NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F058172

Metagenome / Metatranscriptome Family F058172

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058172
Family Type Metagenome / Metatranscriptome
Number of Sequences 135
Average Sequence Length 52 residues
Representative Sequence MGTEVRVGEDKPKYDFYENALFLDDPIEADISRKARCLAPKIGTEPRF
Number of Associated Samples 116
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 48.15 %
% of genes near scaffold ends (potentially truncated) 34.07 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(17.778 % of family members)
Environment Ontology (ENVO) Unclassified
(54.815 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(69.630 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.11%    β-sheet: 0.00%    Coil/Unstructured: 82.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 135 Family Scaffolds
PF03208PRA1 0.74
PF00300His_Phos_1 0.74



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2043231002|Landsort10m_GCH9ZVC02IHJXTAll Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300000128|SA_S1_NOR08_45mDRAFT_c10176296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani607Open in IMG/M
3300000949|BBAY94_10058777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1066Open in IMG/M
3300001354|JGI20155J14468_10068688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1381Open in IMG/M
3300001830|ACM40_1035823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani707Open in IMG/M
3300003216|JGI26079J46598_1034116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1135Open in IMG/M
3300003345|JGI26080J50196_1048143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida830Open in IMG/M
3300003413|JGI25922J50271_10092823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida643Open in IMG/M
3300004241|Ga0066604_10157647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida904Open in IMG/M
3300004794|Ga0007751_11297924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida666Open in IMG/M
3300004836|Ga0007759_10809845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani605Open in IMG/M
3300005516|Ga0066831_10042326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1236Open in IMG/M
3300005662|Ga0078894_10470097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1131Open in IMG/M
3300005662|Ga0078894_10734158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida869Open in IMG/M
3300005988|Ga0075160_10661835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida556Open in IMG/M
3300006086|Ga0075019_10924327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida560Open in IMG/M
3300006397|Ga0075488_1605873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300006920|Ga0070748_1282643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300007513|Ga0105019_1164554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1138Open in IMG/M
3300007513|Ga0105019_1174282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1093Open in IMG/M
3300007551|Ga0102881_1147659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida650Open in IMG/M
3300007558|Ga0102822_1099644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani684Open in IMG/M
3300007863|Ga0105744_1127611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300007956|Ga0105741_1151970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300008119|Ga0114354_1119677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1019Open in IMG/M
3300008929|Ga0103732_1009208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1276Open in IMG/M
3300008935|Ga0103738_1049210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida589Open in IMG/M
3300008938|Ga0103741_1073983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300008952|Ga0115651_1219243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1258Open in IMG/M
3300009068|Ga0114973_10292640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida869Open in IMG/M
3300009071|Ga0115566_10299859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida948Open in IMG/M
3300009071|Ga0115566_10628686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida599Open in IMG/M
3300009154|Ga0114963_10640316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300009172|Ga0114995_10250154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani979Open in IMG/M
3300009172|Ga0114995_10365096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani793Open in IMG/M
3300009172|Ga0114995_10843563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida502Open in IMG/M
3300009263|Ga0103872_1057525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida580Open in IMG/M
3300009265|Ga0103873_1012037All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Vannellidae → Vannella → Vannella robusta1248Open in IMG/M
3300009432|Ga0115005_11016634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida671Open in IMG/M
3300009433|Ga0115545_1209674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida662Open in IMG/M
3300009436|Ga0115008_10453576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani913Open in IMG/M
3300009436|Ga0115008_10525772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida847Open in IMG/M
3300009495|Ga0115571_1200855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida816Open in IMG/M
3300009538|Ga0129287_10115819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1139Open in IMG/M
3300012504|Ga0129347_1139620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida541Open in IMG/M
3300012954|Ga0163111_10423128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1213Open in IMG/M
3300016766|Ga0182091_1522539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida598Open in IMG/M
3300016776|Ga0182046_1023693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida574Open in IMG/M
3300017710|Ga0181403_1073504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani711Open in IMG/M
3300017719|Ga0181390_1180073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida517Open in IMG/M
3300017735|Ga0181431_1066527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida811Open in IMG/M
3300017748|Ga0181393_1038438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1338Open in IMG/M
3300017771|Ga0181425_1052659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1324Open in IMG/M
3300017783|Ga0181379_1068849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1326Open in IMG/M
3300017783|Ga0181379_1093297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1108Open in IMG/M
3300017783|Ga0181379_1163172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani790Open in IMG/M
3300017783|Ga0181379_1189187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani724Open in IMG/M
3300017818|Ga0181565_10276369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1133Open in IMG/M
3300017949|Ga0181584_10689806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida611Open in IMG/M
3300017951|Ga0181577_10407640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida864Open in IMG/M
3300017962|Ga0181581_10868585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300018048|Ga0181606_10420123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani711Open in IMG/M
3300018418|Ga0181567_10994439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida524Open in IMG/M
3300018428|Ga0181568_10840756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani707Open in IMG/M
3300018628|Ga0193355_1019175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani643Open in IMG/M
3300018692|Ga0192944_1040583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani674Open in IMG/M
3300018846|Ga0193253_1059518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani941Open in IMG/M
3300018871|Ga0192978_1085517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida575Open in IMG/M
3300018928|Ga0193260_10050627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida896Open in IMG/M
3300018968|Ga0192894_10080181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida952Open in IMG/M
3300018968|Ga0192894_10112100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani842Open in IMG/M
3300018968|Ga0192894_10249409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani594Open in IMG/M
3300018980|Ga0192961_10105683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida854Open in IMG/M
3300018980|Ga0192961_10221373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300018981|Ga0192968_10073315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida929Open in IMG/M
3300018982|Ga0192947_10088064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1020Open in IMG/M
3300018982|Ga0192947_10093999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani989Open in IMG/M
3300018989|Ga0193030_10067605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1020Open in IMG/M
3300019033|Ga0193037_10345083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300019045|Ga0193336_10357923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300019045|Ga0193336_10513350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300019048|Ga0192981_10128021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1003Open in IMG/M
3300019048|Ga0192981_10143371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida944Open in IMG/M
3300019050|Ga0192966_10252316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani627Open in IMG/M
3300020205|Ga0211731_10487314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1216Open in IMG/M
3300020410|Ga0211699_10274923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300020566|Ga0208222_1034442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida937Open in IMG/M
3300021336|Ga0210307_1182200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1085Open in IMG/M
3300021342|Ga0206691_1573286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani827Open in IMG/M
3300021350|Ga0206692_1484467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani756Open in IMG/M
3300021365|Ga0206123_10154888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1047Open in IMG/M
3300021375|Ga0213869_10317437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida660Open in IMG/M
3300021959|Ga0222716_10405540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida791Open in IMG/M
3300021962|Ga0222713_10290074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1047Open in IMG/M
3300022752|Ga0214917_10203525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida973Open in IMG/M
3300022907|Ga0255775_1241711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani662Open in IMG/M
3300025138|Ga0209634_1306333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida543Open in IMG/M
3300025680|Ga0209306_1057106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1238Open in IMG/M
3300025869|Ga0209308_10188464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida922Open in IMG/M
3300025890|Ga0209631_10168652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1159Open in IMG/M
3300026182|Ga0208275_1024903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1257Open in IMG/M
3300027687|Ga0209710_1146052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani865Open in IMG/M
3300027719|Ga0209467_1112443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1010Open in IMG/M
3300027752|Ga0209192_10090285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1284Open in IMG/M
3300027752|Ga0209192_10264484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300027780|Ga0209502_10286066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani715Open in IMG/M
3300027810|Ga0209302_10176302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1034Open in IMG/M
3300027833|Ga0209092_10300182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani869Open in IMG/M
3300027833|Ga0209092_10551769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida582Open in IMG/M
3300027899|Ga0209668_11046054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300028115|Ga0233450_10376985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300028137|Ga0256412_1307701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300028595|Ga0272440_1093947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1089Open in IMG/M
3300029908|Ga0311341_10327390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida903Open in IMG/M
3300030722|Ga0308137_1072786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida610Open in IMG/M
3300030741|Ga0265459_12470532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida639Open in IMG/M
3300030788|Ga0073964_10989785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300031710|Ga0307386_10787027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida513Open in IMG/M
3300031717|Ga0307396_10468679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida604Open in IMG/M
3300031738|Ga0307384_10448840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida605Open in IMG/M
3300031739|Ga0307383_10491859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300032518|Ga0314689_10562323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300032522|Ga0314677_10580472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300032707|Ga0314687_10563756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani635Open in IMG/M
3300032713|Ga0314690_10483979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida613Open in IMG/M
3300032725|Ga0314702_1337881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani571Open in IMG/M
3300032744|Ga0314705_10749044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300032748|Ga0314713_10349183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani630Open in IMG/M
3300032748|Ga0314713_10400110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida583Open in IMG/M
3300032752|Ga0314700_10613113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300032820|Ga0310342_103125536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300033572|Ga0307390_10548998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani718Open in IMG/M
3300034022|Ga0335005_0232392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1127Open in IMG/M
3300034105|Ga0335035_0458615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani707Open in IMG/M
3300034105|Ga0335035_0543891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine17.78%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine15.56%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh8.15%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater7.41%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater6.67%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.44%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.70%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.22%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.22%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.22%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica2.22%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.96%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater1.48%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.48%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.48%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.48%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.48%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.48%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.48%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.74%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.74%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.74%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.74%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.74%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.74%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.74%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.74%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.74%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.74%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.74%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.74%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
204323100210 m water depthEnvironmentalOpen in IMG/M
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300001830Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM40, ROCA_DNA028_0.2um_3lEnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003345Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNAEnvironmentalOpen in IMG/M
3300003413Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DDEnvironmentalOpen in IMG/M
3300004241Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11EnvironmentalOpen in IMG/M
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004836Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008935Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3AEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020566Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300022907Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaGEnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027719Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028595Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
10m_10562902043231002MarineMGTEVRVGEDKPKYDFYENALFLDDPQEADLSRKARCLAPKIGTQPRFASNNL
SA_S1_NOR08_45mDRAFT_1017629623300000128MarineMGTEVRVGEDKPKYDFYENALFLDDPQEADLSRKARCLAPKIGT*
BBAY94_1005877713300000949Macroalgal SurfaceMGTEIRVGEDKPRYDFYENALFLDDPIEADISRKARCLAPKIGTEPRF*
JGI20155J14468_1006868833300001354Pelagic MarineMPNWSMGTEVRVGEDKPKYDFYENALFLDDPIEADINRKHRCLAPKIGTEPRF*
ACM40_103582323300001830Marine PlanktonMGTEVRVGEDKPKYDFYENALFLDDPVEADLNRRKRCMAPKIGTQPRF*
JGI26079J46598_103411623300003216MarineMGTEVRVGEDKPKYDFYENALFLDDPLEADLSRKARCLAPKIGT*
JGI26080J50196_104814323300003345MarineMQAPGWSMGTEVRVGEDKPKYDFYENALFLDDPLEADLSRKARCLAPKIGT*
JGI25922J50271_1009282313300003413Freshwater LakeLPHWGFGTAERMGADKPRYDFYENAMFLDDPLAADISRKHRCTAPKIGTEPRVSQNY*
Ga0066604_1015764713300004241FreshwaterMPAFGFGTSERVAVDKPKYDFYENAIFLDDPLQADGSRKPRVKAPKIGTEPRVI*
Ga0007751_1129792413300004794Freshwater LakeVGTEVRVGEDKPRYDFYENALFLDDPIEADISRKPRCLAPKIGT*
Ga0007759_1080984513300004836Freshwater LakeDHAPGWSMGTEVRIGEDKPRYDFYENALFLDDPIEADINRKHRCLAPKIGTEPRF*
Ga0066831_1004232623300005516MarineMGTEVRVAEDKPRYDFYENALFLDDPVEADINRKHRICAPKIGTEPRFNSSNLE*
Ga0078894_1047009733300005662Freshwater LakeLPHWGFGTAERMGADKPRYDFYENAMFLDDPLAADISRKHRCTAPKIGTEPRVSQMIEE*
Ga0078894_1073415813300005662Freshwater LakeVRVGEDKPRYDFYENALFLDDPIEADISRKPRCLAPKIGT*
Ga0075160_1066183523300005988Wastewater EffluentLQPPGWGFGTAERHGVDKPKYDFYENAAFLDDPLTADATRKPRCTAPKIGTEPR
Ga0075019_1092432723300006086WatershedsMPAFGFGTSERVAVDKPKYDFYENAIFLDDPLQADGSRRPRVKAPKIGTEPRVRLFYVAD
Ga0075488_160587323300006397AqueousMGTEVRVGEDKPKYDFYENALFLDDPIEADISRKARCLAPKIGTEPRFNTTNLEQNPGP*
Ga0070748_128264313300006920AqueousMGTEIRIGERKPKYDFYENALFLDDPLEADLSRKERCKAPKIGTEPRFSSGNET
Ga0105019_116455443300007513MarineMGTEVRVGEDKPRFDFYENALFLDDPIEACLGRKPRCTAPKIGT*
Ga0105019_117428223300007513MarineMGTEIRNGTEKPKYDFYENALFLDDPIEADLSRKGRCLAPKIGTEPRFSGGVNDFKPGP*
Ga0102881_114765923300007551EstuarineQAPGWSMGTEVRVGEDKPKYDFYENALFLDDPLEADLSRKARCLAPKIGT*
Ga0102822_109964413300007558EstuarineMGTEVRVGEDKPKYDFYENALFLDDPIEADISRKARCLAPKIGTEPRF*
Ga0105744_112761123300007863Estuary WaterMGTEVRVGEDKPKYDFYENALFLDDPIEADINRKHRCLAPKIGTEPRF*
Ga0105741_115197023300007956Estuary WaterMGTEVRVGEDKPKYDFYANALFLDDPIEADINRKHRCLAPKIGTEPRF*
Ga0114354_111967713300008119Freshwater, PlanktonMGTEVRIGEDKPRYDFDENALFLDDPIEADINRKHRCLAPKIGTEPRF*
Ga0103732_100920823300008929Ice Edge, Mcmurdo Sound, AntarcticaMAPGWSMGTEIRVGEDKPRYDFYENALFLDDPIEADISRKARCLAPKIGTEPRFNANNLE
Ga0103738_104921023300008935Ice Edge, Mcmurdo Sound, AntarcticaMGTEVRVGEDKPRYDFYENALFLDDPIEADISRKARCLAPKIGTEPRFNANNLE*
Ga0103741_107398323300008938Ice Edge, Mcmurdo Sound, AntarcticaMPGWSMGTEVRVGEDKPRYDFYENALFLDDPVEADIGRKARCLAPKIGTEPRF*
Ga0115651_121924333300008952MarineMASWLIGTEVRMGEDKPRYDFYENALFLDDPIMACLSRKPRCLAAKVGT*
Ga0114973_1029264013300009068Freshwater LakeLPNWGFGTAERMGADKAKYDFYENAMFHDDPMNADLTRKARCAAPKIGTEPRVKK*
Ga0115566_1029985923300009071Pelagic MarineMGTEVRVGEDKPKYDFYENALFLDDPIEADISRKARCLAPKIGTEPRFQSNNLE*
Ga0115566_1062868623300009071Pelagic MarineMGTEVRNGVEKPRYDFYENALFLDDPVEADLSRKARCTAPKIGTEPRFSSGN*
Ga0114963_1064031623300009154Freshwater LakeMGTEVRIGEDKPRYDFYENALFLDDPIEADINRKHRCLAPKIGTEPRF*
Ga0114995_1025015423300009172MarineMGTEVRVGEDQPKYDFYENALFLDDPIEADINRKPRCLAPKVGTEPRFQGSNLE*
Ga0114995_1036509623300009172MarineMPGWSMGTEVRVGEDKPRYDFYENALFLDDPIEADIGRKARCLAPKIGTEPRFQGSSNE*
Ga0114995_1084356313300009172MarineMGTEVRVGEDHPRYDFYENALFLDDPVEADVTRKPRCKAPKVGTEPRFQGSNLE*
Ga0103872_105752513300009263Surface Ocean WaterKYDFYENALFLDDPQEADISRKARVLAPKIGTEPRFAGSNMDHNPGP*
Ga0103873_101203733300009265Surface Ocean WaterGAPGWSMGTEVRVGEDKPKYDFYENALFLDDPQEADISRKARVLAPKIGTEPRFASSNMDHNPGP*
Ga0115005_1101663423300009432MarineEIRVGEDKPRYDFYENALFLDDPIEADISRKARCLAPKIGTEPRF*
Ga0115545_120967413300009433Pelagic MarineIRVGEDKPRYDFYENALFLDDPIEADISRKARCLAPKIGTEPRF*
Ga0115008_1045357613300009436MarineMGTEVRVGEDQPRYDFYENALFLDDPVEADINRKPRVKAPKVGTEPRFTGSNLEQNPGP*
Ga0115008_1052577233300009436MarineMGTEVRVGEDKPKYDFYENALFLDDPIEADINRKQRCLAPKIGTEPRF*
Ga0115571_120085533300009495Pelagic MarineSMGTEVRVGEDKPKYDFYENALFLDDPIEADINRKHRCLAPKIGTEPRF*
Ga0129287_1011581923300009538Beach Aquifer PorewaterMGSEAKNPEVKPKYDFYENALFLDDPIEADLSRKARCLAPKIGTEPRFANGTYENTPGP*
Ga0129347_113962013300012504AqueousEVRVGEDKPKYDFYENALFLDDPIEADISRKARVLAPKIGTQPRF*
Ga0163111_1042312823300012954Surface SeawaterMGTEVRVGEDKPKYDFYENALFLDDPIEADISRKARVLAPKIGTQPRF*
Ga0182091_152253923300016766Salt MarshGWSMGTEVRVGEDKPKYDFYENALFLDDPIEADISRKARCLAPKIGTEPRF
Ga0182046_102369313300016776Salt MarshEVRVGEDKPKYDFYENALFLDDPLEADLSRKPRCLAPKIGT
Ga0181403_107350413300017710SeawaterMGTEVRVGEDKPRYDFYENALFLDDPVEADVNRKARCLAPKIGTEPRFQGSSNE
Ga0181390_118007323300017719SeawaterTEVRVGEDKPKYDFYENALFLDDPIEADIQRKARCLAPKIGTEPRFQGSSAEAYPGP
Ga0181431_106652723300017735SeawaterMGTEVRVGEDQPKYDFYENALFLDDPTEADASRKPRVRAPKVGTEPRFTGSNLEQNPGP
Ga0181393_103843823300017748SeawaterMGTEVKMGEDKPKYDFYENALFLDDPIEADINRKARCLAPKIGTEPRFQGSSAEAYPGP
Ga0181425_105265923300017771SeawaterMGTEVRVGEDKPRYDFYENALFLDDPIEADIQRKARCLAPKIGT
Ga0181379_106884923300017783SeawaterMGTEVRVGEDKPKYDFYENALFLDDPIEADIQRKARCLAPKIGTEPRFQGSSAEAYPGP
Ga0181379_109329723300017783SeawaterMGTEVRVGEDKPRYDFYENALFLDDPIEADINRKARCRAPKIGTEPRF
Ga0181379_116317223300017783SeawaterMGTEVRVGEDKPRYDFYENALFLDDPVEADINRKPRCKAPKVGTEPRFTGSNLE
Ga0181379_118918723300017783SeawaterMPGWSMGTEVRVGEDKPKYDFYENALFLDDPIEADINRKARVKAPKIGTEPRF
Ga0181565_1027636933300017818Salt MarshMGTEVRVGEDKPKYDFYENALFLDDPLEADLSRKPRCLAPKIGT
Ga0181584_1068980613300017949Salt MarshDKPKYDFYENALFLDDPLEADISRKSRVLAPKIGTEPRFASGNLEHNPGP
Ga0181577_1040764023300017951Salt MarshMQAPGWSMGTEVRVGEDKPKYDFYENALFLDDPLEADLSRKPRCLAPKIGT
Ga0181581_1086858523300017962Salt MarshVGELKPKYDFYENALFLDDPIEADLSRKGRCLAPKIGTEPRF
Ga0181606_1042012323300018048Salt MarshMGTEVRVGEDKPKYDFYENALFLDDPVEADISRKARCLAPKIGTEPRF
Ga0181567_1099443913300018418Salt MarshMGTEVRVGEDKPRYDFYENALFLDDPVEADLNRKARCLAPKIGTEPRFNGGNLEQN
Ga0181568_1084075613300018428Salt MarshMGTEIRVGEDKPRYDFYENALFLDDPIEADISRKARCLAPKIGTEPRF
Ga0193355_101917523300018628MarineNGPNWSMGTEVRIGEQKPRYDFYENALFLDDPIEADLAKKPRCLAPKIGTEPRF
Ga0192944_104058313300018692MarineHGGTEVRVGEDKPRYDFYENALFLDDPVEADIGRKARCLAPKIGTEPRFQGSSNE
Ga0193253_105951823300018846MarineMGTEVRVGEDKPRYDFYENALFLDDPIEADINRKARCLAPKIGT
Ga0192978_108551713300018871MarineGTEIRVGEDKPRYDFYENALFLDDPIEADISRKARCLAPKIGTEPRF
Ga0193260_1005062723300018928MarineMGTEVRVGEDQPRYDFYENALFLDDPIEADIHRKPRCLAPKVGTEPRFTGSNLE
Ga0192894_1008018123300018968MarineMGTEVRVGEDKPRYDFYDNALFLDDPVEADIGRKARVLAPKVGTEPRFSGSNLEANPGP
Ga0192894_1011210013300018968MarineMGTEVRMGEDPPRYDFYENALFLDDPVEACLGRKARVLAPKVGTEPRFSGSNLE
Ga0192894_1024940933300018968MarineMGTEVRVGEDKARYDFYENALFLDDPVEADLNRKNRVLAPKVGTEPRFTGNNNLELNPGP
Ga0192961_1010568323300018980MarineMGTEVRVGEDKPKYDFYENALFLDDAIEADINRKPRCRAPKIGTEPRF
Ga0192961_1022137323300018980MarineMGTEVRVGEDQPKYDFYENALFLDDPIEADINRKPRCLAPKVGTEPRFQGSNLE
Ga0192968_1007331523300018981MarineMGTEVRVGEDKPKYDFYENALFLDDAIEADINRKARCRAPKIGTEPRF
Ga0192947_1008806423300018982MarineMGTEVRVGEDKPRYDFYENALFLDDPVEADIGRKARCLAPKIGTEPRFQGSSNE
Ga0192947_1009399923300018982MarineMGTEVRVGEDKPRYDFYENALFLDDPIEADIQRKARCLAPKIGTEPRF
Ga0193030_1006760523300018989MarineMGTEVRVGEDKPKYDFYENALFLDDAIEADINRKARCLAPKIGTEPRF
Ga0193037_1034508313300019033MarineIKYDDAPGWSLGTEVRVPEDKPRYDFYENALFLDDPVEADINRKQRCLAPKIGTEPRFSTSNLE
Ga0193336_1035792313300019045MarineMGTEVRVGEDKPRYDFYENALFLDDPIEADIGRKKRVLAPKIGTEPRF
Ga0193336_1051335013300019045MarineMGYDNGPNWSMGTEVRIGEDKPRYDFYENALFLDDPVEADIAKRPRPLAPKIGTEPRFQSGS
Ga0192981_1012802113300019048MarineMGTEIRVGEDKPRYDFYENALFLDDPIEADISRKARCLAPKIGTEPRFNANNLE
Ga0192981_1014337133300019048MarineMGTEIRVGEDKPRYDFYENALFLDDPIEADISRKARCLAPKIGTEPRFQSNNLE
Ga0192966_1025231613300019050MarineMPNWSMGTEVRVGEDKPKYDFYENALFLDDAIEADINRKARCRAPKIGTEPRF
Ga0211731_1048731423300020205FreshwaterMGTEVRIGEDKPRYDFYENALFLDDLIEADINRKHRCLAPKIGTEPRF
Ga0211699_1027492323300020410MarineMGTEVRNGVEKPKYDFYENALFLDDPIEADISRRARCTAPKIGTEPRFSSG
Ga0208222_103444223300020566FreshwaterVRVGEDKPRYDFYENALFLDDPIEADISRKPRCLAPKIGT
Ga0210307_118220023300021336EstuarineMQAPGWSMGTEVRVGEDKPKYDFYENALFLDDPLEADLSRKARCLAPKIGT
Ga0206691_157328623300021342SeawaterMGTEVRVGEDKPKYDFYENALFLDDPIEADINRKGRCLAPKVGTEPRF
Ga0206692_148446713300021350SeawaterMFSDNVKYDQAPGWSLGTEVRVGEDKPKYDFYENALFLDDPIEADISRKARVLAPKIGTQPRF
Ga0206123_1015488823300021365SeawaterMGTEVRVGEDKPKYDFYENALFLDDPIEADISRKARCLAPKIGTEPRFNTTNLEQNPGP
Ga0213869_1031743723300021375SeawaterTFMQAPGWSMGTEVRVGEDKPKYDFYENALFLDDPLEADLSRKARCLAPKIGT
Ga0222716_1040554023300021959Estuarine WaterMGTGIRIGDQKPKYDFYENALFLDDPLEADLSRKERCKAPKIGTEPRFSSGVADSNPGP
Ga0222713_1029007413300021962Estuarine WaterMGTGMRIGDYKPKYDFYENALFLDDPLEADLSRKERCKAPKIGTEPRFSSGVTDSNPGP
Ga0214917_1020352513300022752FreshwaterMGTEVRIGEDKPRYDFYENALFLDDPIEADINRKHRCLAPKIGTEPRF
Ga0255775_124171123300022907Salt MarshYHQYFQFQAPNWSMGTEVRVGEDKPKYDFYENALFLDDPVEADISRKARCLAPKIGTEPR
Ga0209634_130633323300025138MarineMGTEIRVGEDKPKYDFYENALFLDDPIEACLGRKARCLAPKIGTEPRF
Ga0209306_105710623300025680Pelagic MarineMGTEVRVGEDKPKYDFYENALFLDDPIEADINRKHRCLAPKIGTEPRF
Ga0209308_1018846413300025869Pelagic MarineMGTEVRVGEDKPKYDFYENALFLDDPIEADISRKARCLAPKIGTEPRFQSNNLE
Ga0209631_1016865223300025890Pelagic MarineMGTEIRVGEDKPKYDFYENALFLDDPIEADISRKARCLAPKIGTEPRFNSNNLEQNPGP
Ga0208275_102490323300026182MarineMGTEVRVAEDKPRYDFYENALFLDDPVEADINRKHRICAPKIGTEPRFNSSNLE
Ga0209710_114605223300027687MarineMPGWSMGTEVRVGEDKPRYDFYENALFLDDPIEADIGRKARCLAPKIGTEPRFQGSSNE
Ga0209467_111244313300027719FreshwaterMPAFGFGTSERVAVDKPKYDFYENAIFLDDPLQADGSRKPRVKAPKIGTEPRVI
Ga0209192_1009028523300027752MarineMGTEVRVGEDKPRYDFYENALFLDDPIEADIGRKARCLAPKIGTEPRFQGSSNE
Ga0209192_1026448413300027752MarineMGTEVRVGEDQPKYDFYENALFLDDPIEADINRKPRCLAPKVGTEPRF
Ga0209502_1028606613300027780MarineMPNWSMGTEVRVGEDKPKYDFYENALFLDDPIEADINRKHRCLAPKIGTEPRF
Ga0209302_1017630213300027810MarineMGTEVRVGEDHPRYDFYENALFLDDPVEADVTRKPRCKAPKVGTEPRFQGSNLE
Ga0209092_1030018213300027833MarineMGTEVRVGEDQPRYDFYENALFLDDPVEADINRKPRVKAPKVGTEPRFTGSNL
Ga0209092_1055176923300027833MarineMPNWSMGTEVRVGEDKPKYDFYENALFLDDPIEADINRKQRCLAPKIGTEPRF
Ga0209668_1104605413300027899Freshwater Lake SedimentVGTEVRVGEDKPRYDFYENALFLDDPIEADISRKPRCLAPKIGT
Ga0233450_1037698523300028115Salt MarshMGTEIRIGERKPKYDFYENALFLDDPLEADLSRKERCKAPKIGTEP
Ga0256412_130770113300028137SeawaterMGTEVRVGEDKPKYDFYENALFLDDPIEADIQRKARCLAPKIGTEPRFQGSSAGAYPGP
Ga0272440_109394723300028595Marine SedimentMGTEVRVGEDKPKYDFYENALFLDDPIEADLSRKSRCLAPKIGTEPRFQGTNLE
Ga0311341_1032739013300029908BogMPAFGFGTSERVAVDKPKYDFYENAIFLDDPLAADSSRKPRVKAPKIGTEPRVNIN
Ga0308137_107278613300030722MarineKYDAAPGWSMGTEIRVGEDKPRYDFYENALFLDDPIEADISRKARCLAPKIGTEPRF
Ga0265459_1247053213300030741SoilPPGWGFGTADKMGADKPRYDFYENVGFLDDPMNADLARKDRCKAPKIGTEPRMQMNILE
Ga0073964_1098978523300030788MarineMGTEVRIGEDKPKYDFYENALFLDDPVEADLNKRPRCLAPKIGTEPRF
Ga0307386_1078702733300031710MarineGWSMGTEIRVGEDKPRYDFYENALFLDDPIEADISRKARCLAPKIGTEPRF
Ga0307396_1046867913300031717MarineGEDKPKYDFYENALFLDDAIEADINRKARCRAPKIGTEPRF
Ga0307384_1044884013300031738MarineDAAPGWSMGTEIRVGEDKPRYDFYENALFLDDPIEADISRKARCLAPKIGTEPRF
Ga0307383_1049185913300031739MarineKYDAAPGWSMGTEIRVGEDKPRYDFYENALFLDDPIEADISRKARCLAPKIGTEPRFQSNNLE
Ga0314689_1056232313300032518SeawaterIKYDAAPGWSMGTEIRVGEDKPRYDFYENALFLDDPIEADISRKARCLAPKIGTEPRF
Ga0314677_1058047213300032522SeawaterIKYDNMPGWSMGTEVRVGEDKPRYDFYENALFLDDPIEADIGRKARCLAPKIGTEPRFQGSSNE
Ga0314687_1056375613300032707SeawaterDNVKYDQAPGWSLGTEVRVGEDKPKYDFYENALFLDDPIEADISRKARVLAPKIGTQPRF
Ga0314690_1048397913300032713SeawaterPGWSMGTEVRVGEDKPRYDFYENALFLDDPIEADIGRKARCLAPKIGTEPRFQGSSNE
Ga0314702_133788113300032725SeawaterAPGWSLGTEVRVGEDKPKYDFYENALFLDDPIEADISRKARVLAPKIGTQPRF
Ga0314705_1074904413300032744SeawaterTEVRVGEDKPRYDFYENALFLDDPIEADIGRKARCLAPKIGTEPRFQGSSNE
Ga0314713_1034918313300032748SeawaterKYDQAPGWSLGTEVRVGEDKPKYDFYENALFLDDPIEADISRKARVLAPKIGTQPRF
Ga0314713_1040011023300032748SeawaterVRVGEDKPRYDFYENALFLDDPIEADIGRKARCLAPKIGTEPRFQGSSNE
Ga0314700_1061311313300032752SeawaterAPGWSMGTEIRVGEDKPRYDFYENALFLDDPIEADISRKARCLAPKIGTEPRF
Ga0310342_10312553623300032820SeawaterMGTEVRVGEDKPRYDFYENALFLDDPVEADMSRKNRCTAPKIGT
Ga0307390_1054899823300033572MarineMGTEVRVGEDKPRYDFYENALFLDDPVEADIGRKARCLAPKIGTEPRF
Ga0335005_0232392_555_7343300034022FreshwaterMNIWFFIWFQAPNWSLGTEVRIGEDKPKYDFYENALFLDDPVEADLSRKARCLAPKIGT
Ga0335035_0458615_1_1533300034105FreshwaterQAPNWSLGTEVRIGEDKPKYDFYENALFLDDPVEADLSRKARCLAPKIGT
Ga0335035_0543891_1_1623300034105FreshwaterMIWFFIWFQAPNWSLGTEVRIGEDKPKYDFYENALFLDDPVEADLSRKARCLA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.