Metagenome Family F053096

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F053096
Family Type	Metagenome
Number of Sequences	141
Average Sequence Length	40 residues
Representative Sequence	MKYTGPAKPIPTHVELITDKGERVIFLLLAIFLAVFLYLE
Number of Associated Samples	75
Number of Associated Scaffolds	141

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	81.56 %
% of genes near scaffold ends (potentially truncated)	24.82 %
% of genes from short scaffolds (< 2000 bps)	78.72 %
Associated GOLD sequencing projects	68
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (48.936 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment (24.823 % of family members)
Environment Ontology (ENVO)	Unclassified (35.461 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (36.879 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 30.88% β-sheet: 0.00% Coil/Unstructured: 69.12%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 141 Family Scaffolds
PF10765	Phage_P22_NinX	10.64
PF06067	DUF932	2.84
PF13203	DUF2201_N	2.13
PF09967	DUF2201	1.42
PF04389	Peptidase_M28	1.42
PF01870	Hjc	0.71
PF11753	DUF3310	0.71
PF13362	Toprim_3	0.71
PF01555	N6_N4_Mtase	0.71
PF00271	Helicase_C	0.71
PF00476	DNA_pol_A	0.71
PF02195	ParBc	0.71
PF14279	HNH_5	0.71
PF01844	HNH	0.71
PF05732	RepL	0.71
PF12705	PDDEXK_1	0.71

COG ID	Name	Functional Category	% Frequency in 141 Family Scaffolds
COG0749	DNA polymerase I, 3'-5' exonuclease and polymerase domains	Replication, recombination and repair [L]	0.71
COG0863	DNA modification methylase	Replication, recombination and repair [L]	0.71
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	0.71
COG1591	Holliday junction resolvase Hjc, archaeal type	Replication, recombination and repair [L]	0.71
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	0.71

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	50.35 %
Unclassified	root	N/A	48.94 %
unclassified Thiobacillus	no rank	unclassified Thiobacillus	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.94 %
Viruses	superkingdom	All Organisms → Viruses	43.97 %
cellular organisms	root	All Organisms → cellular organisms	6.38 %
Thiobacillus sp. 65-1402	species	unclassified Thiobacillus → Thiobacillus sp. 65-1402	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.94 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	21.99 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	21.99 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	6.38 %
Thiobacillus sp. 65-1402	species	unclassified Thiobacillus → Thiobacillus sp. 65-1402	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.94 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	21.99 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	21.99 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	4.96 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.71 %
Thiobacillus sp. 65-1402	species	unclassified Thiobacillus → Thiobacillus sp. 65-1402	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.94 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	21.99 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	21.99 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.84 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.71 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.71 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.71 %
Thiobacillus sp. 65-1402	species	unclassified Thiobacillus → Thiobacillus sp. 65-1402	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.94 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	21.99 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	21.99 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.84 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.71 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	0.71 %
Negativicutes	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes	0.71 %
Thiobacillus sp. 65-1402	species	unclassified Thiobacillus → Thiobacillus sp. 65-1402	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.94 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	21.99 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	21.28 %
Aurantimonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae	2.84 %
Veillonellales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales	0.71 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.71 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.71 %
Thiobacillus sp. 65-1402	species	unclassified Thiobacillus → Thiobacillus sp. 65-1402	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.94 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	21.99 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	21.28 %
Aureimonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aureimonas	2.84 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.71 %
Veillonellaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae	0.71 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.71 %
Thiobacillus sp. 65-1402	species	unclassified Thiobacillus → Thiobacillus sp. 65-1402	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.94 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	21.99 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	21.28 %
Aureimonas frigidaquae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aureimonas → Aureimonas frigidaquae	2.84 %
Pseudomonas stutzeri group	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas stutzeri group	0.71 %
unclassified Veillonellaceae	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae	0.71 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.71 %
Thiobacillus sp. 65-1402	species	unclassified Thiobacillus → Thiobacillus sp. 65-1402	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.94 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	21.99 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	21.28 %
Aureimonas frigidaquae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aureimonas → Aureimonas frigidaquae	2.84 %
Veillonellaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium	0.71 %
Pseudomonas stutzeri subgroup	species subgroup	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas stutzeri group → Pseudomonas stutzeri subgroup	0.71 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.71 %
Thiobacillus sp. 65-1402	species	unclassified Thiobacillus → Thiobacillus sp. 65-1402	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.94 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	21.99 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	21.28 %
Aureimonas frigidaquae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aureimonas → Aureimonas frigidaquae	2.84 %
Pseudomonas stutzeri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas stutzeri group → Pseudomonas stutzeri subgroup → Pseudomonas stutzeri	0.71 %
Veillonellaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium	0.71 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.71 %
Thiobacillus sp. 65-1402	species	unclassified Thiobacillus → Thiobacillus sp. 65-1402	0.71 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000269\|M3P_1029994	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	752	Open in IMG/M
3300001605\|Draft_10251822	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas stutzeri group → Pseudomonas stutzeri subgroup → Pseudomonas stutzeri	1015	Open in IMG/M
3300002408\|B570J29032_109545095	Not Available	857	Open in IMG/M
3300002835\|B570J40625_100400513	All Organisms → Viruses → Predicted Viral	1334	Open in IMG/M
3300003430\|JGI25921J50272_10032471	All Organisms → Viruses → Predicted Viral	1285	Open in IMG/M
3300004112\|Ga0065166_10237186	Not Available	729	Open in IMG/M
3300004481\|Ga0069718_10015442	All Organisms → Viruses → Predicted Viral	1395	Open in IMG/M
3300004481\|Ga0069718_14548658	Not Available	782	Open in IMG/M
3300004481\|Ga0069718_15345888	All Organisms → Viruses → Predicted Viral	1159	Open in IMG/M
3300004481\|Ga0069718_15764605	Not Available	565	Open in IMG/M
3300004481\|Ga0069718_15784772	Not Available	552	Open in IMG/M
3300005527\|Ga0068876_10071670	All Organisms → Viruses → Predicted Viral	2088	Open in IMG/M
3300005527\|Ga0068876_10676943	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	553	Open in IMG/M
3300005581\|Ga0049081_10112401	All Organisms → Viruses → Predicted Viral	1011	Open in IMG/M
3300005581\|Ga0049081_10150071	Not Available	853	Open in IMG/M
3300005581\|Ga0049081_10297869	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M
3300005662\|Ga0078894_10211569	All Organisms → Viruses → Predicted Viral	1756	Open in IMG/M
3300005662\|Ga0078894_10334538	All Organisms → Viruses → Predicted Viral	1372	Open in IMG/M
3300005662\|Ga0078894_10550945	All Organisms → Viruses → Predicted Viral	1031	Open in IMG/M
3300007165\|Ga0079302_1115292	Not Available	554	Open in IMG/M
3300007538\|Ga0099851_1101663	Not Available	1095	Open in IMG/M
3300007538\|Ga0099851_1234727	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	659	Open in IMG/M
3300007974\|Ga0105747_1108959	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	870	Open in IMG/M
3300008107\|Ga0114340_1163921	Not Available	801	Open in IMG/M
3300008107\|Ga0114340_1235495	Not Available	573	Open in IMG/M
3300008114\|Ga0114347_1119472	Not Available	989	Open in IMG/M
3300008267\|Ga0114364_1123510	Not Available	765	Open in IMG/M
3300009009\|Ga0105105_10084826	Not Available	1501	Open in IMG/M
3300009009\|Ga0105105_10852886	Not Available	554	Open in IMG/M
3300009009\|Ga0105105_11007177	Not Available	518	Open in IMG/M
3300009009\|Ga0105105_11053553	Not Available	508	Open in IMG/M
3300009037\|Ga0105093_10231437	Not Available	961	Open in IMG/M
3300009037\|Ga0105093_10474476	Not Available	693	Open in IMG/M
3300009037\|Ga0105093_10486643	Not Available	685	Open in IMG/M
3300009037\|Ga0105093_10653356	Not Available	600	Open in IMG/M
3300009037\|Ga0105093_10854879	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	532	Open in IMG/M
3300009056\|Ga0102860_1211020	Not Available	557	Open in IMG/M
3300009081\|Ga0105098_10164678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aureimonas → Aureimonas frigidaquae	1004	Open in IMG/M
3300009082\|Ga0105099_10073924	All Organisms → Viruses → Predicted Viral	1833	Open in IMG/M
3300009082\|Ga0105099_10118445	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1468	Open in IMG/M
3300009082\|Ga0105099_10141963	Not Available	1347	Open in IMG/M
3300009082\|Ga0105099_10408931	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	811	Open in IMG/M
3300009082\|Ga0105099_10515226	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	726	Open in IMG/M
3300009082\|Ga0105099_10749434	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	609	Open in IMG/M
3300009082\|Ga0105099_10779542	Not Available	597	Open in IMG/M
3300009082\|Ga0105099_11012885	Not Available	529	Open in IMG/M
3300009085\|Ga0105103_10292040	Not Available	887	Open in IMG/M
3300009165\|Ga0105102_10082087	Not Available	1482	Open in IMG/M
3300009168\|Ga0105104_10529536	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aureimonas → Aureimonas frigidaquae	665	Open in IMG/M
3300009168\|Ga0105104_10563487	Not Available	646	Open in IMG/M
3300009168\|Ga0105104_10600792	Not Available	626	Open in IMG/M
3300009168\|Ga0105104_10977358	Not Available	500	Open in IMG/M
3300009169\|Ga0105097_10052364	All Organisms → Viruses → Predicted Viral	2199	Open in IMG/M
3300009169\|Ga0105097_10175627	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aureimonas → Aureimonas frigidaquae	1179	Open in IMG/M
3300009169\|Ga0105097_10580676	Not Available	630	Open in IMG/M
3300009419\|Ga0114982_1000360	Not Available	24568	Open in IMG/M
3300009419\|Ga0114982_1146830	Not Available	728	Open in IMG/M
3300009419\|Ga0114982_1219123	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	591	Open in IMG/M
3300009419\|Ga0114982_1251490	Not Available	550	Open in IMG/M
3300009433\|Ga0115545_1127630	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	901	Open in IMG/M
3300010374\|Ga0114986_1033065	Not Available	956	Open in IMG/M
3300010374\|Ga0114986_1034257	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	937	Open in IMG/M
3300012346\|Ga0157141_1000014	Not Available	99355	Open in IMG/M
3300012348\|Ga0157140_10001884	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2407	Open in IMG/M
3300012348\|Ga0157140_10014756	Not Available	810	Open in IMG/M
3300012665\|Ga0157210_1000051	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	62859	Open in IMG/M
3300017707\|Ga0181363_1017748	Not Available	1412	Open in IMG/M
3300017716\|Ga0181350_1049857	All Organisms → Viruses → Predicted Viral	1114	Open in IMG/M
3300017747\|Ga0181352_1205628	Not Available	505	Open in IMG/M
3300017754\|Ga0181344_1010038	All Organisms → Viruses → Predicted Viral	3051	Open in IMG/M
3300017754\|Ga0181344_1019960	All Organisms → Viruses → Predicted Viral	2086	Open in IMG/M
3300017754\|Ga0181344_1032358	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1596	Open in IMG/M
3300017754\|Ga0181344_1122438	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	749	Open in IMG/M
3300017766\|Ga0181343_1019738	All Organisms → Viruses → Predicted Viral	2093	Open in IMG/M
3300017766\|Ga0181343_1045624	All Organisms → Viruses → Predicted Viral	1297	Open in IMG/M
3300017766\|Ga0181343_1064239	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1066	Open in IMG/M
3300017766\|Ga0181343_1098883	Not Available	829	Open in IMG/M
3300017766\|Ga0181343_1116346	Not Available	753	Open in IMG/M
3300020048\|Ga0207193_1199993	Not Available	1581	Open in IMG/M
3300020151\|Ga0211736_10758565	All Organisms → Viruses → Predicted Viral	2769	Open in IMG/M
3300020159\|Ga0211734_10253057	Not Available	6016	Open in IMG/M
3300020160\|Ga0211733_10836072	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6023	Open in IMG/M
3300020162\|Ga0211735_11371820	All Organisms → Viruses → Predicted Viral	1044	Open in IMG/M
3300020543\|Ga0208089_1047963	Not Available	566	Open in IMG/M
3300021961\|Ga0222714_10168065	All Organisms → Viruses → Predicted Viral	1297	Open in IMG/M
3300021961\|Ga0222714_10265515	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	956	Open in IMG/M
3300021961\|Ga0222714_10269967	Not Available	945	Open in IMG/M
3300021961\|Ga0222714_10275326	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	933	Open in IMG/M
3300021962\|Ga0222713_10140687	All Organisms → Viruses → Predicted Viral	1678	Open in IMG/M
3300021963\|Ga0222712_10006374	Not Available	11669	Open in IMG/M
3300021963\|Ga0222712_10010877	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8246	Open in IMG/M
3300022063\|Ga0212029_1055279	Not Available	577	Open in IMG/M
3300022179\|Ga0181353_1148344	Not Available	542	Open in IMG/M
3300022190\|Ga0181354_1096821	Not Available	964	Open in IMG/M
3300022407\|Ga0181351_1003697	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5604	Open in IMG/M
3300022407\|Ga0181351_1045513	All Organisms → Viruses → Predicted Viral	1844	Open in IMG/M
3300022407\|Ga0181351_1152079	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	830	Open in IMG/M
3300027285\|Ga0255131_1000145	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	23075	Open in IMG/M
3300027285\|Ga0255131_1003649	Not Available	4124	Open in IMG/M
3300027300\|Ga0255140_1000911	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9068	Open in IMG/M
3300027710\|Ga0209599_10148640	Not Available	624	Open in IMG/M
3300027710\|Ga0209599_10191773	Not Available	550	Open in IMG/M
3300027721\|Ga0209492_1205181	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aureimonas → Aureimonas frigidaquae	676	Open in IMG/M
3300027762\|Ga0209288_10146725	Not Available	758	Open in IMG/M
3300027762\|Ga0209288_10194593	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	661	Open in IMG/M
3300027792\|Ga0209287_10045625	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1602	Open in IMG/M
3300027792\|Ga0209287_10061444	Not Available	1383	Open in IMG/M
3300027792\|Ga0209287_10087726	All Organisms → Viruses → Predicted Viral	1159	Open in IMG/M
3300027792\|Ga0209287_10116228	unclassified Thiobacillus → Thiobacillus sp. 65-1402	1006	Open in IMG/M
3300027792\|Ga0209287_10138233	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	921	Open in IMG/M
3300027805\|Ga0209229_10006043	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5060	Open in IMG/M
3300027808\|Ga0209354_10201558	Not Available	807	Open in IMG/M
3300027816\|Ga0209990_10060661	All Organisms → Viruses → Predicted Viral	1903	Open in IMG/M
3300028025\|Ga0247723_1000154	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	43281	Open in IMG/M
3300028025\|Ga0247723_1004585	Not Available	6466	Open in IMG/M
3300028025\|Ga0247723_1054065	All Organisms → Viruses → Predicted Viral	1136	Open in IMG/M
(restricted) 3300028569\|Ga0247843_1010936	Not Available	9482	Open in IMG/M
(restricted) 3300028569\|Ga0247843_1027655	All Organisms → Viruses → Predicted Viral	4017	Open in IMG/M
3300031578\|Ga0307376_10036021	All Organisms → cellular organisms → Bacteria → Proteobacteria	3700	Open in IMG/M
3300031758\|Ga0315907_10076423	All Organisms → Viruses → Predicted Viral	2893	Open in IMG/M
3300031758\|Ga0315907_10612793	Not Available	842	Open in IMG/M
3300031758\|Ga0315907_10634103	Not Available	823	Open in IMG/M
3300031787\|Ga0315900_10390568	All Organisms → Viruses → Predicted Viral	1102	Open in IMG/M
3300031787\|Ga0315900_11015096	Not Available	543	Open in IMG/M
3300031857\|Ga0315909_10664534	Not Available	683	Open in IMG/M
3300031857\|Ga0315909_10840738	Not Available	574	Open in IMG/M
3300031951\|Ga0315904_10102345	All Organisms → Viruses → Predicted Viral	3007	Open in IMG/M
3300031951\|Ga0315904_10547836	Not Available	1008	Open in IMG/M
3300033992\|Ga0334992_0280239	Not Available	790	Open in IMG/M
3300033994\|Ga0334996_0468461	Not Available	572	Open in IMG/M
3300033996\|Ga0334979_0168379	Not Available	1312	Open in IMG/M
3300033996\|Ga0334979_0399914	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	760	Open in IMG/M
3300034018\|Ga0334985_0017249	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5639	Open in IMG/M
3300034018\|Ga0334985_0019360	Not Available	5296	Open in IMG/M
3300034064\|Ga0335001_0015337	All Organisms → Viruses → Predicted Viral	4531	Open in IMG/M
3300034064\|Ga0335001_0220406	All Organisms → Viruses → Predicted Viral	1054	Open in IMG/M
3300034066\|Ga0335019_0652782	Not Available	610	Open in IMG/M
3300034102\|Ga0335029_0075489	Not Available	2422	Open in IMG/M
3300034116\|Ga0335068_0092696	All Organisms → Viruses → Predicted Viral	1703	Open in IMG/M
3300034119\|Ga0335054_0680404	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium	554	Open in IMG/M
3300034356\|Ga0335048_0325745	Not Available	787	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.29%
Engineered	Engineered	0.71%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	90.07%
Terrestrial	Environmental → Terrestrial	9.22%
Wastewater	Engineered → Wastewater	0.71%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	80.85%
Marine	Environmental → Aquatic → Marine	9.22%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	8.51%
Soil	Environmental → Terrestrial → Soil	0.71%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.71%

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Freshwater → Sediment	28.37%
Lentic	Environmental → Aquatic → Freshwater → Lentic	23.40%
Lake	Environmental → Aquatic → Freshwater → Lake	17.02%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	8.51%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	6.38%
Unclassified	Environmental → Aquatic → Marine → Unclassified	4.96%
Lotic	Environmental → Aquatic → Freshwater → Lotic	3.55%
Coastal	Environmental → Aquatic → Marine → Coastal	2.84%
River	Environmental → Aquatic → Freshwater → River	2.13%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.71%
Pelagic	Environmental → Aquatic → Marine → Pelagic	0.71%
Clay	Environmental → Terrestrial → Soil → Clay	0.71%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.71%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	28.37%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	21.99%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	16.31%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	8.51%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	6.38%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	4.96%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	3.55%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	2.84%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	2.13%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	1.42%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.71%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.71%
Unclassified	Environmental → Aquatic → Marine → Pelagic → Unclassified	0.71%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	0.71%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.71%

Habitat	Taxonomy	Distribution
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	24.82%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	18.44%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	10.64%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	6.38%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	6.38%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	4.96%
Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment	3.55%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	2.84%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	2.84%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	2.84%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	2.13%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	2.13%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	2.13%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	2.13%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	1.42%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.71%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	0.71%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.71%
Lotic	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic	0.71%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.71%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.71%
Pelagic Marine	Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine	0.71%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	0.71%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	0.71%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000269	Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 7, Mississippi Headwaters	Environmental	Open in IMG/M
3300001605	Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin	Engineered	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300003430	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD	Environmental	Open in IMG/M
3300004112	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)	Environmental	Open in IMG/M
3300004481	Combined Assembly of Gp0112041, Gp0112042, Gp0112043	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300007165	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16	Environmental	Open in IMG/M
3300007538	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG	Environmental	Open in IMG/M
3300007974	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008114	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA	Environmental	Open in IMG/M
3300008267	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR	Environmental	Open in IMG/M
3300009009	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009037	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015	Environmental	Open in IMG/M
3300009056	Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009082	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009085	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300009433	Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330	Environmental	Open in IMG/M
3300010374	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17	Environmental	Open in IMG/M
3300012346	Freshwater microbial communities from Emily Creek, Ontario, Canada - S29	Environmental	Open in IMG/M
3300012348	Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300017707	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N	Environmental	Open in IMG/M
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental	Open in IMG/M
3300017747	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020162	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1	Environmental	Open in IMG/M
3300020543	Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022063	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300027285	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d	Environmental	Open in IMG/M
3300027300	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8d	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027721	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027762	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027792	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027808	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)	Environmental	Open in IMG/M
3300027816	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028569 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m	Environmental	Open in IMG/M
3300031578	Soil microbial communities from Risofladan, Vaasa, Finland - TR-2	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300033994	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034018	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021	Environmental	Open in IMG/M
3300034064	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054	Environmental	Open in IMG/M
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034116	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR	Environmental	Open in IMG/M
3300034119	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166	Environmental	Open in IMG/M
3300034356	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
M3P_10299941	3300000269	Lotic	MTKYTGPAKPIHTHVELISDRAERIIFLLFAIFIAVYLYLE*
Draft_102518223	3300001605	Hydrocarbon Resource Environments	MKKYKGPAKPIPTHRELITDKGERIIFLLLAIVAAVFLWLE*
B570J29032_1095450951	3300002408	Freshwater	TQGESMRYKGPAKPIPTRREIVSDKAERVVFLLLAIFMAVFLLLE*
B570J40625_1004005131	3300002835	Freshwater	GITQGESMRYKGPAKPIPTRREIVSDKAERVVFLLLAIFMAVFLLLE*
JGI25921J50272_100324713	3300003430	Freshwater Lake	MKYRGPAKPVPTHIEIVSDKAERVIFLLLAIYLAVFLYLE*
Ga0065166_102371861	3300004112	Freshwater Lake	RYTGPAKPLPTHIEIVSDKAERIIFLLLAIYLAVFLYLE*
Ga0069718_100154421	3300004481	Sediment	MKRKYKGPPKPIPTHREIISDKAEAVIFILLAIVAAAILYLE*
Ga0069718_145486581	3300004481	Sediment	MTKPDNQTKYTGPSKPLPTHVEIISDKAERVIFLLFAVFLAVYFYVEG*
Ga0069718_153458882	3300004481	Sediment	MTRYTGPARGIPTHIEIISDKAERVIFLLLAIFMAVFLYLE*
Ga0069718_157646051	3300004481	Sediment	MPKYTGPAKPIPTHIELITDKGERIIFLLLAIVAAVILYLE*
Ga0069718_157847722	3300004481	Sediment	MPKYTGPAKPIPTHIEIVSDKAERIIFLLLAIYMAVYLYLE*
Ga0068876_100716706	3300005527	Freshwater Lake	MPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLAIFLYLE*
Ga0068876_106769432	3300005527	Freshwater Lake	MKYRGPAKPIPTHIELITDKGERVIFLLLAIFMAVFLYLE*
Ga0049081_101124013	3300005581	Freshwater Lentic	MKKYKGPPKPIPTTREIITDKAERVIFLLLAIFLAVFLWLE*
Ga0049081_101500713	3300005581	Freshwater Lentic	MPKYKGPAKPIPTYREPITDKGERIIFLLLAIFLAVYLYLE*
Ga0049081_102978692	3300005581	Freshwater Lentic	MKRYTGPAKPIPTYREPITDKGERIIFLLLAIFLAVFLYLE*
Ga0078894_102115694	3300005662	Freshwater Lake	MKKYTGPAKPIPTHTEIVSDKAERIIFLILAIVVAVILYVE*
Ga0078894_103345383	3300005662	Freshwater Lake	MTRKYKGPARGIPTHIEIVSDKAERIIFLLLAIYLAVVLYVE*
Ga0078894_105509452	3300005662	Freshwater Lake	MLEKKPNPLRYTGPAKPLPTHIEIVSDKAERIIFLLLAIYLAVFLYLE*
Ga0079302_11152923	3300007165	Deep Subsurface	MKYTGPAKPIPTHVELITDKGERVIFLLLAIVAAVFLYLE*
Ga0099851_11016632	3300007538	Aqueous	MKYTGPAKPIPTHVELVTDKAERVIFLLLAIVAAVFLYLE*
Ga0099851_12347272	3300007538	Aqueous	MKQSYKGPAEPSPTQRELITDKGERIIFLLLAIFMAVYLWLE*
Ga0105747_11089592	3300007974	Estuary Water	MPKYTGPAKPIRTHVELVSDKAERIIFLLFAIFLATYLYLE*
Ga0114340_11639211	3300008107	Freshwater, Plankton	AKPIPTHIELITDKGERVIFLLLAIFMAVFLYLE*
Ga0114340_12354953	3300008107	Freshwater, Plankton	SNMPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLAIFLYLE*
Ga0114347_11194723	3300008114	Freshwater, Plankton	MPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLAVYLYLE*
Ga0114364_11235103	3300008267	Freshwater, Plankton	VKYTGPAKPIDTHIELITDRGERIIFLLLAIFMAVYLYLE*
Ga0105105_100848261	3300009009	Freshwater Sediment	RRNEMKYTGPAKPIPTHIEIVSDKAERIIFLLLAIFMAVFLYLE*
Ga0105105_108528862	3300009009	Freshwater Sediment	MKYTGPAKPIPTHVELITDKGERVIFLLLAIFAAVFLYLE*
Ga0105105_110071771	3300009009	Freshwater Sediment	MKYTGPTKPTPTHIEIVSDKAERIIFLLLAVYLAVFLYLE*
Ga0105105_110535532	3300009009	Freshwater Sediment	MKRYQGPPKPIPTHIEIVSDKTERVVFLLLAIFMAVYLYLE*
Ga0105093_102314374	3300009037	Freshwater Sediment	VKYTGPAKPIPTHVELITDKGERVIFLLLAIVAAVFLYLE*
Ga0105093_104744762	3300009037	Freshwater Sediment	MKYTGPAIPTHIELITDKAERVIFLLLAIFLAVFLYLE*
Ga0105093_104866431	3300009037	Freshwater Sediment	KYTGPAKPIPTHVELITDKGERVIFLLLAIFIAVFLYLE*
Ga0105093_106533562	3300009037	Freshwater Sediment	MKKYTGPAKPIPTHIEIVSDKAERIIFLLLAIFLAVFLWLE*
Ga0105093_108548792	3300009037	Freshwater Sediment	MPTKYKGPAEPIPTHVELISDKAERVIFLLFAIFMAVYLYLE*
Ga0102860_12110202	3300009056	Estuarine	MPKYTGPAKPIRTHVELISDKAERIIFLLFAIFLATYLYLE*
Ga0105098_101646782	3300009081	Freshwater Sediment	MKYTGPAKPIPTHVELITDKGELVIFLLLAIVAAVFLYLD*
Ga0105099_100739241	3300009082	Freshwater Sediment	VKYTGPAKPIPTYREPITHKVDRVLFLLALIVLALDLLI
Ga0105099_101184451	3300009082	Freshwater Sediment	KLKERDMKRYTGPARGIPTHIEIVSDKAERVIFLLLAIFLAVYLYLE*
Ga0105099_101419631	3300009082	Freshwater Sediment	MKYTGPAKPIPTHIELITDKGERVIFLLLAIVAAV
Ga0105099_104089311	3300009082	Freshwater Sediment	KYTGPAKPIPTHIEIVSDKAERVIFLLLAIFMAVFLYLE*
Ga0105099_105152261	3300009082	Freshwater Sediment	MKYKGPAKPIPTHIEIVSDKAERIIFLLLAIFMAVFLWLE*
Ga0105099_107494342	3300009082	Freshwater Sediment	MKKYTGPAKPIPTHRELITDKGERIIFLLLAIFLAVYLWLE*
Ga0105099_107795423	3300009082	Freshwater Sediment	VKYTGPAKPIPTHVELITDKGERVIFLLLAIFMAVFLYLE*
Ga0105099_110128851	3300009082	Freshwater Sediment	QMKKYTGPAEPIPTHIEIVSDKAERVIFLLLAIVAAVILYLE*
Ga0105103_102920402	3300009085	Freshwater Sediment	MKYTGPAKPIPTHTELITDKGERVIFLLLAIFMAVFLYLE*
Ga0105102_100820871	3300009165	Freshwater Sediment	MKYTGPAKPIPSHTELIADKAERVIFLLLAIFAAVFLYLE*
Ga0105104_105295363	3300009168	Freshwater Sediment	MKYTGPAKPIPTHVELITDKGELVIFLLLAIVAAVFLYLE*
Ga0105104_105634872	3300009168	Freshwater Sediment	MKRYTGPAKPIPTYREPITDKGERVIFLLLAIFMAVYLYLEN*
Ga0105104_106007923	3300009168	Freshwater Sediment	MKYTGPAKPIPTHTELITDKGERVIFLLLAVVAAVFLYLD*
Ga0105104_109773582	3300009168	Freshwater Sediment	MKYTVPSKPIPTHVELISDKTERVIFLLLAIFLAVFLYLE*
Ga0105097_100523641	3300009169	Freshwater Sediment	MKYTGPTKPLTTHIELVSDKAERVIFLLLAIFLATYLY
Ga0105097_101756274	3300009169	Freshwater Sediment	MKYTGPAKPIPTHVELITDKGELVIFLLLAIVAAVFPYLD*
Ga0105097_105806762	3300009169	Freshwater Sediment	MRYTGPAKPIPTHTELITDKGERVIFLLLAVVAAVFLYLE*
Ga0114982_100036012	3300009419	Deep Subsurface	MLEKPSKYKGPSKPLPTHVELISDKAERVIFLLFAIFMAVFLYLE*
Ga0114982_11468302	3300009419	Deep Subsurface	MRYKGPAKPIPTRHEIVSDKAERVAFLLLAIFMAVFLLLE*
Ga0114982_12191231	3300009419	Deep Subsurface	SKPIPTKVEIVSDKAERIIFLLLAFFLAVYLFLE*
Ga0114982_12514903	3300009419	Deep Subsurface	MKKYTGPAKPIPTHIELITDKGERVIFLLLAIFMAVYLYLE*
Ga0115545_11276304	3300009433	Pelagic Marine	MKKYKPIPTHVELITDKGERVIFLLFAIFMAVYLYLEV*
Ga0114986_10330652	3300010374	Deep Subsurface	MKRYTGPSKPIPTKVEIVSDKAERIIFLLLAFFLAVYLFLE*
Ga0114986_10342573	3300010374	Deep Subsurface	MKYTGPTKPIHTHIEIVSDKAERVIFLLLAIFLAAYLYLE*
Ga0157141_100001413	3300012346	Freshwater	MKRYTGPARGVPTRIEIVSDKAERVIFLLLALFMAVYLYLE*
Ga0157140_100018843	3300012348	Freshwater	MKYRGPAKPIPTHVELITDKGERVIFLLLAIFMAAYLYLE*
Ga0157140_100147563	3300012348	Freshwater	MTKYTGPAKPIPTHREIISDKAELVIFVLFAIFMVAFLILE*
Ga0157210_100005122	3300012665	Freshwater	MPKYNGPAKPIPTYREPITDRGERVIFLLLAIFMAVFLYLE*
Ga0181363_10177482	3300017707	Freshwater Lake	MTRKYKGPAEPIPTHIEIVSDKAERIIFLLLAIYLAVFLYVE
Ga0181350_10498574	3300017716	Freshwater Lake	MKKYQGPAKPIPTTREIITDKAERVIFLLFAIFLAVYLLVA
Ga0181352_12056282	3300017747	Freshwater Lake	MTRKYKGPAKPIPTHIEIVSDKAERIIFLLLAIYLAVVLYVE
Ga0181344_10100384	3300017754	Freshwater Lake	MKKYTGPAKPIPTKVEIVSDKAERIIFLLLAVFLAVYLFLE
Ga0181344_10199601	3300017754	Freshwater Lake	KYTGPAKPVPTHIEIVSDKAERIIFLLLAIYLAVVLYVE
Ga0181344_10323583	3300017754	Freshwater Lake	MKYKGPAKPIPTRIEIVSDKAERVIFLLLAVAFAFIMYLE
Ga0181344_11224381	3300017754	Freshwater Lake	TGPAKPIRTHVELVSDKAERIIFLLFAIFLATYLYLE
Ga0181343_10197381	3300017766	Freshwater Lake	TRKYKGPAEPIPTHIEIVSDKAERIIFLLLAIYLAVVLYVE
Ga0181343_10456242	3300017766	Freshwater Lake	MKKYTGPSKPIPTKVEIVSDKAERIIFLLLAFFLAVYLFLE
Ga0181343_10642393	3300017766	Freshwater Lake	MKQSYKGPAKPIPTHIELISDRAERIIFLLLAIFMAVYLYLE
Ga0181343_10988833	3300017766	Freshwater Lake	MKYRGPAKPIPTHIEIVSDKAERVIFLLLAIYLAVFLYLE
Ga0181343_11163462	3300017766	Freshwater Lake	MKYRGPAKPIPTHSELITDNGERVIFLLLAVLAAVILYLE
Ga0207193_11999931	3300020048	Freshwater Lake Sediment	MRYTGPAKPIPTHTELITDKGERVIFLLLAIFLAVYLYLE
Ga0211736_107585655	3300020151	Freshwater	MKKYTGPAKPIPTHTEIVSDKAERIIFLILAIVAAVILYVE
Ga0211734_102530572	3300020159	Freshwater	VKYTGPAKPIDTETELITDKGERIIFLLLAIFLAVFLYLE
Ga0211733_108360727	3300020160	Freshwater	MKQEYKGPSEPIPTHRELISDRAERVIFLLLAIFMAVYLYLE
Ga0211735_113718202	3300020162	Freshwater	MKKYTGPAKPIPTHTEIVSDKAERIIFLILAIVVAVILYVE
Ga0208089_10479631	3300020543	Freshwater	GITQGESMRYKGPAKPIPTRREIVSDKAERVVFLLLAIFMAVFLLLE
Ga0222714_101680653	3300021961	Estuarine Water	MKKYKGPAKPIPTHTEIVSDKAERIIFLLLAIVLAVILYVE
Ga0222714_102655152	3300021961	Estuarine Water	MKKPIPTHRELITDKGERIIFLLLAIFMAVYLYLE
Ga0222714_102699673	3300021961	Estuarine Water	MPKYTGPAKPIPTHIELITDRGERIIFLLLAIFMAVFLYLD
Ga0222714_102753262	3300021961	Estuarine Water	MPKYTGPAKPIPTHIEIISDKAERIIFLLLAIFMAVYLYLE
Ga0222713_101406874	3300021962	Estuarine Water	MTRKYTGPAKPVPTHIEIVSDKAERIIFLLLAIYLAVVLYVE
Ga0222712_1000637418	3300021963	Estuarine Water	MKYTGPSKPVPTAVEIVSDKAERVIFLLLAIFLAVLLYLE
Ga0222712_1001087713	3300021963	Estuarine Water	MSYKGPAKPIPTRCEIVSDKAERVVFLLLAIFMAVFLLLE
Ga0212029_10552792	3300022063	Aqueous	MKYTGPAKPIPTHVELVTDKAERVIFLLLAIVAAVFLYLE
Ga0181353_11483442	3300022179	Freshwater Lake	MLEKKPNPLRYTGPAKPLPTHIEIVSDKAERIIFLLLAIYLAVFLYLE
Ga0181354_10968211	3300022190	Freshwater Lake	MKKYQGPAKPIPTTREIITDKAERVIFLLFAIFLAVYLLVE
Ga0181351_10036972	3300022407	Freshwater Lake	MPKYKGPAKPIPTHIELITDKGERIIFLLLAIFMAVYLWLE
Ga0181351_10455134	3300022407	Freshwater Lake	MPKYTGPAKPIRTHVELVSDKAERIIFLLFAIFLATYLYLE
Ga0181351_11520792	3300022407	Freshwater Lake	MPKYKGPAKPIPTYREPITDKGERIIFLLLAIFLAVYLYLE
Ga0255131_100014539	3300027285	Freshwater	MPKYTGPAKPIPTHREHISDKAELIIFALFAIFMVVFLLLE
Ga0255131_10036497	3300027285	Freshwater	MPKYTGPAKPIPTHREHISDKAELIIFALFAIFMVVFLFLE
Ga0255140_100091117	3300027300	Freshwater	KYTGPAKPIPTHREHISDKAELIIFALFAIFMVVFLLLE
Ga0209599_101486402	3300027710	Deep Subsurface	MRYKGPAKPIPTRHEIVSDKAERVAFLLLAIFMAVFLLLE
Ga0209599_101917733	3300027710	Deep Subsurface	MKKYTGPAKPIPTHIELITDKGERVIFLLLAIFMAVYLYLE
Ga0209492_12051811	3300027721	Freshwater Sediment	MKYTGPAKPIPTHVELITDKGELVIFLLLAIVAAVFPYLD
Ga0209288_101467251	3300027762	Freshwater Sediment	MKYTGPAKPIPTHVELITDKGERVIFLLLAIFLAVFLYLE
Ga0209288_101945932	3300027762	Freshwater Sediment	MKYTGPKKPTPTHIELVSDKAERIIFLLLAIFMAVFLYLE
Ga0209287_100456256	3300027792	Freshwater Sediment	MKRYTGPARGVPTHIEIVSDKAERVIFLLLAIFLAVYLYLE
Ga0209287_100614444	3300027792	Freshwater Sediment	MKYTGPANPIPTHVELITDKGERVIFLLLAIFAAVFLYLE
Ga0209287_100877261	3300027792	Freshwater Sediment	VKYTGPAKPIPTHVELITDKGERVIFLLLAIVAAVFLYL
Ga0209287_101162283	3300027792	Freshwater Sediment	MKYTGPANPIPTHVELITDKGERVIFLLLAIVAAVFLYLE
Ga0209287_101382333	3300027792	Freshwater Sediment	MPKYTGPAKPIPTHIEIVSDKAERIIFLLLAIFMAVFLYLE
Ga0209229_100060436	3300027805	Freshwater And Sediment	MPKYTGPAKPIRTHVELISDKAERIIFLLFAIFLATYLYLE
Ga0209354_102015584	3300027808	Freshwater Lake	QGPAKPIPTTREIITDKAERVIFLLFAIFLAVYLLVE
Ga0209990_100606616	3300027816	Freshwater Lake	NLKGSNMPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLAIFLYLE
Ga0247723_100015427	3300028025	Deep Subsurface Sediment	MKYKGPPKPLPTHIEIVSDKAERVIFLLLAFFLAVHLYLE
Ga0247723_100458516	3300028025	Deep Subsurface Sediment	MKKYTGPAKPIPTKVEIVSDKAERIIFLLLAFFLAVYLFLE
Ga0247723_10540653	3300028025	Deep Subsurface Sediment	MKYTGPTKPIHTHIEIVSDKAERVIFLLLAIFLAAYLYLE
(restricted) Ga0247843_101093614	3300028569	Freshwater	MKKYTGPAKPIDTHIEIITDKGERIIFLLLAIFLALFLYLE
(restricted) Ga0247843_10276554	3300028569	Freshwater	MKRYTGPAKPIPTYREPITDKGERIIFLLLAIFLAVFLYLE
Ga0307376_1003602110	3300031578	Soil	MKYTGPAKPIPTHVELITDKGERVIFLLLAIVAAVFLYLE
Ga0315907_100764233	3300031758	Freshwater	MKYRGPAKPIPTHIELITDKGERVIFLLLAIFMAVFLYLE
Ga0315907_106127933	3300031758	Freshwater	MPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLAIFLYLE
Ga0315907_106341033	3300031758	Freshwater	MPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLAVYLYLE
Ga0315900_103905683	3300031787	Freshwater	MPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLAIYLYLE
Ga0315900_110150963	3300031787	Freshwater	YTGPAKPIDTHIELITDRGERIIFLLLAIFLAIFLYLE
Ga0315909_106645341	3300031857	Freshwater	GPAKPIPTHIELITDKGERVIFLLLAIFMAVFLYLE
Ga0315909_108407383	3300031857	Freshwater	KYTGPAKPIDTHIELITDRGERIIFLLLAIFLAIFLYLE
Ga0315904_101023451	3300031951	Freshwater	MPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLA
Ga0315904_105478363	3300031951	Freshwater	YRGPAKPIPTHIELITDKGERVIFLLLAIFMAVFLYLE
Ga0334992_0280239_471_596	3300033992	Freshwater	MKKYKGPAKPIPTTREIITDKAERVIFLLFAIFLAVYLLVE
Ga0334996_0468461_164_286	3300033994	Freshwater	MKYTGPAKPIPTHIELISDKAERVIFLLLAIVAAVFLYLE
Ga0334979_0168379_135_260	3300033996	Freshwater	MKKYQGPAKPLPTRVELISDKAERVIFLLLAIFMAVYLWLE
Ga0334979_0399914_2_115	3300033996	Freshwater	MRYKGPAKPIPTRREIVSDKAERVVFLLLAIFMAVFLL
Ga0334985_0017249_4916_5038	3300034018	Freshwater	MRYKGPAKPIPTRCEIVSDKAERVVFLLLAIFMAVFLLLE
Ga0334985_0019360_3013_3135	3300034018	Freshwater	MRYTGPAKPIPTHTELISDKAERVIFLLLAVVAAVFLYLD
Ga0335001_0015337_3_122	3300034064	Freshwater	RYKGPAKPIPTRCEIVSDKAERVVFLLLAIFMAVFLLLE
Ga0335001_0220406_94_216	3300034064	Freshwater	MRYKGPAKPIPTRREIVSDKAERVVFLLLAIFMAVFLLLE
Ga0335019_0652782_440_565	3300034066	Freshwater	MKKYTGPAKPLPTRVELISDKAERVIFLLLAIFMAVYLWLE
Ga0335029_0075489_2310_2420	3300034102	Freshwater	GPAKPIPTHREPITDKGERIIFLLLAIFLAVYLYLE
Ga0335068_0092696_560_688	3300034116	Freshwater	MPKYKGPAKPIPTYREPITDKGERIIFLLLAIFLAVFLYLEN
Ga0335054_0680404_446_553	3300034119	Freshwater	MKYTGPAKPIPTHTELISDQAERVIFLLLAIVAAVF
Ga0335048_0325745_2_118	3300034356	Freshwater	MKKYQGPAKPIPTTREIITDKAERVIFLLFAIFLAVYLL

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters