NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F054292

Metagenome / Metatranscriptome Family F054292

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054292
Family Type Metagenome / Metatranscriptome
Number of Sequences 140
Average Sequence Length 50 residues
Representative Sequence WKPSPEIGMLGGVLPLLTSSVSFRFTAVGGAAAIDDVYLDPMKSS
Number of Associated Samples 121
Number of Associated Scaffolds 140

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.96 %
% of genes near scaffold ends (potentially truncated) 92.14 %
% of genes from short scaffolds (< 2000 bps) 89.29 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.714 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(25.714 % of family members)
Environment Ontology (ENVO) Unclassified
(28.571 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 4.11%    β-sheet: 30.14%    Coil/Unstructured: 65.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 140 Family Scaffolds
PF01380SIS 34.29
PF07690MFS_1 10.71
PF10041DUF2277 3.57
PF07726AAA_3 1.43
PF03462PCRF 0.71
PF14833NAD_binding_11 0.71
PF01979Amidohydro_1 0.71
PF00117GATase 0.71
PF06724DUF1206 0.71
PF00877NLPC_P60 0.71
PF05988DUF899 0.71
PF01175Urocanase 0.71
PF01547SBP_bac_1 0.71
PF13487HD_5 0.71
PF02746MR_MLE_N 0.71
PF11753DUF3310 0.71
PF01568Molydop_binding 0.71
PF01047MarR 0.71
PF01370Epimerase 0.71
PF00326Peptidase_S9 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 140 Family Scaffolds
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 1.43
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 0.71
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 0.71
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 0.71
COG2987Urocanate hydrataseAmino acid transport and metabolism [E] 0.71
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.71

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.71 %
UnclassifiedrootN/A9.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001526|A105W1_1132663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300004479|Ga0062595_101533878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300005172|Ga0066683_10408054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria839Open in IMG/M
3300005172|Ga0066683_10830853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300005187|Ga0066675_11074840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300005294|Ga0065705_11149011All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005337|Ga0070682_101887934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300005339|Ga0070660_101924203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
3300005347|Ga0070668_100426783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1136Open in IMG/M
3300005434|Ga0070709_10481376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales940Open in IMG/M
3300005434|Ga0070709_10525072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium902Open in IMG/M
3300005436|Ga0070713_101985996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M
3300005439|Ga0070711_101301752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales631Open in IMG/M
3300005446|Ga0066686_10312398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1069Open in IMG/M
3300005456|Ga0070678_101615596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300005536|Ga0070697_100448595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1123Open in IMG/M
3300005549|Ga0070704_101072883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria731Open in IMG/M
3300005553|Ga0066695_10142560All Organisms → cellular organisms → Bacteria1489Open in IMG/M
3300005555|Ga0066692_10505077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium769Open in IMG/M
3300005561|Ga0066699_10978709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300005569|Ga0066705_10935318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300005598|Ga0066706_11305138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300005719|Ga0068861_100276358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1444Open in IMG/M
3300005840|Ga0068870_11271418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300006034|Ga0066656_10469636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium820Open in IMG/M
3300006173|Ga0070716_100273704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1161Open in IMG/M
3300006358|Ga0068871_100580615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1018Open in IMG/M
3300006903|Ga0075426_10762078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria727Open in IMG/M
3300006904|Ga0075424_102180243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300009012|Ga0066710_101407311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1080Open in IMG/M
3300009094|Ga0111539_12540936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300009101|Ga0105247_10590620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium822Open in IMG/M
3300009137|Ga0066709_102024038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria797Open in IMG/M
3300009148|Ga0105243_10669646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1008Open in IMG/M
3300009162|Ga0075423_11158391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria824Open in IMG/M
3300009553|Ga0105249_11453489All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300009553|Ga0105249_13451451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300009837|Ga0105058_1077752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria763Open in IMG/M
3300009840|Ga0126313_10113103All Organisms → cellular organisms → Bacteria2012Open in IMG/M
3300010036|Ga0126305_10086941All Organisms → cellular organisms → Bacteria1853Open in IMG/M
3300010041|Ga0126312_10715004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300010166|Ga0126306_10054313Not Available2784Open in IMG/M
3300010301|Ga0134070_10252070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300010304|Ga0134088_10370144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium697Open in IMG/M
3300010326|Ga0134065_10204494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium716Open in IMG/M
3300010335|Ga0134063_10231048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium876Open in IMG/M
3300012014|Ga0120159_1001370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13714Open in IMG/M
3300012198|Ga0137364_10901456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium669Open in IMG/M
3300012200|Ga0137382_10113685Not Available1801Open in IMG/M
3300012200|Ga0137382_10114328Not Available1796Open in IMG/M
3300012204|Ga0137374_10104570All Organisms → cellular organisms → Bacteria2658Open in IMG/M
3300012204|Ga0137374_10334379All Organisms → cellular organisms → Bacteria1228Open in IMG/M
3300012204|Ga0137374_10626245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria817Open in IMG/M
3300012207|Ga0137381_10203690All Organisms → cellular organisms → Bacteria1715Open in IMG/M
3300012208|Ga0137376_11475392All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300012209|Ga0137379_11473008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300012349|Ga0137387_10193560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1459Open in IMG/M
3300012357|Ga0137384_10436071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1079Open in IMG/M
3300012362|Ga0137361_10669117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria949Open in IMG/M
3300012685|Ga0137397_10439888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria971Open in IMG/M
3300012685|Ga0137397_11239961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300012896|Ga0157303_10305024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300012908|Ga0157286_10462281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300012951|Ga0164300_10090753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1318Open in IMG/M
3300012955|Ga0164298_10352369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria933Open in IMG/M
3300012955|Ga0164298_10998192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300012958|Ga0164299_10066385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1753Open in IMG/M
3300012961|Ga0164302_10261168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1107Open in IMG/M
3300012977|Ga0134087_10406548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium664Open in IMG/M
3300012985|Ga0164308_10160024All Organisms → cellular organisms → Bacteria1674Open in IMG/M
3300012986|Ga0164304_10516683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria875Open in IMG/M
3300013770|Ga0120123_1067831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria783Open in IMG/M
3300014052|Ga0120109_1006037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2679Open in IMG/M
3300014326|Ga0157380_11503695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium726Open in IMG/M
3300015356|Ga0134073_10392710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300017654|Ga0134069_1293319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300017659|Ga0134083_10242055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium753Open in IMG/M
3300018028|Ga0184608_10156380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria985Open in IMG/M
3300018056|Ga0184623_10420095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300018061|Ga0184619_10023257All Organisms → cellular organisms → Bacteria2563Open in IMG/M
3300018061|Ga0184619_10024075All Organisms → cellular organisms → Bacteria2523Open in IMG/M
3300018066|Ga0184617_1119144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria753Open in IMG/M
3300018076|Ga0184609_10127240All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300018076|Ga0184609_10410538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300018078|Ga0184612_10003921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter7396Open in IMG/M
3300018081|Ga0184625_10200841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1045Open in IMG/M
3300018431|Ga0066655_11271306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium526Open in IMG/M
3300018431|Ga0066655_11328029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300018433|Ga0066667_10602712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria916Open in IMG/M
3300018466|Ga0190268_11408673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria598Open in IMG/M
3300019767|Ga0190267_10653302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300019789|Ga0137408_1249709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1071Open in IMG/M
3300019875|Ga0193701_1031372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1090Open in IMG/M
3300020018|Ga0193721_1145741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300020070|Ga0206356_11448108Not Available709Open in IMG/M
3300021080|Ga0210382_10425593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300025898|Ga0207692_10654367Not Available679Open in IMG/M
3300025901|Ga0207688_11005916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300025903|Ga0207680_10336896Not Available1058Open in IMG/M
3300025906|Ga0207699_10032697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2933Open in IMG/M
3300025911|Ga0207654_10658659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium750Open in IMG/M
3300025961|Ga0207712_10375113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1189Open in IMG/M
3300026309|Ga0209055_1300613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300026324|Ga0209470_1191606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria874Open in IMG/M
3300026528|Ga0209378_1283293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300026538|Ga0209056_10147895Not Available1805Open in IMG/M
3300026542|Ga0209805_1252506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium692Open in IMG/M
3300026789|Ga0207513_100690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria686Open in IMG/M
3300028379|Ga0268266_10393774All Organisms → cellular organisms → Bacteria1309Open in IMG/M
3300028380|Ga0268265_11612802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300028708|Ga0307295_10077413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium880Open in IMG/M
3300028712|Ga0307285_10087923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium811Open in IMG/M
3300028715|Ga0307313_10120764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300028716|Ga0307311_10207114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300028719|Ga0307301_10093761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium948Open in IMG/M
3300028721|Ga0307315_10125599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria768Open in IMG/M
3300028721|Ga0307315_10210889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300028778|Ga0307288_10262440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium679Open in IMG/M
3300028796|Ga0307287_10410789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300028799|Ga0307284_10001788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5548Open in IMG/M
3300028799|Ga0307284_10130636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria958Open in IMG/M
3300028811|Ga0307292_10077061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1285Open in IMG/M
3300028814|Ga0307302_10079299All Organisms → cellular organisms → Bacteria1553Open in IMG/M
3300028814|Ga0307302_10584381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria555Open in IMG/M
3300028819|Ga0307296_10375799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300028819|Ga0307296_10667128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300028824|Ga0307310_10141980All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300028824|Ga0307310_10719243Not Available513Open in IMG/M
3300028876|Ga0307286_10056579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1336Open in IMG/M
3300028878|Ga0307278_10080020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1472Open in IMG/M
3300031226|Ga0307497_10572164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300031548|Ga0307408_100373648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1216Open in IMG/M
3300031720|Ga0307469_11283145All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300032012|Ga0310902_10397672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium876Open in IMG/M
3300032211|Ga0310896_10934480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil25.71%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.43%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.43%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.43%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.57%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.86%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.86%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.43%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.71%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.71%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.71%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.71%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.71%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.71%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.71%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.71%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001526Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-5cm-1A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026789Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A2a-11 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A105W1_113266323300001526PermafrostVLGVFDGGTISAGGAWKPSPQIGMLGGVLPLLTSSVSFRFTAVGGAVGIDDVYLDPMKSS
Ga0062595_10153387823300004479SoilDGGTISVGGSWKPSPQIGMLGGTLPLLTASVSFRFTAVGGAAAIDDVYLDPMKSS*
Ga0066683_1040805413300005172SoilGSWNASPAIGMLGGTLPLLTASVSFRFTAVGAAASIDDVYLDPMKSS*
Ga0066683_1083085333300005172SoilISAGGTWKPSPAIGMLGGVLPLLTASVSFRLTAVNGAAAIDDVYLDPMKSS*
Ga0066675_1107484013300005187SoilGSVSPNGTWNAAPETSMLGGVLPLLTASVSFRFTAAGAAASIDDVYLDPMKSG*
Ga0065705_1114901113300005294Switchgrass RhizosphereGGAWQPSPEIGMLGGTLPLLTSSVQFRFSAPNDGGSFRIDDVYLDPFLSR*
Ga0070682_10188793423300005337Corn RhizosphereGSWKPSPQIGMLGGTVPLLTASVSFRFTAVGGTAAIDDVYLDPMKSS*
Ga0070660_10192420333300005339Corn RhizosphereALGMLGGVLPLLTTSVSFRFTAVNGAAAIDDVYLDPMKSS*
Ga0070668_10042678333300005347Switchgrass RhizosphereRGLLSSVLGIFDGGTISAGSTWKPSPALGMLGGVLPLLTTSVSFRFAAVNGAAAIDDVYLDPMKSS*
Ga0070709_1048137633300005434Corn, Switchgrass And Miscanthus RhizosphereRGLLSSVLGIFDGGTISAGGTWKPSPALGMLGGVLPLLTTSVSFRFTAVNGAAAIDDVYLDPMKSS*
Ga0070709_1052507213300005434Corn, Switchgrass And Miscanthus RhizosphereGTISAGGSWKPSPAIGMLGGTLPLLTASVAFRFTAVNGAAAIDDVYLDPMKSS*
Ga0070713_10198599623300005436Corn, Switchgrass And Miscanthus RhizospherePSPAIGMLGGTLPLLTQSVSFRFTALNGAVAIDDVYLDPMKSS*
Ga0070711_10130175233300005439Corn, Switchgrass And Miscanthus RhizosphereSAGGTWKPSPALGMLGGVLPLLTTSVSFRFTAINGAAAIDDVYLDPMKSS*
Ga0066686_1031239823300005446SoilNGTWNAAPSISMLGGTLPLLTASVSFRFTAVGAAASIDDVYLDPMKSS*
Ga0070678_10161559623300005456Miscanthus RhizosphereGLLSSVLGILDGGTYTVGSGWKPSPEIGMLGGVLPLLTSSVSFRFTAVGGAAAIDDVYLDPMKSS*
Ga0070697_10044859533300005536Corn, Switchgrass And Miscanthus RhizosphereSAGSTWKPSPALGMLGGVLPLLTTSVSFRFTAVNGAAAIDDVYLDPMKSS*
Ga0070704_10107288323300005549Corn, Switchgrass And Miscanthus RhizosphereLDGGTYSTGGAWKPSSEIGMLGGVLPLLTSSVSFRFTAVDGAAAIDDVYLDPMKSS*
Ga0066695_1014256033300005553SoilDDGTMSPSGTWNAAPATSMLGGVLPLLTASVSFRFTAVGAAASIDDVYLDPMKSG*
Ga0066692_1050507713300005555SoilLGGTLPLFTTSVSFRFTAVGGAAAIDDVYLDPMKSS*
Ga0066699_1097870933300005561SoilGGTWKPSPAIGMLGGTLPLLTASVSFRFTAVGGAAAIDDVYLDPMKSS*
Ga0066705_1093531813300005569SoilGMLGGTLPLLTASVSFRFTAVGAAASIDDVYLDPMKSS*
Ga0066706_1130513813300005598SoilGTYSVGGSWKPSPQIGMLGGLLPLLTSSVSFRFTAVGGAMTIDDVYLDPMKSS*
Ga0068861_10027635813300005719Switchgrass RhizosphereGLLSSVLGIFDGGTISAGGTWKPSPALGMLGGVLPLLTTSVSFRFTAVNGAAAIDDVYLDPMKSS*
Ga0068870_1127141823300005840Miscanthus RhizosphereTYTVGSGWKPSPEIGMLGGVLPLLTSSVSFRFTAVGGAAAIDDVYLDPMKSS*
Ga0066656_1046963633300006034SoilSLLGIFDGGTISAGGTWKPSAAIGMLGGVLPLLTTSVAFRFTAVNGAAAIDDVYLDPMKSS*
Ga0070716_10027370413300006173Corn, Switchgrass And Miscanthus RhizosphereGLLSSVLGIFDGGTISAGSTWKPSPALGMLGGVLPLLTTSVSFRFTAVNGAAAIDDVYLDPMKSS*
Ga0068871_10058061533300006358Miscanthus RhizosphereWKPSPAIGMLGGTLPLLTASVAFRFTAVNGAAAIDDVYLDPMKSS*
Ga0075426_1076207813300006903Populus RhizosphereFDGGTITSNGTWQPSPQVSMLGGLLPLLTQSVQFRFVAVSGTVQVDDVYLDPWKVT*
Ga0075424_10218024313300006904Populus RhizosphereSVLGIFDGGSVTSNGTWQPSPEISMLGGVLPLLTQSVQFRLVATAGTPQVDDVYLDPWKVT*
Ga0066710_10140731123300009012Grasslands SoilLLSSILGIFDGGTISPSGSWNASPAIGMLGGTLPLLTASVSFRFTAVGAAASIDDVYLDPMKSS
Ga0111539_1254093633300009094Populus RhizosphereAGGSWKPSPAIGMLGGTLPLLTASVAFRFSAVNGAAAIDDVYLDPMKSS*
Ga0105247_1059062013300009101Switchgrass RhizosphereRGLLSSVLGIFDGGTISAGSTWKPSPALGMLGGVLPLLTTSVSFRFTAVNGAAAIDDVYLDPMKSS*
Ga0066709_10202403813300009137Grasslands SoilGILDGGTIPAGGTWKPSPQIGMLGGVLPLLTASVSFRFTAVGGAAAIDDVYLDPMKSS*
Ga0105243_1066964613300009148Miscanthus RhizosphereMLGGVLPLLTSSVSFRFTAVDGAAAIDDVYLDPMKSS*
Ga0075423_1115839123300009162Populus RhizosphereSVLGILDGGTYSVGSSWKPSPEISMLGGLLPLLTSSVSFRFTAVGGAVSIDDVYLDPMKSS*
Ga0105249_1145348923300009553Switchgrass RhizospherePEIGMLGGLLPLLTTGVQFRFPAVGGDVALDDVYLDPMKSS*
Ga0105249_1345145133300009553Switchgrass RhizosphereSVLGIFDGGTISAGGTWKPSPALGMLGGVLPLLTTSVSFRFTAVNGAAAIDDVYLDPMKSS*
Ga0105058_107775223300009837Groundwater SandIGMLGGVLPLLTSAVQFRFTALSGAVAIDDIYLDPMKSA*
Ga0126313_1011310333300009840Serpentine SoilGTVSTNGTWQPSPAIGMLGGVLPLLTQSVQFRFVATSGTPRIDDVYLDPMKSG*
Ga0126305_1008694113300010036Serpentine SoilPAIGMLGGVLPLLTQSVQFRFVATSGTPRIDDVYLDPMKSG*
Ga0126312_1071500413300010041Serpentine SoilILDGGTVSTNGTWQPSPAIGMLGGVLPLLTQSVQFRFVATSGTPRIDDVYLDPMKSG*
Ga0126306_1005431313300010166Serpentine SoilTNGTWQPSPAIGMLGGVLPLLTQSVQFRFVATSGTPRIDDVYLDPMKSG*
Ga0134070_1025207023300010301Grasslands SoilLLGIFDDGTMSPSGTWNAAPATSMLGGVLPLLTASVSFRFTAVGAAASIDDVYLDPMKSG
Ga0134088_1035146713300010304Grasslands SoilMLGGVLPLLTQSVQFRLVASAGTPQVDDVYLDPWKVT*
Ga0134088_1037014433300010304Grasslands SoilDGGTISAGGTWKPSPAIGMLGGVLPLLTTSVAFRFTAVNGAAVIDDVYLDPMKSS*
Ga0134065_1020449413300010326Grasslands SoilGAWRPSPEIGMLGGTLPLLTASVSFRFTAVGGAAGIDDVYLDPMKSS*
Ga0134063_1023104813300010335Grasslands SoilGMLGGTLPLFTTSVSFRFTAVGGNAAIDDVYLDPMKSS*
Ga0120159_100137013300012014PermafrostGMLGGLLPLLTSSVSFRFTAVGGAAGIDDVYLDPMKSS*
Ga0137364_1090145633300012198Vadose Zone SoilSSVLGILDGGTISADGSWKPSPQVGMLGGVLPLLTTSVSFRFTAVNGAVAIDDVYLDPMKSA*
Ga0137382_1011368513300012200Vadose Zone SoilPEIGMLGGTLPLLTASVSFRFTAVGGAAGIDDVYLDPMKFS*
Ga0137382_1011432813300012200Vadose Zone SoilGMLGGVLPLLPTSVAFRFTAVNGAAAIDDVYLDPMKSS*
Ga0137374_1010457043300012204Vadose Zone SoilGTVSAGNWSPSPAMSMLGGVLPLLTQSVQFRFVPVNGSVSLDDVYLDPMKSA*
Ga0137374_1033437923300012204Vadose Zone SoilYSAGGNWKPSPQVGMLGGILPLLTTSVQFRFTSSNGAVKIDDVYLDPMKSS*
Ga0137374_1062624523300012204Vadose Zone SoilWQPSPQVGMLGGVLPLLTSSVSFRFTAMNGAAAIDDVYLDPMKSS*
Ga0137381_1020369033300012207Vadose Zone SoilSSWKPSPEIGMLGGTLPLLTSSVSFRFTSSGGAVAIDDVYLDPMKSS*
Ga0137376_1147539233300012208Vadose Zone SoilLGGVLPLLTTSVSFRFTAVNGAVAIDDVYLDPMKSA*
Ga0137379_1147300823300012209Vadose Zone SoilKPSPQIGMLGGLLPLLTSSVSFRFTAVGGAATIDDVYLDPMKSS*
Ga0137387_1019356013300012349Vadose Zone SoilMLGGVLPLLTTSVSFRFTAVNGAAAIDDVYLDPMKSS*
Ga0137384_1043607123300012357Vadose Zone SoilDGGTYSVGSSWKPSPEIGMLGGTLPLLTSSVSFRFTSSGGAVAIDDVYLDPMKSS*
Ga0137361_1066911723300012362Vadose Zone SoilSPQIGMLGGVLPLLTASVSFRFTAVGGAAAIDDMYLDPMKSS*
Ga0150984_10889916213300012469Avena Fatua RhizospherePEVLMVGGVVPLLTKSVQFRFVATAGAPQLDDVYLDPWKVT*
Ga0137397_1043988823300012685Vadose Zone SoilGGVLPLLTSSVSFRFTAVGGAAGIDDVYLDPMKSS*
Ga0137397_1123996113300012685Vadose Zone SoilPSPQIGMLGGVLPLLTSSVSFRFTAVGGAAGIDDVYLDPMKSS*
Ga0157303_1030502423300012896SoilGLLSSVVGILDGGTYSAGGAWKPSPQIGMLGGVLPLLTSSVSFRFTAVDGAAAIDDVYLDPMKSS*
Ga0157286_1046228113300012908SoilQIGMLGGVLPLLTSSVSFRFTAVDGAAAIDDVYLDPMKSS*
Ga0164300_1009075323300012951SoilMNLFVRRVRAVGGTYTVGDGWKPSPEIGMLGGVLPLLTSSVSFRFTAVGGAAAIDDVYLDPMKSS*
Ga0164298_1035236923300012955SoilDGWKPSPEIGMLGGVLPLLTSSVSFRITAVGGAAAIDDVYLDPMKSS*
Ga0164298_1099819213300012955SoilMNLFVRRVRAVGGTYTVGDGWKPSPEIGMLGGVLPLLTSSVSFRFTAVGGAAAIDDVYLD
Ga0164299_1006638543300012958SoilMNLFVRRVRAVGGTYTVGDGWKPSPEIGMLGGVLPLLTSSVSFRFTAVGGAAAIDDVYLDPMK
Ga0164302_1026116823300012961SoilGLLSSLLGIFDGGTISADGSWKPSPAIGMLGGTLPLLTQSVSFRFTALNGAVAIDDVYLDPMKSS*
Ga0134087_1040654813300012977Grasslands SoilLGIFDGGTISSGGSWKPSPAIGMLGGTLPLFTTSVSFRFTAVGGNAAIDDVYLDPMKSS*
Ga0164308_1016002433300012985SoilLLSSVLGILDGGTYTVGSGWKPSPEIGMLGGVLPLLTSSVSFRFTAVGGAAAIDDVYLDPMKSS*
Ga0164304_1051668313300012986SoilWKPSPEIGMLGGVLPLLTSSVSFRFTAVGGAAAIDDVYLDPMKSS*
Ga0120123_106783113300013770PermafrostVFDGGTISAAGAWKPSPQIGMLGGVLPLLTSSVSFRFTAVGGAVGIDDVYLDPMKSS*
Ga0120109_100603723300014052PermafrostMLGGLLPLLTSSVSFRFTAVGGAVGIDDVYLDPMKSS*
Ga0157380_1150369513300014326Switchgrass RhizosphereGLLSSVLGIFYGGTISAGGTWKPSPALGMLGGVLPLLTTSVSFRFTAINGAAAIDDVYLDPMKSS*
Ga0134073_1039271033300015356Grasslands SoilLGGVLPLLTTSVSFRFTAVNGAAAIDDVYLDPMKSS*
Ga0134069_129331933300017654Grasslands SoilGMLGGVLPLLTTSVAFRFTAVNGAAAIDDVYLDPMKSS
Ga0134083_1024205513300017659Grasslands SoilKPSPAIGMLGGVLPLLTTSVAFRFTAVNGAAAIDDVYLDPMKSS
Ga0184608_1015638033300018028Groundwater SedimentAIGMLGGVLPLLTTSVSFRFTAVNGAAAIDDVYLDPMKSS
Ga0184623_1042009513300018056Groundwater SedimentGGTVSTNGTWQPSPGIGMLGGVLPLLTQSVQFRFVATSGTPKIDDVYLDPMKSG
Ga0184619_1002325733300018061Groundwater SedimentPQIGMLGGVLPLLTSSVSFRFTAVGGAAGIDDVYLDPMKSS
Ga0184619_1002407533300018061Groundwater SedimentVGSGWKPSPEIGMLGGVLPLLTSSVSFRFTSVGGAATIDDVYLDPMKSS
Ga0184617_111914423300018066Groundwater SedimentILDGGTMTVGKSWTPSPQVGMLGGVLPLLTSSVSFRFTASGGAASIDDVYLDPMKSS
Ga0184609_1012724033300018076Groundwater SedimentGLLSSLLGIFDGGTVSTNGTWQPSPGIGMLGGVLPLLTQSVQFRFVATSGTPRIDDVYLDPMKSG
Ga0184609_1041053813300018076Groundwater SedimentGGTVSTNGTWQPSPAISMLGGLLPLLTQSVQFRLVGTSGTPRIDDAYLDPMKSG
Ga0184612_1000392113300018078Groundwater SedimentPEIGMLGGVLPLLTSAVQFRFTASNGAVAIDDIYLDPMKSA
Ga0184625_1020084113300018081Groundwater SedimentLLSNVLGILDGGTYSAGDSWKPSPQVGMLGGVLPLLTASVSFRFTAVGGDAAIDDVYLDPMKSS
Ga0066655_1127130633300018431Grasslands SoilSPAIGMLGGNLPLFTTSVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0066655_1132802923300018431Grasslands SoilGMLGGTLPLLTASVSFRFTAVGAAASIDDVYLDPMKSS
Ga0066667_1060271213300018433Grasslands SoilSVSPNGTWNAAPETSMLGGVLPLLTASVSFRFTAAGAAASIDDVYLDPMKSG
Ga0190268_1140867313300018466SoilGTWQPSPAIGMLGGLLPLLTQSVQFRFVATSGTPKIDDVFLDPMKSG
Ga0190267_1065330223300019767SoilGMLGGVLPLLTSSVSFRFTAVDGAAAIDDVYLDPMKSS
Ga0137408_124970913300019789Vadose Zone SoilACSRACLASWTGGTISAGGTWKPSPAIGMLGGVLPLLTTSVAFRFTAVNGAAAIDDVYLDPMKSS
Ga0193701_103137223300019875SoilMLGGVLPLLTSGVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0193721_114574123300020018SoilILDGGTIPAGATWKPSPQIGMLGGVLPLLTASVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0206356_1144810813300020070Corn, Switchgrass And Miscanthus RhizosphereTISAGGSWKPSPQIGMLGGALPLLTASVSFRFTAVGGSVAIDDVYLDPMKSA
Ga0210382_1042559313300021080Groundwater SedimentVLGILDGGTYSAGGSWKPSPQIGMLGGVLPLLTASVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0222623_1007101433300022694Groundwater SedimentGGLLPLLTQSVQFRLVGTSGTPKIDDAYLDPMKSG
Ga0207692_1065436733300025898Corn, Switchgrass And Miscanthus RhizosphereIGMLGGTLPLLTASVAFRFTAVNGAAAIDDVYLDPMKSS
Ga0207688_1100591623300025901Corn, Switchgrass And Miscanthus RhizosphereSGWKPSPEIGMLGGVLPLLTSSVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0207680_1033689633300025903Switchgrass RhizosphereMLGGVLPLLTSSVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0207699_1003269713300025906Corn, Switchgrass And Miscanthus RhizosphereLGIFDRGTISAGGSWKPSPAIGMLGGTLPLLTASVAFRFTAVNGAAAIDDVYLDPMKSS
Ga0207654_1065865913300025911Corn RhizosphereSWKPSPQIGMLGGTVPLLTASVSFRFTAVGGTAAIDDVYLDPMKSS
Ga0207712_1037511333300025961Switchgrass RhizosphereGGVLPLLTTSVSFRFTAVNGAAAIDDVYLDPMKSS
Ga0209055_130061313300026309SoilWNASPAIGMLGGTLPLLTASVSFRFTAVNAAASIDDVYLDPMKSS
Ga0209470_119160633300026324SoilVLGIFDGGTISSGGSWKPSPAIGMLGGNLPLFTTSVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0209378_128329313300026528SoilGLLSSLLGILDGGTISAGGTWKPSPAIGMLGGVLPLLTTSVAFRFTAVNGAAAIDDVYLDPMKSS
Ga0209056_1014789533300026538SoilPAIGMLGGVLPLLTTSVAFRFTAVNGAAAIDDVYLDPMKSS
Ga0209805_125250633300026542SoilSGGTWKPSPAIGMLGGTLPLLTASVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0207513_10069023300026789SoilLDGGTYSSGGAWKPSPQIGMLGGVLPLLTASVSFRFTAVDGAAAIDDVYLDPMKSS
Ga0268266_1039377433300028379Switchgrass RhizosphereQIGMLGGTVPLLTASVSFRFTAVGGTAAIDDVYLDPMKSS
Ga0268265_1161280213300028380Switchgrass RhizosphereGTMTVGKSWSPSPEVGMVGGVLPLLTSSVSFRFTASGGSVAIDDVYLDPMKSS
Ga0307295_1007741333300028708SoilVGMLGGVLPLLTASVSFRFTAVGGDAAIDDVYLDPMKSS
Ga0307285_1008792333300028712SoilPSPALGMLGGVLPLLTTSVSFRFTAVNGAAAIDDVYLDPMKSS
Ga0307313_1012076413300028715SoilTYSAGGSWKPSPQIGMLGGVLPLLTASVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0307311_1020711413300028716SoilPSPQIGMLGGVLPLLTASVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0307301_1009376133300028719SoilRGLLSSVLGIFDGGTISAGGTWKPSPALGMLGGVLPLLTTSVSFRFTAVNGAAAIDDVYLDPMKSS
Ga0307315_1012559913300028721SoilGGVLPLLTSGVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0307315_1021088923300028721SoilSTNGTWQPSPAITMLGGLLPLLTQSVQFRLVGTSGTPKIDDAYLDPMKSG
Ga0307288_1026244013300028778SoilLSSVLGILDGGTVSTNGTWQPSPAITMLGGVLPLLTQSVQFRLVGTSGTPKIDDAYLDPMKSG
Ga0307287_1041078913300028796SoilIGMLGGVLPLLTSGVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0307284_1000178863300028799SoilWKPSPQIGMLGGVLPLLTASVSFRFTAVDGAAAIDDVYLDPMKSS
Ga0307284_1013063623300028799SoilTYSVGSSWSPSPQVGMLGGLLPLLTSSVSFRFTAVGGAASIDDVYLDPMKSS
Ga0307292_1007706133300028811SoilSAGGTWKPSPAIGMLGGVLPLLTTSVSFRFTAVNGAAAIDDVYLDPMKSS
Ga0307292_1029100333300028811SoilLGGVLPLLTQSVQFRFVATSGTPRIDDVYLDPMKSG
Ga0307302_1007929913300028814SoilGLLSSVLGILDGGTYSAGGSWKPSPQIGMLGGVLPLLTASVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0307302_1058438123300028814SoilLSSLLGILDGGTYSTGGSWKPSQQIGMLGGLLPLLTSGVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0307296_1037579913300028819SoilGGTYTVGGDWKPSPQIGMLGGVLPLLTSSVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0307296_1066712813300028819SoilSPQVGMLGGVLPLLTSSVSFRFTASGGAASIDDVYLDPMKSS
Ga0307310_1014198013300028824SoilRGLLSSVLGILDGGTVSTNGTWQPSPAITMLGGLLPLLTQSVQFRLVGTSGTPKIDDAYLDPMKSG
Ga0307310_1071924313300028824SoilGTWQPSPAIGMLGGVLPLLTQSVQFRFVATNGTPKIDDVYLDPMKSG
Ga0307286_1005657933300028876SoilGIFDGGTISAGGTWKPSPAIGMLGGVLPLLTTSVSFRFTAVNGAAAIDDVYLDPMKSS
Ga0307278_1008002013300028878SoilVLGIFDGGTISAGGFWKPSPQIGMLGGVLPLLTSSVSFRFTAVGGAAGIDDVYLDPMKSS
Ga0307278_1054896423300028878SoilIGMLGGVLPLLTQSVQFRFVATSGTPKIDDVYLDPMKSG
Ga0307497_1057216423300031226SoilPSPEIGMLGGVLPLLTSSVSFRFTAVGGAAAIDDVYLDPMKSS
Ga0307408_10037364823300031548RhizosphereMLGGVLPLLTQSVQFRFVATSGTPRIDDVYLDPMKSG
Ga0307469_1128314513300031720Hardwood Forest SoilMLGGTLPLLTASVAFRFTAVNGAAAIDDVYLDPMKSS
Ga0310902_1039767233300032012SoilIFDGGTISAGGSWKPSPAIGMLGGTLPLLTASVAFRFTAVNGAAAIDDVYLDPMKSS
Ga0310896_1093448013300032211SoilLSSVLGIFDGGTISAGGSWKPSPAIGMLGGTLPLLTASVVFRFTAVNGAAAIDDVYLDPMKSS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.