NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F049900

Metagenome Family F049900

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049900
Family Type Metagenome
Number of Sequences 146
Average Sequence Length 36 residues
Representative Sequence VGLNPFRQARRSPADYVMVAVAVVVCVALVAWALFG
Number of Associated Samples 102
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 39.16 %
% of genes near scaffold ends (potentially truncated) 8.90 %
% of genes from short scaffolds (< 2000 bps) 75.34 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.068 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.973 % of family members)
Environment Ontology (ENVO) Unclassified
(28.082 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.096 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 35.94%    β-sheet: 0.00%    Coil/Unstructured: 64.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF02021UPF0102 22.60
PF00378ECH_1 21.23
PF13541ChlI 15.07
PF00300His_Phos_1 10.27
PF01245Ribosomal_L19 3.42
PF01746tRNA_m1G_MT 1.37
PF00318Ribosomal_S2 1.37
PF05193Peptidase_M16_C 0.68
PF00034Cytochrom_C 0.68
PF01569PAP2 0.68
PF07859Abhydrolase_3 0.68
PF00903Glyoxalase 0.68
PF02481DNA_processg_A 0.68
PF01243Putative_PNPOx 0.68
PF00886Ribosomal_S16 0.68
PF08659KR 0.68
PF06259Abhydrolase_8 0.68
PF01654Cyt_bd_oxida_I 0.68
PF13683rve_3 0.68
PF02881SRP54_N 0.68
PF00905Transpeptidase 0.68
PF10502Peptidase_S26 0.68
PF13442Cytochrome_CBB3 0.68
PF02899Phage_int_SAM_1 0.68
PF10611DUF2469 0.68
PF13365Trypsin_2 0.68
PF13083KH_4 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG0792Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 familyReplication, recombination and repair [L] 22.60
COG0335Ribosomal protein L19Translation, ribosomal structure and biogenesis [J] 3.42
COG0052Ribosomal protein S2Translation, ribosomal structure and biogenesis [J] 1.37
COG0758Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptakeReplication, recombination and repair [L] 1.37
COG0228Ribosomal protein S16Translation, ribosomal structure and biogenesis [J] 0.68
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.68
COG1271Cytochrome bd-type quinol oxidase, subunit 1Energy production and conversion [C] 0.68
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.68
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.07 %
UnclassifiedrootN/A34.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309009|GPKNP_GG3DY5402IDGRXNot Available502Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_13193569All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300000956|JGI10216J12902_103871619All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300000956|JGI10216J12902_108607105Not Available687Open in IMG/M
3300000956|JGI10216J12902_109594242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales981Open in IMG/M
3300000956|JGI10216J12902_110460119Not Available609Open in IMG/M
3300001213|JGIcombinedJ13530_109575282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria546Open in IMG/M
3300001431|F14TB_100151031Not Available528Open in IMG/M
3300005937|Ga0081455_10006425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria12598Open in IMG/M
3300006038|Ga0075365_10114307All Organisms → cellular organisms → Bacteria1857Open in IMG/M
3300006038|Ga0075365_10571754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria799Open in IMG/M
3300006038|Ga0075365_10670331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300006042|Ga0075368_10275543All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300006049|Ga0075417_10320114All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300006051|Ga0075364_10048930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2755Open in IMG/M
3300006057|Ga0075026_100441305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300006172|Ga0075018_10503667All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300006178|Ga0075367_10770466Not Available612Open in IMG/M
3300006844|Ga0075428_100675495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1101Open in IMG/M
3300006844|Ga0075428_100969612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria901Open in IMG/M
3300006845|Ga0075421_100000510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria40752Open in IMG/M
3300006846|Ga0075430_100505205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria998Open in IMG/M
3300006847|Ga0075431_100484902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales1229Open in IMG/M
3300006852|Ga0075433_11574290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300006894|Ga0079215_11490210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300006954|Ga0079219_12087560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Microthrixaceae → Candidatus Microthrix → Candidatus Microthrix parvicella542Open in IMG/M
3300007004|Ga0079218_11410962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria745Open in IMG/M
3300007517|Ga0105045_10036593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales4467Open in IMG/M
3300007521|Ga0105044_10004413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia19334Open in IMG/M
3300007521|Ga0105044_10300834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1519Open in IMG/M
3300009094|Ga0111539_10093193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3538Open in IMG/M
3300009094|Ga0111539_11920814Not Available686Open in IMG/M
3300009095|Ga0079224_100153116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales3335Open in IMG/M
3300009095|Ga0079224_101244024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1059Open in IMG/M
3300009095|Ga0079224_103352763Not Available638Open in IMG/M
3300009100|Ga0075418_10006060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13649Open in IMG/M
3300009100|Ga0075418_10017746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter7866Open in IMG/M
3300009100|Ga0075418_12544969All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300009120|Ga0117941_1082583Not Available871Open in IMG/M
3300009153|Ga0105094_10050448Not Available2305Open in IMG/M
3300009156|Ga0111538_10715144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1269Open in IMG/M
3300009156|Ga0111538_11235191Not Available944Open in IMG/M
3300009162|Ga0075423_12494046Not Available564Open in IMG/M
3300009166|Ga0105100_10578064Not Available688Open in IMG/M
3300009527|Ga0114942_1478281Not Available513Open in IMG/M
3300009789|Ga0126307_10000470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria25854Open in IMG/M
3300009789|Ga0126307_10029412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4217Open in IMG/M
3300009807|Ga0105061_1029884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria765Open in IMG/M
3300009870|Ga0131092_10102981All Organisms → cellular organisms → Bacteria3355Open in IMG/M
3300010037|Ga0126304_10897108Not Available603Open in IMG/M
3300010047|Ga0126382_11820011Not Available573Open in IMG/M
3300010362|Ga0126377_12510524Not Available591Open in IMG/M
3300010362|Ga0126377_12940895Not Available550Open in IMG/M
3300010366|Ga0126379_12453355Not Available620Open in IMG/M
3300012204|Ga0137374_10791072All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300012355|Ga0137369_10097902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2415Open in IMG/M
3300012355|Ga0137369_10338304All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300012529|Ga0136630_1080997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1202Open in IMG/M
3300012668|Ga0157216_10020249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3482Open in IMG/M
3300012679|Ga0136616_10184050All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300012680|Ga0136612_10098680Not Available1479Open in IMG/M
3300012915|Ga0157302_10154625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria783Open in IMG/M
3300012973|Ga0123351_1190960Not Available800Open in IMG/M
3300012973|Ga0123351_1233877Not Available698Open in IMG/M
3300014314|Ga0075316_1047940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium921Open in IMG/M
3300014326|Ga0157380_12056620Not Available633Open in IMG/M
3300014326|Ga0157380_13265615Not Available518Open in IMG/M
3300015163|Ga0167665_1000315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria17012Open in IMG/M
3300015209|Ga0167629_1038417Not Available1660Open in IMG/M
3300015209|Ga0167629_1089383Not Available953Open in IMG/M
3300015371|Ga0132258_10523255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2969Open in IMG/M
3300015373|Ga0132257_104213473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300017960|Ga0180429_10131211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1677Open in IMG/M
3300018052|Ga0184638_1285997Not Available560Open in IMG/M
3300018072|Ga0184635_10082477Not Available1262Open in IMG/M
3300018422|Ga0190265_10012770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales6404Open in IMG/M
3300018422|Ga0190265_10176204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2123Open in IMG/M
3300018422|Ga0190265_11388030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300018422|Ga0190265_11803001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium720Open in IMG/M
3300018422|Ga0190265_13368912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300018429|Ga0190272_10279851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1276Open in IMG/M
3300018432|Ga0190275_10016456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5622Open in IMG/M
3300018432|Ga0190275_10978442Not Available917Open in IMG/M
3300018432|Ga0190275_11250355Not Available818Open in IMG/M
3300018432|Ga0190275_12564628Not Available587Open in IMG/M
3300018465|Ga0190269_10016368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3329Open in IMG/M
3300018465|Ga0190269_10215213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1053Open in IMG/M
3300018466|Ga0190268_10673849Not Available752Open in IMG/M
3300018469|Ga0190270_10011834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4989Open in IMG/M
3300018469|Ga0190270_10115463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2096Open in IMG/M
3300018469|Ga0190270_10683356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1015Open in IMG/M
3300018469|Ga0190270_10819934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria939Open in IMG/M
3300018469|Ga0190270_10928069Not Available891Open in IMG/M
3300018469|Ga0190270_11450783Not Available734Open in IMG/M
3300018476|Ga0190274_11449110All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300018476|Ga0190274_12196252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300018476|Ga0190274_13067495Not Available561Open in IMG/M
3300018481|Ga0190271_10514354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1309Open in IMG/M
3300018481|Ga0190271_10612989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1208Open in IMG/M
3300018481|Ga0190271_11989688Not Available690Open in IMG/M
3300018481|Ga0190271_12107831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria671Open in IMG/M
3300018481|Ga0190271_13051081Not Available562Open in IMG/M
3300019361|Ga0173482_10349306Not Available669Open in IMG/M
3300019377|Ga0190264_12065538All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300019487|Ga0187893_10004574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria26107Open in IMG/M
3300020509|Ga0208594_1000110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria27059Open in IMG/M
3300022213|Ga0224500_10172561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria801Open in IMG/M
3300022213|Ga0224500_10384217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300022309|Ga0224510_10087330All Organisms → cellular organisms → Bacteria → Terrabacteria group1762Open in IMG/M
3300025791|Ga0210115_1092544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300026535|Ga0256867_10121673Not Available994Open in IMG/M
3300027379|Ga0209842_1029130Not Available1045Open in IMG/M
3300027823|Ga0209490_10104424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2054Open in IMG/M
3300027831|Ga0209797_10035449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales2254Open in IMG/M
3300027866|Ga0209813_10323917Not Available604Open in IMG/M
3300027880|Ga0209481_10018202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales3082Open in IMG/M
3300027897|Ga0209254_10620967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria758Open in IMG/M
3300027909|Ga0209382_10039275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5675Open in IMG/M
(restricted) 3300027997|Ga0255057_10521563Not Available577Open in IMG/M
3300028007|Ga0247718_1173790Not Available507Open in IMG/M
3300028483|Ga0233377_1009537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2808Open in IMG/M
3300028590|Ga0247823_10637713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300028741|Ga0302256_10060127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria978Open in IMG/M
3300028812|Ga0247825_10376488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia1000Open in IMG/M
3300030336|Ga0247826_10187410Not Available1403Open in IMG/M
3300030496|Ga0268240_10071213Not Available778Open in IMG/M
3300031228|Ga0299914_10091169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales2664Open in IMG/M
3300031228|Ga0299914_10201746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1764Open in IMG/M
3300031229|Ga0299913_10011455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter7920Open in IMG/M
3300031229|Ga0299913_10656750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1028Open in IMG/M
3300031229|Ga0299913_10698586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales992Open in IMG/M
3300031455|Ga0307505_10041286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2061Open in IMG/M
3300031548|Ga0307408_101566595Not Available625Open in IMG/M
3300031548|Ga0307408_101897251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300031726|Ga0302321_102998020Not Available551Open in IMG/M
3300031727|Ga0316576_10550946Not Available845Open in IMG/M
3300031903|Ga0307407_10785747All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300031965|Ga0326597_10288627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1872Open in IMG/M
3300033407|Ga0214472_11699433All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300033416|Ga0316622_100660621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium1207Open in IMG/M
3300033417|Ga0214471_10213584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1582Open in IMG/M
3300033417|Ga0214471_11148112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300034148|Ga0364927_0045197Not Available1137Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.97%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere11.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil5.48%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere4.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.11%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater2.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.74%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil2.74%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.74%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand2.05%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment2.05%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.05%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.05%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil2.05%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.05%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.37%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.37%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.37%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.37%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.37%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.37%
FecalHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Fecal1.37%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.37%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.68%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.68%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.68%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.68%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.68%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater0.68%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.68%
Lake SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.68%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.68%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.68%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.68%
Elk FecesHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces0.68%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.68%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.68%
Anaerobic Biogas ReactorEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor0.68%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309009Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007517Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300007521Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009095Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009120Lake sediment microbial communities from Tanners Lake, St. Paul, MNEnvironmentalOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009527Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold CreekEnvironmentalOpen in IMG/M
3300009770Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C12 SIP DNAEngineeredOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009807Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10EnvironmentalOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012529Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06)EnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012679Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06)EnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012973Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E36 Day 36 MetagenomeHost-AssociatedOpen in IMG/M
3300014314Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015163Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1b, glacier snout)EnvironmentalOpen in IMG/M
3300015209Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017960Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_1 metaGEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300020509Freshwater microbial communities from Lake Mendota, WI - 14SEP2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022309Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300025791Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027379Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027650Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeqEnvironmentalOpen in IMG/M
3300027823Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027997 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6EnvironmentalOpen in IMG/M
3300028007Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-1-E_DEnvironmentalOpen in IMG/M
3300028483Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E36Host-AssociatedOpen in IMG/M
3300028590Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30EnvironmentalOpen in IMG/M
3300028741Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031727Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GPKNP_016626602070309009SoilMGLNPFGQQRRSAADYVMVVAAVVACILLVAWALFG
ICChiseqgaiiFebDRAFT_1319356923300000363SoilVGLNPFRQQRRSPADILMVVGALVVCVALVAWALFA*
JGI10216J12902_10387161923300000956SoilMGLNPFRQIHRSPADYVMVVVAVLVCVALVAWAVLG*
JGI10216J12902_10860710523300000956SoilLNPFRETHRSPADYLMVVVAVLICIALVAWALFG*
JGI10216J12902_10959424223300000956SoilMLVAVGLNPFRQAHRSPADYVMVAVAVLVCVALVAWALFG*
JGI10216J12902_11046011923300000956SoilVGLNPFRQARRSPADYLMVAVAVLVCIALVAWALFG*
JGIcombinedJ13530_10957528213300001213WetlandPDRARILDVVGFNPFRQQRRSFADYAMVGGALIVLVLLVLWAFFG*
F14TB_10015103113300001431SoilVGFNPFRKARRSSADYLMVATALVVCALLVIWALFG*
Ga0081455_1000642563300005937Tabebuia Heterophylla RhizosphereVGFNPFRQSRRSPADYVMVAAALVVCAALVIWALVG*
Ga0075365_1011430733300006038Populus EndosphereMNPFRPHRRSPADYVMVVAALLVVAALIAWAFLG*
Ga0075365_1057175423300006038Populus EndosphereMNPFRQHRRSPADYVMVAVAFAVIVALVLWAFFG*
Ga0075365_1067033123300006038Populus EndosphereVGLNPFRQARRSPADYVMVAVAVVVCVALVAWALFG*
Ga0075368_1027554323300006042Populus EndosphereMNPFRQHRRSPADYVMVAVAGVVILALVLWAFFG*
Ga0075417_1032011423300006049Populus RhizosphereVGLNPFRQQRRSPADIVMVAGAIVVVVLLVAWALFG*
Ga0075364_1004893033300006051Populus EndosphereMNPFRQHRRSPADYVMVAAALLILAALVAWAFFG*
Ga0075026_10044130523300006057WatershedsMNPFRPHRRSPADFVMVGAALLVVIGLVVWAIHG*
Ga0075018_1050366723300006172WatershedsMGMNPFRPPRRTPADYVMVAAALVVLAALVFWAVHG*
Ga0075367_1077046623300006178Populus EndosphereMNPFRQHRRSPADYVMVAVAAVVILALVLWAFFG*
Ga0075428_10067549523300006844Populus RhizosphereVGFNPFRQSRRSPADYVMVAAALVVCAALVIWALAG*
Ga0075428_10096961243300006844Populus RhizosphereDTDGVGLNPFRQQRRSPADIVMVAGAIVVVVLLVAWALFG*
Ga0075421_10000051083300006845Populus RhizosphereVGFNPFRQQRRSYADYVMVAAAIVICIVLVAWALFG*
Ga0075430_10050520523300006846Populus RhizosphereVGLNPFRQQRRSPADIVMVAGAIVVVILLVAWALFG*
Ga0075431_10048490223300006847Populus RhizosphereVGFNPFRQTRRSSADYVIVAAALVVCAALVIWALAG*
Ga0075433_1157429023300006852Populus RhizosphereMDVGLNPFRQHRRSPADILLVAAAVAVCVALVAWALFA*
Ga0079215_1149021033300006894Agricultural SoilMNAVGFNPFRQQRRSSADYLMVAVAMVIIVALVAWGLFG*
Ga0079219_1208756013300006954Agricultural SoilMGLNPYRPHRRSPADYALVAGAVLVCVLLVAWALFG*
Ga0079218_1141096223300007004Agricultural SoilMGLNPFRQAHRSPADYVMVAVAILVCVALVAWAFFG*
Ga0105045_1003659373300007517FreshwaterMNPFRPHRRSPADVVMVVAAVLVCAALVAWALFG*
Ga0105044_1000441363300007521FreshwaterMNPFRQHRRSPADYVMVAAAFVVLAALVAWAFFG*
Ga0105044_1030083423300007521FreshwaterMGLNPYRKHHRSPVDYVMVAGAVLACLALVLWAFLG*
Ga0111539_1009319333300009094Populus RhizosphereVGLNPFRQHRRSPADILMVAVALVVCLALVLWALLG*
Ga0111539_1192081423300009094Populus RhizosphereMGFNPFRAQRRSTGDYVMVAVAVVVCVLLVAWAVLG*
Ga0079224_10015311643300009095Agricultural SoilMGRTILTGVGFNPFRPRRNSYADYLMVASALVVSAALVAWALFG*
Ga0079224_10124402423300009095Agricultural SoilMGLNPFRPHRRSYGDLAVMAGALIVTAALVAWALLG*
Ga0079224_10335276323300009095Agricultural SoilVGLNPFRQHRRSPADIAMVVGALLACAVLVAWALFG*
Ga0075418_1000606043300009100Populus RhizosphereVGFNPFRKTRRSSADYLMVAAALAVCALLVIWALFG*
Ga0075418_1001774633300009100Populus RhizosphereVGFNPFRQTRRSPADYVMVAVALVVCAALVIWALAG*
Ga0075418_1254496923300009100Populus RhizosphereVGLNPFRQQRRSPVDYVLVAVALAVCVLLVAWAAFGL*
Ga0117941_108258323300009120Lake SedimentMGLNPYRQRRRSPADYLMVAAAVVACLLLVLWAVLG*
Ga0105094_1005044843300009153Freshwater SedimentVGLNPFRQQRRSPADIVMLVAALAVCVALVAWALFA*
Ga0111538_1071514413300009156Populus RhizosphereTDGVGLNPFRQQRRSPADIVMVAGAIVVVILLVAWALFG*
Ga0111538_1123519113300009156Populus RhizosphereVGLNPFRQHRRSPADVLLVAAALLVCLALVAWALFG*
Ga0075423_1249404623300009162Populus RhizosphereVGLNPFRQHRRSPADILMVVGALVVCVALVAWALFA*
Ga0105100_1057806413300009166Freshwater SedimentMGLNPFGPRRRSAADYLMVAGAVIACAVLVLWAFLG*
Ga0114942_147828123300009527GroundwaterMNPFRQHRRSPADYVMVAAALLILLALVAWAFFG*
Ga0123332_112299123300009770Anaerobic Biogas ReactorMGFNPHRPHRNSIADYLMVGAALAVVVLLVLWAVFG*
Ga0126307_10000470213300009789Serpentine SoilVGLNPFRQHRRSPADYLMVAVAVAVCLALVLWAALG*
Ga0126307_1002941223300009789Serpentine SoilVGLNPFRQHRRSPADYLMVAGAVVVCLALVLWAFFG*
Ga0105061_102988423300009807Groundwater SandVGFNPFRQTRRSPADYVMVAAALVACAALVIWALAG*
Ga0131092_1010298143300009870Activated SludgeVGFNPFRQQRRSFADYAMVGGALIVLTLLVLWALFG*
Ga0126304_1089710823300010037Serpentine SoilMGFNPHRPHRRSAADYVMVAAAFVVCIGLVLWAALG*
Ga0126382_1182001123300010047Tropical Forest SoilVGLNPFRQHRRSPGDILMVVAALVVCVALVLWALLG*
Ga0126377_1251052423300010362Tropical Forest SoilVGLNPFRQHRRSPADILLVAAAVAVCVALVAWALFG*
Ga0126377_1294089523300010362Tropical Forest SoilVGLNPFRQHRRSPADILMLAAALVVCVLLVAWALFG*
Ga0126379_1245335523300010366Tropical Forest SoilVGLNPFRQHRRSPADILLVAAAVAVCVALVAWALFA*
Ga0137374_1079107223300012204Vadose Zone SoilVGFNPFHQQRRSNADYVMVAAALVVCIALVAWALFG*
Ga0137369_1009790263300012355Vadose Zone SoilVGFNPFARHRRSAADYVMVAAALVLVVLLVAWALFG*
Ga0137369_1033830423300012355Vadose Zone SoilMGFNPFRQHRRSYADYVLVGLAVVVCVALVLWALFG*
Ga0136630_108099713300012529Polar Desert SandMGLNPFRLHRRTPADYLMVVGAVVVSLALVLWAFLG*
Ga0157216_1002024933300012668Glacier Forefield SoilMGLNPFRQHRRSAADYLMVAGAVLACVLLVVWALFG*
Ga0136616_1018405013300012679Polar Desert SandVGLNPFRQHRRSPIDYVLVVAALLVCVLLVYWAAFGF*
Ga0136612_1009868023300012680Polar Desert SandVGLNPFRQQRRTSVDYVMVAVALTVCLLLVAWAFFG*
Ga0157302_1015462523300012915SoilMLGQMGLNPFRQIHRSPFDYVMVALAVLVCVALVAWAFLG*
Ga0123351_119096023300012973FecalVGLNPFRQHRRSPADIVMVAAALLACVALVAWALFG*
Ga0123351_123387723300012973FecalMNPFRPHRRSPADYVMVAAAILVCLALVGWALFG*
Ga0075316_104794023300014314Natural And Restored WetlandsVGLNPFRQQRRRPSDYVLVAGAMLLTLLLVAWGIGLIP*
Ga0157380_1205662023300014326Switchgrass RhizosphereMNPFRQHRRSPADYVMVAAALLILVALVAWAFFG*
Ga0157380_1326561523300014326Switchgrass RhizosphereMNPFRQHRRSPADYVMVAAAFVVLVALVAWAFFG*
Ga0167665_1000315163300015163Glacier Forefield SoilMGLNPFRQHRRSPADYLMVAGAVLACVLLVVWALFG*
Ga0167629_103841733300015209Glacier Forefield SoilVGLNPFRQQRRSPADYVLVAAAVVVTLLLVLWALLG*
Ga0167629_108938323300015209Glacier Forefield SoilVGLNPFRQQRRSPADYVLVAAAIVVTLLLVLWALLG*
Ga0132258_1052325523300015371Arabidopsis RhizosphereVGLNPFRQTHRSPADYLMVVVAVLACVALVAWAILG*
Ga0132257_10421347323300015373Arabidopsis RhizosphereMRMGFNPFRHQRRSPADYVMVVAAFVIVALLVVWALFG*
Ga0180429_1013121133300017960Hypersaline Lake SedimentMGFNPHRTHRRSPADYVMVAGAFVVVILLVAWALLG
Ga0184638_128599723300018052Groundwater SedimentMGFNPFHKRRPSYADYLLVGLAVAVCLALVLWALFG
Ga0184635_1008247723300018072Groundwater SedimentVGFNPFRQTRRSPADYVMVAAALVACAALVIWALAG
Ga0190265_1001277043300018422SoilMGLNPYRPHRRSPADIVMVVCALLACLALVLWALFG
Ga0190265_1017620423300018422SoilVGLNPFRHARHSPADYVMVAVAVLVCVALVVWAFVG
Ga0190265_1138803023300018422SoilMGLNPFRQQRRSSADYVMVAMAVLVCIALVVWAFAG
Ga0190265_1180300123300018422SoilVGLNPFRQHRRSPADIAMVVGALLVCVALVAWAIFA
Ga0190265_1336891213300018422SoilMGLNPFRQAHRSPADYVMVAVAILVCVALVAWALFG
Ga0190272_1027985123300018429SoilVGLNPFRQQRRSPVDYVLVAIALVVCVLLVAWAAFGL
Ga0190275_1001645663300018432SoilMGLNPFRQQRRSAADYLMVAGAIVVCILLVAWALFG
Ga0190275_1097844223300018432SoilVGLNPFRQARRSPVDYLMVAGAVLVCVALVVWAFLG
Ga0190275_1125035513300018432SoilMGLNPYRPHRTSAADVVMVVGALLACLALVLWALFG
Ga0190275_1256462823300018432SoilMGLNPFRQQRRSVVDYLMVAGAVVVCILLVAWALLG
Ga0190269_1001636833300018465SoilMGLNPFRQQRRSAADYLMVAGAVLACVLLVLWALLG
Ga0190269_1021521343300018465SoilMGLNPFRQHRRSAADYLMVAGAVVACLLLVLWALFG
Ga0190268_1067384923300018466SoilVGLNPFRQHRRSPADILMVAVALAVCVALVAWALLG
Ga0190270_1001183443300018469SoilVGLNPFRQHRRSPADVLMVAVALLVCAALVAWALFA
Ga0190270_1011546323300018469SoilVGFNPFRQTRRSPADYLMVGAALIVCAALVIWALAG
Ga0190270_1068335623300018469SoilVTVGLNPFRQTHRSPADYLMVAVAVLVCVALVAWALFG
Ga0190270_1081993433300018469SoilAPMGMNPFRQHRRSPADYVMVAAALLILVALVAWAFFG
Ga0190270_1092806923300018469SoilMGFNPFRAQRRSTGDYVMVAVAVVVCVLLVAWAVLG
Ga0190270_1145078323300018469SoilVGLNPFRQAHRSPADYLMVAVAVLVCVALVAWAVFG
Ga0190274_1144911023300018476SoilVGLNPFRQHRRSPADILMVAVALLVCVALVAWALFA
Ga0190274_1219625223300018476SoilMGLNPFRQVHRSPLDYVMVALAVLVCLALVAWAFFG
Ga0190274_1306749523300018476SoilMGLNPFREVHRSPLDYVMVALAVLVCLALVAWAFFG
Ga0190271_1051435433300018481SoilMGLNPFGTRTHGWADYLMVAAAVVACLALVAWALLG
Ga0190271_1061298933300018481SoilMGLNPFGTRTHGWADYLMVAGAVVACLALVAWALLG
Ga0190271_1198968823300018481SoilMGLNPFRQVHRAPADYVIAALAVLVTVALVAWAFLG
Ga0190271_1210783113300018481SoilMLGRMGLNPFRQAHRAPADYVIAAVAILVCLALVAWAFFG
Ga0190271_1305108123300018481SoilAGRMGLNPFREVHRSPADYVIAALAILVIVALVAWAMFG
Ga0173482_1034930623300019361SoilMLGRMGLNPFREIHRSPFDYVMVALAVLVCVALVAWAFLG
Ga0190264_1206553823300019377SoilMGLNPFRQHRRSPADYLMVAGAVVVCLALVLWAFFG
Ga0187893_10004574143300019487Microbial Mat On RocksVGLNPFRQHRRSPIDYLLVATTLVVVAALVAWALFG
Ga0208594_1000110263300020509FreshwaterMGFNPHRVHRRSAADYFMVAGAFIVVAALVVWALVG
Ga0224500_1017256133300022213SedimentGLNPYRKQRRSPADYVMVAGAVMACAALVLWALLG
Ga0224500_1038421723300022213SedimentMGLNPYRKQRRSPAYYVMVAGAVMACAALVLWALLG
Ga0224510_1008733023300022309SedimentMGLNPYRKQRRSPADYVMVAGAVMACAALVLWALLG
Ga0210115_109254423300025791Natural And Restored WetlandsVGLNPFRQQRRRPSDYVLVAGAMLLTLLLVAWGIGLIP
Ga0256867_1012167323300026535SoilVGLNPFRQHRRSSADILMVAGALVVCAALVAWALLG
Ga0209842_102913013300027379Groundwater SandVGFNPFRQTRRPPADYVMVAAALVACAALVIWALAG
Ga0256866_108916813300027650SoilVARRGHDTEPVGFNPFRQTRRSPADYVMVAAALVVCAAL
Ga0209490_1010442433300027823FreshwaterMGLNPYRKHHRSPVDYVMVAGAVLACLALVLWAFLG
Ga0209797_1003544923300027831Wetland SedimentVGLNPFRQHRRTAADYLMVAAALVVCGLLVLWAFLG
Ga0209813_1032391713300027866Populus EndosphereAGYVADTEAMGMNPFRQHRRSPADYVMVAVAGVVILALVLWAFFG
Ga0209481_1001820263300027880Populus RhizosphereVGFNPFRQQRRSYADYVMVAAAIVICIVLVAWALFG
Ga0209254_1062096723300027897Freshwater Lake SedimentMGLNPFHQHRRSAADYLMVAGAVVVCLVLVAWALLG
Ga0209253_1059100533300027900Freshwater Lake SedimentGAVGFNPQRPKRRSSADYLMVGAAAIVVVGLVVWALFG
Ga0209382_1003927523300027909Populus RhizosphereVGFNPFRKARRSSADYLMVAAALAVCALLVIWALFG
(restricted) Ga0255057_1052156313300027997SeawaterRILGAVGFNPFRAQSRSLGDYVMVASALVVTALLVAWALLG
Ga0247718_117379023300028007SoilMGLNPFREQRRSAADYLLVAAAVAACVLLVLWALFG
Ga0233377_100953753300028483Elk FecesVGLNPFRQHRRSPADIVMVAAALLACVALVAWALFG
Ga0247823_1063771323300028590SoilMGLNPFRQGRRGAADYLMVAGAVLVCILLVAWAFLG
Ga0302256_1006012723300028741FenMGLNPFRPQHHSALDYLMVAAALLASAALVAWAFLG
Ga0247825_1037648813300028812SoilDTGAMGLNPFRQGRRGAADYLMVAGAVLVCILLVAWAFLG
Ga0247826_1018741033300030336SoilMGFNPFRAQRRSTGDYVMVAVAVLVCVLLVAWAVLG
Ga0268240_1007121313300030496SoilVGLNPFRQHCRSTADYVLVAAALAVCLALVLWAALG
Ga0299914_1009116913300031228SoilTDHVGLNPFHQHRRSPADIAMVVGALVVCAALVTWALLG
Ga0299914_1020174643300031228SoilMGLNPFRQQRRSPVDYLMVAGAVLACVLLVVWAMFG
Ga0299913_1001145513300031229SoilVGNTAAVGFNPFRQRRSTADYLMVAVALAICVALVVWAAAG
Ga0299913_1065675023300031229SoilMGLNPFRPNHRSYGDYVMVAGALVVCALLVVWALVG
Ga0299913_1069858623300031229SoilMGLNPFRQQRRSAVDYVMVAGAVLACVLLVLWAMFG
Ga0307505_1004128643300031455SoilMNPFRPHRSSPVADALFVGAALVVCAALVLWAFFG
Ga0307408_10156659523300031548RhizosphereMGMNPFRQHRRSPADYVMVAAALLILVALVAWAFFG
Ga0307408_10189725123300031548RhizosphereVGLNPFRQQRRSPVDYVLVAVALAVCVLLVAWAAFGL
Ga0302321_10299802013300031726FenMGMNPFRQHRRSPADYVMVGAALVVLAGLVFWAIHG
Ga0316576_1055094623300031727RhizosphereGFNPHRKHRRSPADILFVVGALAVAVGLLAWALFG
Ga0307407_1078574733300031903RhizosphereVGLNPFRQQRRSPVDYVLVAVALVVCVLLVAWAAFGL
Ga0326597_1028862713300031965SoilMGLNPFRQQRRSPADYVMVAAAVAACVLLVLWALFG
Ga0214472_1169943323300033407SoilEPMGLNPFRQQRRSPADYLMVVGAVLACILLVLWALLG
Ga0316622_10066062123300033416SoilMGMNPFRQHRRSPADYLMVVAALVICALLVGWALFGG
Ga0214471_1021358443300033417SoilMGLNPFRQQRHSAADYLMVAAAVLACIVLVLWAVLG
Ga0214471_1114811223300033417SoilMGLNPFRQQRRSPVDYVMVAGAVLACVLLVLWAMFG
Ga0364927_0045197_417_5273300034148SedimentVGFNPFARHRRSTADYVMVAAAFAVVVLLLAWALFG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.