NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049595

Metagenome / Metatranscriptome Family F049595

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049595
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 67 residues
Representative Sequence MQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Number of Associated Samples 121
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 79.45 %
% of genes near scaffold ends (potentially truncated) 30.82 %
% of genes from short scaffolds (< 2000 bps) 81.51 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.932 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh
(23.973 % of family members)
Environment Ontology (ENVO) Unclassified
(58.904 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.411 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.82%    β-sheet: 25.00%    Coil/Unstructured: 41.18%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF03592Terminase_2 19.86
PF00271Helicase_C 1.37
PF08279HTH_11 0.68
PF04448DUF551 0.68
PF03237Terminase_6N 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG3728Phage terminase, small subunitMobilome: prophages, transposons [X] 19.86


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.47 %
UnclassifiedrootN/A7.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001460|JGI24003J15210_10084289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium952Open in IMG/M
3300001460|JGI24003J15210_10117356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium732Open in IMG/M
3300001460|JGI24003J15210_10163390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium556Open in IMG/M
3300001472|JGI24004J15324_10103108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium728Open in IMG/M
3300004457|Ga0066224_1049181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium892Open in IMG/M
3300004460|Ga0066222_1039379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1070Open in IMG/M
3300006025|Ga0075474_10271338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium507Open in IMG/M
3300006026|Ga0075478_10067915All Organisms → Viruses → Predicted Viral1155Open in IMG/M
3300006026|Ga0075478_10092888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium967Open in IMG/M
3300006027|Ga0075462_10195115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium610Open in IMG/M
3300006029|Ga0075466_1099047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium793Open in IMG/M
3300006637|Ga0075461_10009955All Organisms → Viruses → Predicted Viral3146Open in IMG/M
3300006802|Ga0070749_10090276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1820Open in IMG/M
3300006802|Ga0070749_10499656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium663Open in IMG/M
3300006803|Ga0075467_10159704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1286Open in IMG/M
3300006803|Ga0075467_10684341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium522Open in IMG/M
3300006870|Ga0075479_10256346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium692Open in IMG/M
3300006874|Ga0075475_10086345All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1431Open in IMG/M
3300006919|Ga0070746_10191156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium979Open in IMG/M
3300006920|Ga0070748_1354079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium517Open in IMG/M
3300007236|Ga0075463_10025392All Organisms → cellular organisms → Bacteria1940Open in IMG/M
3300007276|Ga0070747_1105526All Organisms → Viruses → Predicted Viral1037Open in IMG/M
3300007344|Ga0070745_1181458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium785Open in IMG/M
3300007344|Ga0070745_1232112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium672Open in IMG/M
3300007344|Ga0070745_1294851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium578Open in IMG/M
3300007346|Ga0070753_1107338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1084Open in IMG/M
3300007538|Ga0099851_1003988All Organisms → cellular organisms → Bacteria6207Open in IMG/M
3300007539|Ga0099849_1016628All Organisms → cellular organisms → Bacteria3226Open in IMG/M
3300007540|Ga0099847_1215751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium557Open in IMG/M
3300007640|Ga0070751_1217324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium737Open in IMG/M
3300008012|Ga0075480_10002813Not Available11197Open in IMG/M
3300008012|Ga0075480_10048363All Organisms → cellular organisms → Bacteria2502Open in IMG/M
3300009071|Ga0115566_10055515All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium2669Open in IMG/M
3300009071|Ga0115566_10231008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1116Open in IMG/M
3300009071|Ga0115566_10311487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium926Open in IMG/M
3300009074|Ga0115549_1179211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium681Open in IMG/M
3300009124|Ga0118687_10086993All Organisms → Viruses → Predicted Viral1071Open in IMG/M
3300009149|Ga0114918_10216106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1106Open in IMG/M
3300009423|Ga0115548_1275058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium516Open in IMG/M
3300009447|Ga0115560_1368944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium544Open in IMG/M
3300009467|Ga0115565_10306435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium722Open in IMG/M
3300009476|Ga0115555_1306163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium639Open in IMG/M
3300009495|Ga0115571_1020894Not Available3346Open in IMG/M
3300009495|Ga0115571_1029444All Organisms → cellular organisms → Bacteria2696Open in IMG/M
3300009495|Ga0115571_1367353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium565Open in IMG/M
3300009507|Ga0115572_10507179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium669Open in IMG/M
3300009529|Ga0114919_10021063All Organisms → cellular organisms → Bacteria4964Open in IMG/M
3300009529|Ga0114919_10775985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium650Open in IMG/M
3300009550|Ga0115013_10146958All Organisms → Viruses → Predicted Viral1378Open in IMG/M
3300010300|Ga0129351_1180963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium823Open in IMG/M
3300010318|Ga0136656_1253977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium578Open in IMG/M
3300011118|Ga0114922_10971812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium690Open in IMG/M
3300011252|Ga0151674_1029935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium618Open in IMG/M
3300011253|Ga0151671_1107398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium851Open in IMG/M
3300012953|Ga0163179_10467536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1037Open in IMG/M
3300013010|Ga0129327_10008710Not Available5614Open in IMG/M
3300016745|Ga0182093_1091594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium630Open in IMG/M
3300016748|Ga0182043_1434146All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium651Open in IMG/M
3300016791|Ga0182095_1402852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium811Open in IMG/M
3300017724|Ga0181388_1031666Not Available1299Open in IMG/M
3300017726|Ga0181381_1010630All Organisms → cellular organisms → Bacteria2163Open in IMG/M
3300017727|Ga0181401_1032953All Organisms → Viruses → Predicted Viral1481Open in IMG/M
3300017727|Ga0181401_1094893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium763Open in IMG/M
3300017735|Ga0181431_1047043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium978Open in IMG/M
3300017741|Ga0181421_1022197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1730Open in IMG/M
3300017742|Ga0181399_1026986All Organisms → Viruses → Predicted Viral1576Open in IMG/M
3300017744|Ga0181397_1124182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium669Open in IMG/M
3300017752|Ga0181400_1065574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1101Open in IMG/M
3300017752|Ga0181400_1209859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium534Open in IMG/M
3300017769|Ga0187221_1195937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium584Open in IMG/M
3300017773|Ga0181386_1020935All Organisms → cellular organisms → Bacteria2181Open in IMG/M
3300017782|Ga0181380_1007012All Organisms → cellular organisms → Bacteria4488Open in IMG/M
3300017782|Ga0181380_1190238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium691Open in IMG/M
3300017783|Ga0181379_1326937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium518Open in IMG/M
3300017818|Ga0181565_10434128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium862Open in IMG/M
3300017950|Ga0181607_10596116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium581Open in IMG/M
3300017951|Ga0181577_10006148Not Available9151Open in IMG/M
3300017951|Ga0181577_10319490All Organisms → Viruses → Predicted Viral1004Open in IMG/M
3300017951|Ga0181577_10466551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium794Open in IMG/M
3300017968|Ga0181587_10411985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium891Open in IMG/M
3300018036|Ga0181600_10021644All Organisms → cellular organisms → Bacteria4509Open in IMG/M
3300018036|Ga0181600_10324412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium767Open in IMG/M
3300018041|Ga0181601_10686961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium517Open in IMG/M
3300018048|Ga0181606_10045998Not Available3006Open in IMG/M
3300018413|Ga0181560_10175139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1064Open in IMG/M
3300018413|Ga0181560_10467709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium575Open in IMG/M
3300018416|Ga0181553_10719011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium521Open in IMG/M
3300018420|Ga0181563_10209726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1183Open in IMG/M
3300018420|Ga0181563_10295801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium949Open in IMG/M
3300018424|Ga0181591_10184459All Organisms → Viruses → Predicted Viral1651Open in IMG/M
3300018876|Ga0181564_10534988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium626Open in IMG/M
3300019076|Ga0188856_1000761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium554Open in IMG/M
3300019459|Ga0181562_10410696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium653Open in IMG/M
3300019751|Ga0194029_1001288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium3169Open in IMG/M
3300020051|Ga0181555_1146877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium966Open in IMG/M
3300020052|Ga0181554_1233919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium727Open in IMG/M
3300020053|Ga0181595_10166558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium998Open in IMG/M
3300020055|Ga0181575_10468430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium682Open in IMG/M
3300020055|Ga0181575_10560996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium603Open in IMG/M
3300020173|Ga0181602_10115586All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1290Open in IMG/M
3300020174|Ga0181603_10188377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium863Open in IMG/M
3300020177|Ga0181596_10137810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1152Open in IMG/M
3300020252|Ga0211696_1000013All Organisms → cellular organisms → Bacteria39414Open in IMG/M
3300020336|Ga0211510_1069919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium834Open in IMG/M
3300020439|Ga0211558_10058904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1906Open in IMG/M
3300020463|Ga0211676_10000993Not Available30242Open in IMG/M
3300020601|Ga0181557_1118599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1164Open in IMG/M
3300021335|Ga0213867_1302787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium504Open in IMG/M
3300021347|Ga0213862_10080435All Organisms → Viruses → Predicted Viral1150Open in IMG/M
3300021365|Ga0206123_10225278All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium824Open in IMG/M
3300021389|Ga0213868_10596187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium579Open in IMG/M
3300021957|Ga0222717_10381923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium783Open in IMG/M
3300021958|Ga0222718_10015618All Organisms → cellular organisms → Bacteria5413Open in IMG/M
3300021960|Ga0222715_10106689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1800Open in IMG/M
3300021964|Ga0222719_10580287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium656Open in IMG/M
3300022072|Ga0196889_1095832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium544Open in IMG/M
3300022074|Ga0224906_1006109All Organisms → cellular organisms → Bacteria5008Open in IMG/M
3300022900|Ga0255771_1105860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1285Open in IMG/M
3300022925|Ga0255773_10148376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1139Open in IMG/M
3300022926|Ga0255753_1094849Not Available1484Open in IMG/M
3300022926|Ga0255753_1377298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium520Open in IMG/M
3300022927|Ga0255769_10259937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium726Open in IMG/M
(restricted) 3300023109|Ga0233432_10384522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium619Open in IMG/M
3300025120|Ga0209535_1007446All Organisms → cellular organisms → Bacteria6468Open in IMG/M
3300025120|Ga0209535_1102880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1017Open in IMG/M
3300025120|Ga0209535_1132548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium823Open in IMG/M
3300025127|Ga0209348_1147647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium693Open in IMG/M
3300025610|Ga0208149_1041759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1214Open in IMG/M
3300025626|Ga0209716_1000974Not Available23528Open in IMG/M
3300025652|Ga0208134_1097701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium818Open in IMG/M
3300025655|Ga0208795_1002106All Organisms → cellular organisms → Bacteria8648Open in IMG/M
3300025671|Ga0208898_1154170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium616Open in IMG/M
3300025696|Ga0209532_1011984Not Available4546Open in IMG/M
3300025759|Ga0208899_1125142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium917Open in IMG/M
3300025771|Ga0208427_1031653Not Available2021Open in IMG/M
3300025810|Ga0208543_1122426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium615Open in IMG/M
3300025840|Ga0208917_1184507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium704Open in IMG/M
3300025869|Ga0209308_10214886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium844Open in IMG/M
3300025892|Ga0209630_10248635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium836Open in IMG/M
3300027917|Ga0209536_100116711All Organisms → Viruses → Predicted Viral3388Open in IMG/M
(restricted) 3300027996|Ga0233413_10255617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium746Open in IMG/M
3300031566|Ga0307378_10207172All Organisms → cellular organisms → Bacteria1921Open in IMG/M
3300031578|Ga0307376_10437050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium855Open in IMG/M
3300031669|Ga0307375_10656009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium610Open in IMG/M
3300032277|Ga0316202_10366701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium673Open in IMG/M
3300032373|Ga0316204_10520640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium884Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous23.97%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh23.97%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater10.96%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine9.59%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.16%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface2.74%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.74%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.74%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.05%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.05%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil2.05%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.37%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.37%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.37%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.37%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.37%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.68%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.68%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.68%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.68%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.68%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.68%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300011252Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeateEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300016745Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041411BS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016748Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016791Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019076Metatranscriptome of marine microbial communities from Baltic Sea - GS683_0p8EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300020051Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020052Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011503CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020053Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020174Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020177Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020252Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX555968-ERR599022)EnvironmentalOpen in IMG/M
3300020336Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300020601Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011506CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022900Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaGEnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300022926Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaGEnvironmentalOpen in IMG/M
3300022927Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025696Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI24003J15210_1008428923300001460MarineMEQVDYRFEDHGSIFLCQPLNGCARDNLDEGCDAVLGTFHIRMGNALVVDARFVNDVAKQLTDKGWVVE*
JGI24003J15210_1011735623300001460MarineMEQIDYRFEDHGSIFLCQPLTGCAKDNLDEGCDAVLGTFHIRMGDALVVDARFVNDVAKQLTDKGWIVE*
JGI24003J15210_1016339013300001460MarineHGSIWLCQPLTGCAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVNDVAKQLTDEGWVVE*
JGI24004J15324_1010310833300001472MarineMEQVDYRFEDHGSIFLCQPLNGCAKDNLDEGCDAVLGTFHIRMGNALVVDPRFVNDVAKQLTDKGWIVE*
Ga0066224_104918133300004457MarineMQQIDYRFENHGSIFLCHPMTADAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVNDVAKQLTDEGWIVE*
Ga0066222_103937923300004460MarineMQQIDYRFEDHGSIWLCEPLTGCAKDNLDEGCSGESHIRWGNALVVDPRFVNDVAKQLTDEGWIVE*
Ga0075474_1027133813300006025AqueousMSLVSDYRFENHGSIFLCQPLNGAAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVNDVAKQLTDEGWIVE*
Ga0075478_1006791533300006026AqueousMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWVIE*
Ga0075478_1009288833300006026AqueousMQQVDYRFENHGSIFLCQPLNADAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWVIE*
Ga0075462_1019511523300006027AqueousMEQIDYRFEDHGSIWLCQPLTGCAKDNLDEGCSDEFHIRWGNALVVDPRFVNDVAKQLTDEGWIVE*
Ga0075466_109904723300006029AqueousMQQVDYRFENHGSIFLCQPLNADAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE*
Ga0075461_1000995533300006637AqueousMSLVSDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE*
Ga0070749_1009027623300006802AqueousMQQVDYRFEDHGSIWLCEPLTGCAKDNLDEGCSGEFHIRWGNALVVDPRFVNDVAKQLTDEGWVIE*
Ga0070749_1049965623300006802AqueousMSLVSDYRFENHGSIFLCQPLYGAAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVNDVAKQLTDKGWIVE*
Ga0075467_1015970453300006803AqueousKQIDYRFENHGFIFLCKPLTDAAKDNLDQACEGTEDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE*
Ga0075467_1068434123300006803AqueousMQQVDYRFENHGSIFLCQPLNGAAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVNDVAKQLTDEGWIVE*
Ga0075479_1025634623300006870AqueousMKQIDYKFENHGFIFLCKPLTDAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDVAQQLIEEGWIIE*
Ga0075475_1008634553300006874AqueousDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWVIE*
Ga0070746_1019115643300006919AqueousMQQVDYRFENHGSIFLCQPLNADAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVNDVAKQLTDEGWIVE*
Ga0070748_135407923300006920AqueousMEQVDYRFEDHGSIWLCQPLNGAAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVDDVAKQLTDEGWIVE*
Ga0075463_1002539243300007236AqueousMQQVDYRFENHGSIFLCQPLNADAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVNDVAKQLTDKGWIVE*
Ga0070747_110552633300007276AqueousMQQVDYRFENHGSIFLCQPLNGAAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVDDVAKQLTDEGWIVE*
Ga0070745_118145813300007344AqueousNHGSIFLCQPLNGAAKDNLDQACEGTEDFHIRMGDALVIDHRFANDIALQLIEEGWVIE*
Ga0070745_123211233300007344AqueousMSLVSDYRFENHGSIFLCHPLNGTAKENLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE*
Ga0070745_129485133300007344AqueousMEQVDYRFEDHGSIWLCQPLNGAAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVNDVAKQLTDEGWIVE*
Ga0070753_110733833300007346AqueousMSLVSDYRFENHGSIFLCQPLNGAAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVNDVAKQLTDKGWIVE*
Ga0099851_1003988123300007538AqueousMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE*
Ga0099849_101662843300007539AqueousMEQVDYRFENHGSIWLCRPMTADAKDNLRQACDADDAPFNISWCDALVVEPRFVNDVAKQLTDEGWIVE*
Ga0099847_121575133300007540AqueousMKQIDYRFENHGSIFLCQPLNADAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVDDVAKQLTDEGWVVE*
Ga0070751_121732413300007640AqueousRFENHGSIFLCQPLNGAAKDNLDQACEGTEDFHIRMGDALVIDHRFANDIALQLIEEGWVIE*
Ga0075480_1000281313300008012AqueousMQQVDYRFENHGSIFLCQPLNADAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIA
Ga0075480_1004836313300008012AqueousMQQVDYRFENHGSIFLCQPLNADAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEG
Ga0115566_10055515103300009071Pelagic MarineMEQVDYRFEDHGSIWLCEPLTGCARDNLDEGCSGEFHIRWGNALVVDPRFVNDVAKQLTDEGWVVE*
Ga0115566_1023100833300009071Pelagic MarineMQQVDYRFENHGSIFLCQPLNGAAKDNLDECCDAVLGTFHIRWGDALVIDHRFANDIAQQLIEEGWIIE*
Ga0115566_1031148723300009071Pelagic MarineMEVRRMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWVIE*
Ga0115549_117921113300009074Pelagic MarineGSIWLCQPLTGCAKDNLDEGCSGEFHIRWGSALVVDPRFVNDVAKQLTDEGWVVE*
Ga0118687_1008699333300009124SedimentMQQIDYRFENHGSIFLCQPLNADAKDNLDQACEGTKDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE*
Ga0114918_1021610623300009149Deep SubsurfaceMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTKDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE*
Ga0115548_127505813300009423Pelagic MarineMEQVDYRFEDHGSIWLCQPLTGCAKDNLDEGCSGEFHIRWGNALVVDPRFVNDVAKQLTDEGWIVE*
Ga0115560_136894433300009447Pelagic MarineMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGNALVIDHRFANDIALQLIEEGWVIE*
Ga0115565_1030643533300009467Pelagic MarineMQQVDYKFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE*
Ga0115555_130616323300009476Pelagic MarineMEQIDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGNALVIDHRFANDIAQQLIEEGWIIE*
Ga0115571_102089463300009495Pelagic MarineMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTKDFHIRWGDALVIDQRFANDIAHQLIEEGWVIE*
Ga0115571_102944453300009495Pelagic MarineMQQVDYRFEDHGSIWLCHPMTADAKDNLRQACDADDAPFNISWCDALVVDPRFVNDVAKQLTDKGWVIE*
Ga0115571_136735333300009495Pelagic MarineMEVRRMQQVAYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE*
Ga0115572_1050717923300009507Pelagic MarineMEQVDYRFEDHGSIWLCEPLTGCAKDNLDEGCSGEFHIRWGNALVVDPRFVNDVAKQLTDEGWVVE*
Ga0114919_1002106363300009529Deep SubsurfaceMQQVDYRFEDHGSIWLCQPLTGDARENLDQACESCEDFYIRWGNALVVEPRFVDQVAMQLVEEGWTVE*
Ga0114919_1077598523300009529Deep SubsurfaceMSLVSDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWVIE*
Ga0115013_1014695853300009550MarineMQQIDYKFEDHGSIWLCQPLTGCAKDNLDEDCSGEFHIRWGNALVVEPRFVNDVAKQLTDEGWVVE*
Ga0129351_118096313300010300Freshwater To Marine Saline GradientMQQVDYRFEDHGSIWLCQPITGDARENLDQACESCEDFYIRWGNALVVEPRFVDQVAMQLVEEGWTVE*
Ga0136656_125397723300010318Freshwater To Marine Saline GradientENHGSIFLCQPLNGAAKDNLDQACEGTEDFHIRWGDALVIDHRFANDIALQLIEEGWIIE
Ga0114922_1097181223300011118Deep SubsurfaceMQQVDYRFENHGSIFLCQPLNADAKDNLDEGCDAVLGTFHIRMGDALVVDPRFVNDVAKQLTDKGWIIE*
Ga0151674_102993533300011252MarineMEQIDYRFVDHGSIWLCQPLTGCDKDNLDEGCSGEFHIRWGNALVVDTRFVNDVAKQLTDEGWV
Ga0151671_110739843300011253MarineMEQIDYRFEDHGSIWLCQPLTGCAKDNLDEGCSGDFHIRWGNALVVDTRFVNDVAKQLTDEGWVVE*
Ga0163179_1046753633300012953SeawaterMQQVDYRFEDHGSIWLCQPLTGCAKDNLDEGCDAVLGTFHIRMGDALVVDPRFVNDVAKQLTDEGWIVE*
Ga0129327_10008710183300013010Freshwater To Marine Saline GradientMEQVDYRFENHGSIFLCQPLNADAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVNDVAKQLTDEGWIVE*
Ga0182093_109159433300016745Salt MarshYRFENHGSIFLCHPLNGNAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0182043_143414623300016748Salt MarshSLASDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDEFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0182095_140285223300016791Salt MarshMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQ
Ga0181388_103166643300017724SeawaterMSHVSDYRFENHGSIFLCQPLNADAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIA
Ga0181381_101063043300017726SeawaterMQQVDYRFEDHGSIWLCQPLTGDARENLDQACESCEDFHIRWGNALVVEPRFVDQVAMQLVEEGWTVE
Ga0181401_103295323300017727SeawaterMSHVSDYRFENHGSIFLCQPLNADAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0181401_109489343300017727SeawaterMSHVSDYRFEDHGSIWLCHPMNADAKDNLRQACDADDAPFNISWCDALVVDPRFVNDIAKQLTDEGWVVDG
Ga0181431_104704343300017735SeawaterMSHVSDYRFENHGSIFLCQPLNADAKDNLDQACEGTEDFHIRWGDALVIDHRFANEIAQQLIEEGWTVE
Ga0181421_102219743300017741SeawaterMSHVSDYRFENHGSIFLCQPLNADAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWTVE
Ga0181399_102698633300017742SeawaterMSHVSDYRFENHGSIFLCQPLTGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0181397_112418233300017744SeawaterFEDHGSIFLCQPLNGCARDNLDEGCSGEFHIRWGNALVVDARFVNDVAKQLTDKGWVVE
Ga0181400_106557423300017752SeawaterMSHVSDYRFENHGSIWLCHPMNADAKDNLRQACDADDAPFNISWCDALVVDPRFVNDVAKQLTDEGWVVDG
Ga0181400_120985933300017752SeawaterMQQIDYRFEDHGSIWLCHPMNADAKDNLRQACDADDAPFNISWCDALVVDPRFVNDVAKQLTDEGWVVDG
Ga0187221_119593733300017769SeawaterYRFEDHGSIFLCQPLNGCAKDNLDEGCSGEFHIRWGNALVVDARFVNDVAKQLTDKGWVV
Ga0181386_102093523300017773SeawaterMEQVDYRFEDHGSIFLCQPLNGCAKDNLDEGCSGEFHIRWGNALVVDARFVNDVAKQLTDKGWVVE
Ga0181380_100701223300017782SeawaterMSHVSDYRFENHGSIWLCHPMNADAKDNLRQACDADDAPFNISWCDALVVDPRFVNDIAKQLTDEGWTVE
Ga0181380_119023813300017782SeawaterMEQVDYRFEDHGSIFLCQPLNGCAKDNLDEGCDAVLGTFHIRMGNALVVDARFVNDVAKQLTDKGWIVE
Ga0181379_132693733300017783SeawaterPQSKGGEVMQQVDYRFEDHGSIWLCHPMTADAKDNLRQACDADDAPFNISWCDALVVDPRFVNDIAKQLTDEGWTVE
Ga0181565_1043412823300017818Salt MarshMQQVDYRFEDHGSIWLCQPLTGDARENLDQACESCEDFHIRWGNALVVEPRFVEHVAMQLVEEGWTVE
Ga0181607_1059611633300017950Salt MarshDEVMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTEDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0181577_10006148113300017951Salt MarshMSLASDYRFENHGSIFLCHPLTADAKANLDQACDGTEDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0181577_1031949033300017951Salt MarshMQQVDYRFEDHGSIWLCQPLTGDARENLDQACESCEDFYIRWGNALVVEPRFVEHVAMQLVEEGWTVE
Ga0181577_1046655143300017951Salt MarshMQQVDYRFEDHGSIWLCQPLTGDARENLDQACESCEDFYIRWGNALVVDPRFVEHVAMQLVEEGWTVE
Ga0181587_1041198513300017968Salt MarshMSLVSDYRFENHGSIFLCHPLNGNAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0181600_10021644113300018036Salt MarshMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0181600_1032441223300018036Salt MarshMAVQTDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0181601_1068696123300018041Salt MarshMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTEDFHIRWGDALVIDHRFANDIALQLIEEGWVIE
Ga0181606_1004599813300018048Salt MarshMSLASDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0181560_1017513933300018413Salt MarshMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWVIE
Ga0181560_1046770933300018413Salt MarshVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFLFRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0181553_1071901123300018416Salt MarshMQQVDYRFENHGSIFLCHPLNGTAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWVIE
Ga0181563_1020972613300018420Salt MarshNHGSIFLCHPLNGTAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0181563_1029580123300018420Salt MarshMQQVDYRFEDHGSIWLCQPLTGDARENLDQACESCEDFYIRWGNALVVEPRFVEHVEMQLVEDAWTVE
Ga0181591_1018445913300018424Salt MarshMQQVDYRFEDHGSIWLCQPLTGDARENLDQACDSCEDFYIRWGNALVVEPRFVEHVAMQLVEEGWTVE
Ga0181564_1053498823300018876Salt MarshMQQVDYRFENHGSIFWGQPLNGAAEDDLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0188856_100076113300019076Freshwater LakeSKGGEVMQQVDYRFENHGSIWLCHPMTADAKDNLRQACDADDAPFNISWCDALVVDPRFVNDVAKQLTDKGWIIE
Ga0181562_1041069633300019459Salt MarshMSLVSDYRFENHGSIFLCHPLNGTAKENLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0194029_100128823300019751FreshwaterMQQVDYRFEDHGSIWLCQPLTGDARENLDQACESCEDFYIRWGNALVVEPRFVDQVAMQLVEEGWTVE
Ga0181555_114687733300020051Salt MarshMSLVSDYRFENHGSIFLCHPLNGTAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0181554_123391933300020052Salt MarshSIFLCHPLNGTAKENLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0181595_1016655823300020053Salt MarshMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTEDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0181575_1046843013300020055Salt MarshMQQVDYRFEDHGSIWLCQPLTGDARENLDQACESCEDFYIRWGNALVVEPRFVENVAM
Ga0181575_1056099623300020055Salt MarshSIWLCQPLTGDARENLDQACESCEDFYIRWGNALVVEPRFVEHVAMQLVEEGWTVE
Ga0181602_1011558653300020173Salt MarshMSLASDYRFENHGSIFLCHPLNGNAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQ
Ga0181603_1018837733300020174Salt MarshMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGW
Ga0181596_1013781043300020177Salt MarshMSLASDYRFENHGSIFLCHPLNGNAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0211696_1000013243300020252MarineMEQVDYRFEDHGSIWLCHPMTADAKDNLRQACDADDAPFNISWCDALVVEPRFVNDVAKQLTDKGWVVE
Ga0211510_106991933300020336MarineMQQVDYRFEDHGSIWLCEPLTGCAKDNLDEGCSGEFHLRWGNALVVEPRFVNDVAKQLTDEGWVVE
Ga0211558_1005890443300020439MarineMQQVDYRFEDHGSIWLCQPLTGDARENLDQACESCEDFYIRWGNALVVEPRFVEHVAMQLQEEGWTVE
Ga0211676_10000993473300020463MarineMEQVDYRFEDHGSIWLCEPLTGCARDNLDKGCSGEFHIRWGNALVVEPRFVNDVAKQLTDEGWVVE
Ga0181557_111859913300020601Salt MarshSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWVIE
Ga0213867_130278723300021335SeawaterMEQVDYRFEDHGSIWLCHPMTADAKDNLRQACDADDAPFNISWCDALVVEPRFVNDVAKQLTDEGWVVE
Ga0213862_1008043513300021347SeawaterRFEDHGSIWLCHPMTADAKDNLRQACDADDAPFNISWCDALVVEPRFVNDVAKQLTDEGWVVE
Ga0206123_1022527823300021365SeawaterMEQVDYRFEDHGSIWLCHPMTADAKDNLRQACDADDAPFNISWCDALVVEPRFVNDVAKQLTDEGWMVG
Ga0213868_1059618723300021389SeawaterMSLVSDYRFENHGSIFLCHPLNGNAKDNLDQACEGTEDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0222717_1038192343300021957Estuarine WaterMDEDFEIDYRFENHGSIFLCQPLNADAKDNLDQACEGTKDFHIRWGDALVIDHRFANDIAQQLIEEGWVIDG
Ga0222718_1001561853300021958Estuarine WaterMGRKMQQVDYRFENHGSIFLCQPLNADAKDNLDQACEGTKDFHIRWGDALVIDHRFANDIAQQLIEEGWVIDG
Ga0222715_1010668983300021960Estuarine WaterQGKGGKVMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGNALVIDHRFANDIALQLIEEGWVVE
Ga0222719_1058028723300021964Estuarine WaterMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGNALVIDHRFANDIALQLIEEGWVIE
Ga0196889_109583213300022072AqueousSKGGCVMQQVDYRFENHGSIFLCQPLNADAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVNDVAKQLTDEGWIVE
Ga0224906_100610983300022074SeawaterMQQVDYRFEDHGSIWLCQPLTGDARENLDQACESCEDFHIRWGNALVVEPRFVDQVAMQLVEEGWAVE
Ga0255771_110586043300022900Salt MarshMSLVSDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0255773_1014837613300022925Salt MarshQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWVIE
Ga0255753_109484953300022926Salt MarshMSLVSDYRFENHGSIFLCHPLNGTAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLI
Ga0255753_137729813300022926Salt MarshMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFAND
Ga0255769_1025993723300022927Salt MarshMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWI
(restricted) Ga0233432_1038452233300023109SeawaterMSHVSDYRFEDHGSIWLCHPMTADAKDNLRQACDADDAPFNISWCDALVVDPRFVNDVV
Ga0209535_100744693300025120MarineMEQVDYRFEDHGSIWLCQPLTGCAKDNLDEGCDAVLGTFHIRMGNALVVDPRFVNDVAKQLTDEGWVVE
Ga0209535_110288033300025120MarineMEQIDYRFEDHGSIFLCQPLNGCAKDNLDEGCDAVLGTFHIRMGNALVVDPRFVNDVAKQLTDKGWIVE
Ga0209535_113254843300025120MarineMEQVDYRFEDHGSIFLCQPLTGCAKDNLDEGCDAVLGTFHIRMGDALVVDARFVNDVAKQLTDKGWIVE
Ga0209348_114764713300025127MarineHGSIFLCQPLTGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWTVE
Ga0208149_104175933300025610AqueousMQQVDYRFENHGSIFLCQPLNADAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWVIE
Ga0209716_1000974273300025626Pelagic MarineMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTKDFHIRWGDALVIDQRFANDIAHQLIEEGWVIE
Ga0208134_109770123300025652AqueousMQQVDYRFENHGSIFLCQPLNGAAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVNDVAKQLTDEGWIVE
Ga0208795_1002106173300025655AqueousMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWII
Ga0208898_115417033300025671AqueousHGSIFLCQPLNGAAKDNLDQACEGTEDFHIRMGDALVIDHRFANDIALQLIEEGWVIE
Ga0209532_1011984113300025696Pelagic MarineMEQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTEDFHIRWGNALVIDHRFANDIAQQLIEEGWIIE
Ga0208899_112514213300025759AqueousMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTEDFHIRMGDALVIDHRFANDIAL
Ga0208427_103165353300025771AqueousMSLVSDYRFENHGSIFLCQPLNGAAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVNDVAKQLTDEGWIVE
Ga0208543_112242623300025810AqueousMQQVDYRFENHGSIFLCQPLNADAKDNLDEGCDAVLGTFHIRWGNALVVDPRFVNDVAKQLTDKGWIVE
Ga0208917_118450743300025840AqueousVSDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWVIE
Ga0209308_1021488633300025869Pelagic MarineMQQVDYRFENHGSIFLCQPLNGAAKDNLDECCDAVLGTFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0209630_1024863543300025892Pelagic MarineMEQVDYRFEDHGSIWLCHPMTADAKDNLRQACDADDAPFNISWCDALVVEPRFVNDVAKQLTDEGWIVG
Ga0209536_10011671133300027917Marine SedimentMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTEDFHIRWGDALVIDHRFANDIAQQLIEEGWVIE
(restricted) Ga0233413_1025561733300027996SeawaterMQQVDYRFEDHGSIWLCQPLTGTAKDNLDEGCSGEFHIRWGNALVVDPRFVNDVAKQLTDEGWVVE
Ga0307378_1020717253300031566SoilMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGNALVIDHRFAND
Ga0307376_1043705013300031578SoilHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWIIE
Ga0307375_1065600933300031669SoilMQQVDYRFENHGSIFLCQPLNGAAKDNLDQACEGTDDFHIRWGNALVIDHRFANDIAQQLIEEGWVIE
Ga0316202_1036670133300032277Microbial MatMGRIMQQIDYRFENHGSIFLCQPLNGAAKDNLNQACEGTDDFHIRWGDALVIDHRFANDIAQQLIEEGWVIE
Ga0316204_1052064023300032373Microbial MatMEQIDYRFEDHGSIWLCEPLTGCAKDNLDEGCSGEFHIRWGNALVVEPRFVNDVAKQLTDEGWVVG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.