995_0366342_3_1763300034062FreshwaterFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
Ga0334995_0789648_3_2003300034062FreshwaterGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS
Ga0335019_0671719_56_2653300034066FreshwaterMPAGGANAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
Ga0335030_0612568_3_1943300034103FreshwaterNAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVINLVGLGATGLIGSGAMITDILS
Ga0335049_0199727_1233_14033300034272FreshwaterAYTYQLTGTPAVRPEYYIRERRVVRAEITVERAVHPVGLGTTGLIGSGAMITDILA
Ga0335049_0313008_877_10563300034272FreshwaterPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMITDILS
Ga0335049_0421439_2_1903300034272FreshwaterAATPAFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS
Ga0335013_0808425_351_5243300034284FreshwaterFAYTYQLTGTPAVRPEYYIRERRVVRAEITVERVVNLVGLGATGLIGSGAMVTDILS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.