NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046476

Metagenome / Metatranscriptome Family F046476

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046476
Family Type Metagenome / Metatranscriptome
Number of Sequences 151
Average Sequence Length 41 residues
Representative Sequence VLMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK
Number of Associated Samples 137
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.32 %
% of genes near scaffold ends (potentially truncated) 97.35 %
% of genes from short scaffolds (< 2000 bps) 92.05 %
Associated GOLD sequencing projects 135
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.185 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(16.556 % of family members)
Environment Ontology (ENVO) Unclassified
(21.854 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.411 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.64%    β-sheet: 0.00%    Coil/Unstructured: 75.36%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 151 Family Scaffolds
PF13561adh_short_C2 35.76
PF00815Histidinol_dh 7.28
PF04392ABC_sub_bind 3.97
PF13924Lipocalin_5 3.97
PF00106adh_short 2.65
PF00890FAD_binding_2 2.65
PF03976PPK2 1.99
PF00378ECH_1 1.99
PF13193AMP-binding_C 1.99
PF04199Cyclase 0.66
PF03060NMO 0.66
PF09084NMT1 0.66
PF13545HTH_Crp_2 0.66
PF12706Lactamase_B_2 0.66
PF08031BBE 0.66
PF14534DUF4440 0.66
PF00484Pro_CA 0.66
PF02518HATPase_c 0.66
PF03972MmgE_PrpD 0.66
PF12697Abhydrolase_6 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 151 Family Scaffolds
COG0141Histidinol dehydrogenaseAmino acid transport and metabolism [E] 7.28
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 3.97
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 1.99
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 0.66
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.66
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.66
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 0.66
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.66
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.66
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.66
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.66

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.19 %
UnclassifiedrootN/A27.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459024|GZRSKLJ01B3QAHNot Available518Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10067967All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300000720|JGI12456J11933_104476All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10135138All Organisms → cellular organisms → Bacteria → Proteobacteria513Open in IMG/M
3300001989|JGI24739J22299_10226219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp.548Open in IMG/M
3300004058|Ga0055498_10010350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1209Open in IMG/M
3300005330|Ga0070690_100366209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1050Open in IMG/M
3300005332|Ga0066388_100613797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1708Open in IMG/M
3300005332|Ga0066388_105278193All Organisms → cellular organisms → Bacteria → Proteobacteria655Open in IMG/M
3300005356|Ga0070674_100241096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1415Open in IMG/M
3300005363|Ga0008090_15074949Not Available534Open in IMG/M
3300005524|Ga0070737_10059734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1986Open in IMG/M
3300005548|Ga0070665_100504815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1221Open in IMG/M
3300005563|Ga0068855_101513823Not Available689Open in IMG/M
3300005577|Ga0068857_102424177Not Available515Open in IMG/M
3300005616|Ga0068852_102417253Not Available546Open in IMG/M
3300005713|Ga0066905_101285658All Organisms → cellular organisms → Bacteria → Proteobacteria657Open in IMG/M
3300005713|Ga0066905_101774475All Organisms → cellular organisms → Bacteria → Proteobacteria568Open in IMG/M
3300005713|Ga0066905_102108510All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300005764|Ga0066903_100615288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1887Open in IMG/M
3300005764|Ga0066903_104932664Not Available708Open in IMG/M
3300005764|Ga0066903_108689643Not Available516Open in IMG/M
3300005938|Ga0066795_10140061All Organisms → cellular organisms → Bacteria → Proteobacteria721Open in IMG/M
3300005995|Ga0066790_10173714All Organisms → cellular organisms → Bacteria → Proteobacteria922Open in IMG/M
3300006178|Ga0075367_10294156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1022Open in IMG/M
3300006904|Ga0075424_100184648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2213Open in IMG/M
3300009089|Ga0099828_10435431Not Available1182Open in IMG/M
3300009089|Ga0099828_12003051All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium506Open in IMG/M
3300009098|Ga0105245_10188854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1972Open in IMG/M
3300009167|Ga0113563_13995181Not Available500Open in IMG/M
3300009551|Ga0105238_11555832Not Available691Open in IMG/M
3300009764|Ga0116134_1304809Not Available547Open in IMG/M
3300009826|Ga0123355_10764089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1089Open in IMG/M
3300010043|Ga0126380_10164869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1439Open in IMG/M
3300010043|Ga0126380_11237842All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium646Open in IMG/M
3300010046|Ga0126384_11942862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium562Open in IMG/M
3300010049|Ga0123356_11719357Not Available779Open in IMG/M
3300010360|Ga0126372_11313183Not Available753Open in IMG/M
3300010360|Ga0126372_11809282All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300010361|Ga0126378_12800392All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium557Open in IMG/M
3300010362|Ga0126377_11741881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria698Open in IMG/M
3300010366|Ga0126379_12373898Not Available630Open in IMG/M
3300010371|Ga0134125_11914989Not Available645Open in IMG/M
3300010397|Ga0134124_10010936All Organisms → cellular organisms → Bacteria → Proteobacteria7319Open in IMG/M
3300010403|Ga0134123_10654237All Organisms → cellular organisms → Bacteria → Proteobacteria1019Open in IMG/M
3300012189|Ga0137388_10567691Not Available1055Open in IMG/M
3300012203|Ga0137399_11125044All Organisms → cellular organisms → Bacteria → Proteobacteria661Open in IMG/M
3300012208|Ga0137376_11053540All Organisms → cellular organisms → Bacteria → Proteobacteria696Open in IMG/M
3300012351|Ga0137386_10985866Not Available600Open in IMG/M
3300012357|Ga0137384_10440334All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300012474|Ga0157356_1018200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp.555Open in IMG/M
3300012507|Ga0157342_1047307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp.595Open in IMG/M
3300012925|Ga0137419_11059016All Organisms → cellular organisms → Bacteria → Proteobacteria674Open in IMG/M
3300012958|Ga0164299_10030170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes2347Open in IMG/M
3300012960|Ga0164301_10627578All Organisms → cellular organisms → Bacteria → Proteobacteria797Open in IMG/M
3300012984|Ga0164309_10309826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1142Open in IMG/M
3300012984|Ga0164309_11707892All Organisms → cellular organisms → Bacteria → Proteobacteria540Open in IMG/M
3300012986|Ga0164304_10041871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes2434Open in IMG/M
3300013308|Ga0157375_12268768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp.647Open in IMG/M
3300013766|Ga0120181_1130480Not Available548Open in IMG/M
3300014267|Ga0075313_1111302All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300014326|Ga0157380_10334181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes1410Open in IMG/M
3300014838|Ga0182030_10718975All Organisms → cellular organisms → Bacteria → Proteobacteria932Open in IMG/M
3300014969|Ga0157376_11628611All Organisms → cellular organisms → Bacteria → Proteobacteria680Open in IMG/M
3300015200|Ga0173480_10971670Not Available557Open in IMG/M
3300015371|Ga0132258_13103308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1148Open in IMG/M
3300015373|Ga0132257_100347542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601792Open in IMG/M
3300016270|Ga0182036_10284176All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300016319|Ga0182033_10166034All Organisms → cellular organisms → Bacteria1722Open in IMG/M
3300016341|Ga0182035_10782180All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300016357|Ga0182032_10443914All Organisms → cellular organisms → Bacteria → Proteobacteria1058Open in IMG/M
3300017936|Ga0187821_10285871Not Available652Open in IMG/M
3300017972|Ga0187781_11434199Not Available511Open in IMG/M
3300017974|Ga0187777_11175022Not Available560Open in IMG/M
3300018060|Ga0187765_10778003All Organisms → cellular organisms → Bacteria → Proteobacteria636Open in IMG/M
3300018086|Ga0187769_10556955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales866Open in IMG/M
3300018086|Ga0187769_10798406All Organisms → cellular organisms → Bacteria → Proteobacteria713Open in IMG/M
3300019356|Ga0173481_10335558All Organisms → cellular organisms → Bacteria → Proteobacteria717Open in IMG/M
3300021090|Ga0210377_10370530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp.858Open in IMG/M
3300021439|Ga0213879_10147024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium682Open in IMG/M
3300025271|Ga0207666_1031545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp.813Open in IMG/M
3300025312|Ga0209321_10471209All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05573Open in IMG/M
3300025580|Ga0210138_1012114All Organisms → cellular organisms → Bacteria → Proteobacteria1712Open in IMG/M
3300025615|Ga0210086_1195114All Organisms → cellular organisms → Bacteria → Proteobacteria584Open in IMG/M
3300025650|Ga0209385_1157720All Organisms → cellular organisms → Bacteria → Proteobacteria667Open in IMG/M
3300025813|Ga0210064_1009480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2914Open in IMG/M
3300025914|Ga0207671_10573071All Organisms → cellular organisms → Bacteria → Proteobacteria900Open in IMG/M
3300025916|Ga0207663_11138122Not Available628Open in IMG/M
3300025918|Ga0207662_11062779Not Available575Open in IMG/M
3300025931|Ga0207644_10229856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601473Open in IMG/M
3300025936|Ga0207670_10136058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601806Open in IMG/M
3300025936|Ga0207670_11347876Not Available605Open in IMG/M
3300026095|Ga0207676_11158450All Organisms → cellular organisms → Bacteria → Proteobacteria765Open in IMG/M
3300026492|Ga0256802_1005348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601296Open in IMG/M
3300026806|Ga0207546_100410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601068Open in IMG/M
3300026865|Ga0207746_1013776Not Available692Open in IMG/M
3300026879|Ga0207763_1001830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602626Open in IMG/M
3300027014|Ga0207815_1000641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68605371Open in IMG/M
3300027330|Ga0207777_1037757Not Available874Open in IMG/M
3300027643|Ga0209076_1038055All Organisms → cellular organisms → Bacteria → Proteobacteria1351Open in IMG/M
3300027665|Ga0209983_1008861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602055Open in IMG/M
3300027765|Ga0209073_10246299Not Available693Open in IMG/M
3300027903|Ga0209488_10242896Not Available1351Open in IMG/M
3300028802|Ga0307503_10599307All Organisms → cellular organisms → Bacteria → Proteobacteria608Open in IMG/M
3300029917|Ga0311326_10240696Not Available935Open in IMG/M
3300029987|Ga0311334_11566750All Organisms → cellular organisms → Bacteria → Proteobacteria559Open in IMG/M
3300031226|Ga0307497_10115196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1069Open in IMG/M
3300031549|Ga0318571_10104529All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300031595|Ga0265313_10035629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2504Open in IMG/M
3300031668|Ga0318542_10405446All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium704Open in IMG/M
3300031679|Ga0318561_10517126All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300031711|Ga0265314_10549743Not Available601Open in IMG/M
3300031716|Ga0310813_11562575Not Available615Open in IMG/M
3300031720|Ga0307469_10896542All Organisms → cellular organisms → Bacteria → Proteobacteria821Open in IMG/M
3300031724|Ga0318500_10103010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601301Open in IMG/M
3300031740|Ga0307468_100413514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1035Open in IMG/M
3300031747|Ga0318502_10475220All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300031763|Ga0318537_10026675Not Available2038Open in IMG/M
3300031768|Ga0318509_10036839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2427Open in IMG/M
3300031768|Ga0318509_10684735All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300031770|Ga0318521_10396035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales822Open in IMG/M
3300031770|Ga0318521_10673053Not Available628Open in IMG/M
3300031777|Ga0318543_10281186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales743Open in IMG/M
3300031778|Ga0318498_10368301All Organisms → cellular organisms → Bacteria → Proteobacteria640Open in IMG/M
3300031781|Ga0318547_10419814All Organisms → cellular organisms → Bacteria → Proteobacteria822Open in IMG/M
3300031782|Ga0318552_10714254All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300031796|Ga0318576_10473824All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300031797|Ga0318550_10533649All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300031819|Ga0318568_10263770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1067Open in IMG/M
3300031821|Ga0318567_10068926Not Available1865Open in IMG/M
3300031908|Ga0310900_11327612Not Available602Open in IMG/M
3300031912|Ga0306921_12615173Not Available521Open in IMG/M
3300031913|Ga0310891_10114394All Organisms → cellular organisms → Bacteria → Proteobacteria843Open in IMG/M
3300032001|Ga0306922_11913102All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium580Open in IMG/M
3300032035|Ga0310911_10057975All Organisms → cellular organisms → Bacteria → Proteobacteria2035Open in IMG/M
3300032039|Ga0318559_10517555All Organisms → cellular organisms → Bacteria → Proteobacteria556Open in IMG/M
3300032041|Ga0318549_10393657All Organisms → cellular organisms → Bacteria → Proteobacteria624Open in IMG/M
3300032043|Ga0318556_10676981All Organisms → cellular organisms → Bacteria → Proteobacteria537Open in IMG/M
3300032052|Ga0318506_10079634All Organisms → cellular organisms → Bacteria → Proteobacteria1373Open in IMG/M
3300032055|Ga0318575_10371772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium brasilense725Open in IMG/M
3300032061|Ga0315540_10405190Not Available546Open in IMG/M
3300032205|Ga0307472_101419458All Organisms → cellular organisms → Bacteria → Proteobacteria674Open in IMG/M
3300032261|Ga0306920_102439243Not Available721Open in IMG/M
3300032261|Ga0306920_104337673All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300032421|Ga0310812_10507761Not Available542Open in IMG/M
3300032770|Ga0335085_10691951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1135Open in IMG/M
3300032895|Ga0335074_11631257Not Available502Open in IMG/M
3300033134|Ga0335073_10911043Not Available924Open in IMG/M
3300033290|Ga0318519_10216582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1097Open in IMG/M
3300033433|Ga0326726_10964698All Organisms → cellular organisms → Bacteria → Proteobacteria828Open in IMG/M
3300033513|Ga0316628_101857157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp.801Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil8.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.28%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.30%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.31%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.65%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.65%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.99%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.32%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut1.32%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.32%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.32%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.66%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.66%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.66%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.66%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.66%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.66%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.66%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.66%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.66%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.66%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.66%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.66%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.66%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.66%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.66%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.66%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.66%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.66%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.66%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.66%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.66%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.66%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.66%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000720Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300001989Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5Host-AssociatedOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005524Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012474Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610EnvironmentalOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300025271Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025312Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4EnvironmentalOpen in IMG/M
3300025580Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025615Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025650Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes)EnvironmentalOpen in IMG/M
3300025813Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026492Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 CS5EnvironmentalOpen in IMG/M
3300026806Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A4a-10 (SPAdes)EnvironmentalOpen in IMG/M
3300026865Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75 (SPAdes)EnvironmentalOpen in IMG/M
3300026879Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes)EnvironmentalOpen in IMG/M
3300027014Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027330Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032061Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD1_031654902170459024Grass SoilAEDEVLINTLKGAPRLNVPDQFSPAFMAEVEKVHQEYFADLPPLK
AF_2010_repII_A1DRAFT_1006796733300000597Forest SoilLINTLKGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK*
JGI12456J11933_10447613300000720Tropical Forest SoilVNTLPGAARLNVPKLFRPEFMEAVMKEHPEYFADLPKL*
AF_2010_repII_A001DRAFT_1013513813300000793Forest SoilAFESAEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK*
JGI24739J22299_1022621923300001989Corn RhizosphereMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK*
Ga0055498_1001035033300004058Natural And Restored WetlandsEDEVLMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFVDLPALK*
Ga0070690_10036620933300005330Switchgrass RhizosphereFENAEDEVLTNTLKGAPRLDVPSLFRPQFMAAVEKEHPEYFADLPKL*
Ga0066388_10061379713300005332Tropical Forest SoilEVLINTLKGAPRLNVPDQFSPAFMAEVEKVHPEYFADLPPVK*
Ga0066388_10527819313300005332Tropical Forest SoilFEAAEDEVLINTLKGAPRLNVPDQFSPAFMAEVEKVHREYFADLPPLK*
Ga0070674_10024109613300005356Miscanthus RhizosphereENAEDEVLTNTLKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK*
Ga0008090_1507494923300005363Tropical Rainforest SoilVLANTLKGAPRLDVPSLFRPEFMAAVEKEHPEYFADLPKL*
Ga0070737_1005973413300005524Surface SoilNAEDEVLMNTLKGAARLDVPSLFRPQFMQEVEREHPEYFADLPKL*
Ga0070665_10050481513300005548Switchgrass RhizosphereTLKGASRLNVPSLFRPEFMQRVEKEHSEYFADLPKLK*
Ga0068855_10151382313300005563Corn RhizosphereEVLMNTLKGAPRLDVPKLFRPEFMQQVEKEHPDYFADLPKL*
Ga0068857_10242417723300005577Corn RhizosphereKGASRLNVPSLFRPEFMQRVEKEHPEYFADLPKLK*
Ga0068852_10241725313300005616Corn RhizosphereNAEDEVLTNTLKGASRLNVPSLFRPEFMQRVEKEHSEYFADLPKLK*
Ga0066905_10128565823300005713Tropical Forest SoilLANTLKGAPRLDVPSLFRPQFMAAVEKEHPEYFADLPKL*
Ga0066905_10177447513300005713Tropical Forest SoilVAEDEVLINTLKGAPRLDVPDQFRPAFMAEVEKAHPEYFADLPPLK*
Ga0066905_10210851023300005713Tropical Forest SoilGAPRLNVPDQFSPAFMAEVEKLYPEYFADLPPLK*
Ga0066903_10061528833300005764Tropical Forest SoilLINTLKGAPRLNVPDQFSPAFMAEVEKVYPEYFGDLPPLK*
Ga0066903_10493266413300005764Tropical Forest SoilMRAFEAAEDEVLINTLKGAPRLNVPDQFSPAKVYPEYFADLPPLK*
Ga0066903_10868964323300005764Tropical Forest SoilGASRLDVPDQFRPSFMAEVEKAHPEYFADLPPLK*
Ga0066795_1014006113300005938SoilGAARLDVPSLFRPKFMAEVEKEHPEYFADLPKLK*
Ga0066790_1017371423300005995SoilVLMNTLKGAARLDVPSLFRPKFMAEVEKEHPEYFADLPKLT*
Ga0075367_1029415633300006178Populus EndosphereNAEDEVLTNTLKGASRLNVPSLFRPEFMQRVEKEHPEYFADLPKLK*
Ga0075424_10018464813300006904Populus RhizosphereMNTLKGAPRLDVPSLFRPQFMAEVQQEHPEYFADLPQLK*
Ga0099828_1043543123300009089Vadose Zone SoilPRLDVPDQFRPSFMAEVEKAHPEYFADLPPLNLPPLK*
Ga0099828_1200305123300009089Vadose Zone SoilEVLINTLKGATRLDVPDQFHPSFMAEVEKAHPEYFADLPPLT*
Ga0105245_1018885433300009098Miscanthus RhizosphereLMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLT*
Ga0113563_1399518123300009167Freshwater WetlandsDEVLMNTLKGAPRLDVPSLFRPKFMAEVEKEHPEYFADLPPLK*
Ga0105238_1155583213300009551Corn RhizosphereTLKGAPRLDVPKLFRPEFMQQVEKEYPDYFADLPKL*
Ga0116134_130480923300009764PeatlandVLMNTLKGAPRLDVPSLFRPQFMAEVEKEHPEYFADLPKLT*
Ga0123355_1076408913300009826Termite GutTLKGAARLDVPSLFQRKFMAAVEQEHPEYFSDLPPLPSS*
Ga0126380_1016486923300010043Tropical Forest SoilFESAEDEVLINTLKGAPRLDVPDQFRPSFMAEMEKAHPEYFADLPPLK*
Ga0126380_1123784213300010043Tropical Forest SoilAFEAAEDEVLINTLKGAPRLDVPDQFRPSFMTEVEKAHPEYFADLPPLK*
Ga0126384_1194286213300010046Tropical Forest SoilAAEDEVLLNTLRGAPRLDVPDQFRPSFMTEVEKTHPEYFADLPPLTS*
Ga0123356_1171935723300010049Termite GutNTLKGAARLDVPSLFRPQFMAEVEKEHPEYFADLPPL*
Ga0126372_1131318313300010360Tropical Forest SoilEAAEDEVLINTLKGAPRLDVPDQFRPSFMTEVEKAHPEYFADLPPLK*
Ga0126372_1180928213300010360Tropical Forest SoilTLKGAPRLNVPDQFSPAFMAEVEKVHPEYFADLPPLK*
Ga0126378_1280039223300010361Tropical Forest SoilLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPPLK*
Ga0126377_1174188113300010362Tropical Forest SoilTLKGAPRLDVPDQFCPTFMAEVEQAHPEYFADLLRLK*
Ga0126379_1237389823300010366Tropical Forest SoilEAAEDEVLMNTLKGAPRLDVPDQFRPSFMTEIAKAHPEYFADLPPLK*
Ga0134125_1191498913300010371Terrestrial SoilNTLKGAPRLDVPKLFRPEFMQQVEKEHPDYFADLPKL*
Ga0134124_1001093673300010397Terrestrial SoilVLTNTLKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK*
Ga0134123_1065423713300010403Terrestrial SoilKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK*
Ga0137388_1056769123300012189Vadose Zone SoilEVLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPPLNLPPLK*
Ga0137399_1112504423300012203Vadose Zone SoilINTLKGAPRLDVPDQFRPAFIAEVEKAHPEYFADLPPLT*
Ga0137376_1105354023300012208Vadose Zone SoilLTNTLKGAPRLDVPSLFRPQFMAEVEKEHSEYFADLPKL*
Ga0137386_1098586613300012351Vadose Zone SoilFEAAEDEVLINTLKGAPRLDVPGQFRPSFMAEVEKAHPEYFADLPALT*
Ga0137384_1044033413300012357Vadose Zone SoilAFEAAEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPALT*
Ga0157356_101820013300012474Unplanted SoilNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK*
Ga0157342_104730713300012507Arabidopsis RhizosphereEILMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK*
Ga0137419_1105901623300012925Vadose Zone SoilLINTLKGAPRLDVPDQFRPAFIAEVEKAHPEYFADLPPLT*
Ga0164299_1003017013300012958SoilAEDEVLANTLKGAPRLDVPSLFRPQFMAAVEKEHPESFADLPKL*
Ga0164301_1062757813300012960SoilNAEDEVLMNTLKGAPRLDVPKLFRPEFMQQVEKEHPDYFADLPKL*
Ga0164309_1030982613300012984SoilNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLT*
Ga0164309_1170789213300012984SoilEVLMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFSDLPALK*
Ga0164304_1004187113300012986SoilLKGAPRLNVPSLFRPEFMQQVEKEHPEYFADLPKLA*
Ga0157375_1226876823300013308Miscanthus RhizosphereTNTLKGAPRLDVPSLFRPQFMAAVEKEHPEYFSDLPKL*
Ga0120181_113048023300013766PermafrostVQPISAAGAPRLDVPNLFRPEFMQQVEKEHPEYFADLPKL*
Ga0075313_111130223300014267Natural And Restored WetlandsVLMNTLPGAARLDIPNLFRPTFMAEVEKEHPEYFADLPPLK*
Ga0157380_1033418133300014326Switchgrass RhizosphereENAEDEILVNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK*
Ga0182030_1071897523300014838BogFENAEDEVLMNTLKGAPRLDVPSLFRPEFMQQVEKEHPEYFADLPKL*
Ga0157376_1162861123300014969Miscanthus RhizosphereEDEVLNNTLKGAPRLDVPSLFRPQFMAAVEKEHPEYFSDLPKL*
Ga0173480_1097167023300015200SoilAEDEVLTNTLKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK*
Ga0132258_1310330833300015371Arabidopsis RhizosphereENAEDEVLMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK*
Ga0132257_10034754213300015373Arabidopsis RhizosphereTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK*
Ga0182036_1028417623300016270SoilLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPPLK
Ga0182033_1016603413300016319SoilESAEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKAYPEYFADLPLLK
Ga0182035_1078218013300016341SoilEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK
Ga0182032_1044391413300016357SoilEDEVLINTLKGAPRLAVPDQFRPSFMAEVEKAHPEYFADLPPLK
Ga0187821_1028587123300017936Freshwater SedimentLPGAPRLNVPKLFRPEFMQQVEKENPEYFADLPKLS
Ga0187781_1143419913300017972Tropical PeatlandKGAPRLNVPSLFKPQFMAEVEKEHPEYFADLPPLK
Ga0187777_1117502223300017974Tropical PeatlandLKGAPRLDVPSLFRPKFMAEVEKEHPEYFADLPKL
Ga0187765_1077800313300018060Tropical PeatlandVLMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK
Ga0187769_1055695513300018086Tropical PeatlandTLKGAARLDVPDQFRPSFMAEVEKAHPEYFADLPPLP
Ga0187769_1079840613300018086Tropical PeatlandLKGAPRLNVPSLFKPQFMAEVEKEHPEYFADLPPLK
Ga0173481_1033555823300019356SoilAEDEVLTNTLKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK
Ga0210377_1037053023300021090Groundwater SedimentMNTLKGAPRLDVPSLFRPQFMTEVQKEHPEYFADLPKL
Ga0213879_1014702413300021439Bulk SoilVLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPPLK
Ga0207666_103154523300025271Corn, Switchgrass And Miscanthus RhizosphereAEDEILVNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK
Ga0209321_1047120913300025312SoilEAAEDELLINTLPGAPRLVVPDLFAPGFMAEVEKAHPEYFRDLPPLK
Ga0210138_101211433300025580Natural And Restored WetlandsVLVNTLPGAARLNVPKLFRPDFMEAVMKEHPEYFADLPRLK
Ga0210086_119511413300025615Natural And Restored WetlandsVLINTLPGAPRLDVPSLFRPQFMAEVEQEHPEYFADLPKLP
Ga0209385_115772023300025650Arctic Peat SoilMNTLKGAARLDVPSLFRPKFMAEVEKEHPEYFADLPKLT
Ga0210064_100948013300025813Natural And Restored WetlandsANTLKGAPRLDVPSLFRPEFMTEVQKEHPDYFADLPPLKQ
Ga0207671_1057307113300025914Corn RhizosphereEDEVLTNTLKGAPRLNVPSLFRPDFMQQVEKEHPEYFADLPRLK
Ga0207663_1113812223300025916Corn, Switchgrass And Miscanthus RhizosphereLMNTLKGAPRLDVPKLFRPEFMQQVEKEHPDYFADLPKL
Ga0207662_1106277913300025918Switchgrass RhizosphereENAEDEVLTNTLKGASRLNVPSLFRPEFMQRVEKEHPEYFADLPKLK
Ga0207644_1022985633300025931Switchgrass RhizosphereAARLRERGDEVLMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLT
Ga0207670_1013605833300025936Switchgrass RhizosphereENAEDEVLTNTLKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK
Ga0207670_1134787613300025936Switchgrass RhizosphereEDEVLTNTLKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK
Ga0207676_1115845013300026095Switchgrass RhizosphereTLKGAPRLDVPSLFRPQFMAAVEKEHPEYFADLPKL
Ga0256802_100534833300026492SedimentENAEDEVLMNTLKGALRLDVPSLFRPQFMAEVQKEHPEYFVDLPALK
Ga0207546_10041033300026806SoilKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK
Ga0207746_101377613300026865Tropical Forest SoilLPGAPRLDVPNLFRPQFMTDVQKEHPEYFADLPSLK
Ga0207763_100183013300026879Tropical Forest SoilFENAEDEVLVNTLPGAARLNVPKLFRPEFMEAVMKEHPEYFADLPKL
Ga0207815_100064163300027014Tropical Forest SoilLINTLPGAPRLDVPNLFRPQFMTDVQKEHPEYFADLPSLK
Ga0207777_103775713300027330Tropical Forest SoilPGAPRLDVPNLFRPQFMTDVQKEHPEYFADLPSLK
Ga0209076_103805513300027643Vadose Zone SoilEVLINTLKGAPRLDVPDQFRPAFIAEVEKAHPEYFADLPPLT
Ga0209983_100886113300027665Arabidopsis Thaliana RhizosphereKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK
Ga0209073_1024629913300027765Agricultural SoilEDEVLTNTLKGAPRLNVPSLFRPEFMQQVEKQHPEYFADLPALK
Ga0209488_1024289623300027903Vadose Zone SoilAPRLDVPDQFRPSFMAEVEKAHPEYFADLPPLNLPPLK
Ga0307503_1059930713300028802SoilMNTLKGAPRLDVPSLFRPEFMAEVQKEHPEYFADLPKL
Ga0311326_1024069613300029917BogEVLMNTLKGAARLDVPSLFRPQFMTEVQIEHPEYFADLPKLA
Ga0311334_1156675013300029987FenLKGAPRLDVPSLFRPKFMAEVEKGHPEYFADLPKL
Ga0307497_1011519613300031226SoilMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLV
Ga0318571_1010452913300031549SoilLKGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK
Ga0265313_1003562933300031595RhizosphereVNTLPGAPRLNVPKLFRPEFMQQVEKEHPEYFADLPKLT
Ga0318542_1040544633300031668SoilNTLKGAPRLAVPDQFRPSFMAEVEKAHPEYFADLPPLK
Ga0318561_1051712623300031679SoilDEVLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPLLK
Ga0265314_1054974323300031711RhizosphereEVLINTLKGAPRLNVPSLFRPEFMQQVEKEHPEYFADLPKL
Ga0310813_1156257513300031716SoilINTLKGAPRLDVPKLFRPEFMQQVEKEHPDYFADLPKL
Ga0307469_1089654213300031720Hardwood Forest SoilLTNTLKGAPRLNVPSLFRPEFMQQVEKQHPEYFADLPKLK
Ga0318500_1010301033300031724SoilEVLTNTLKGSPRLDVPSLFRPQFMAAVEKEHPEYFADLPKL
Ga0307468_10041351413300031740Hardwood Forest SoilTLKGAPRLDVQSLFRPQFMAEVQKEHPEYFADLPALK
Ga0318502_1047522013300031747SoilLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPLLK
Ga0318537_1002667533300031763SoilFEAAEDEVLINTLKGAPRLNVPDQFSPAFMAEVEKVYPEYFADLPPLN
Ga0318509_1003683913300031768SoilAFASAEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPPLK
Ga0318509_1068473533300031768SoilNTLKGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK
Ga0318521_1039603513300031770SoilKGAPRLDVPDQFRPSFMAEVGKAHPEYFADLPPLK
Ga0318521_1067305323300031770SoilTLKGAPRLNVPDQFSPAFMAEVGKVYPEYFADLPPLK
Ga0318543_1028118613300031777SoilESAEDEVLINTLKGAPRLDVPDQFRPSFMAEVGKAHPEYFADLPPLK
Ga0318498_1036830113300031778SoilAEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKTHPEYFADLPPLK
Ga0318547_1041981423300031781SoilEVLINTLKGAPRLAVPDQFRPSFMAEVEKAHPEYFADLPPLK
Ga0318552_1071425413300031782SoilFESAEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK
Ga0318576_1047382413300031796SoilEAAEDEVLINTLKGAPRLNVPDQFSPAFMAEVEKVYPEYFADLPPLN
Ga0318550_1053364913300031797SoilEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPLLK
Ga0318568_1026377043300031819SoilEAAEDEVLINTLKGAPRLDVPDQFRPSFMAEVGKAHPEYFADLPPLK
Ga0318567_1006892613300031821SoilLINTLKGAPRLDVPDQFRPSFMAEVGKAHPEYFADLPPLK
Ga0310900_1132761223300031908SoilEDEVLTNTLKGAPRLDVPSLFRPQFMAAVEKEHPEYFADLPKL
Ga0306921_1261517313300031912SoilLKGAPRLNVPDQFSPAFMAEVGKVYPEYFADLPPLK
Ga0310891_1011439423300031913SoilNAEDEVLTNTLKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK
Ga0306922_1191310213300032001SoilVLINTLKGAPRLNVPDQFSPAFMAEVEKVYPEYFADLPPLN
Ga0310911_1005797543300032035SoilAFESAEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPLLK
Ga0318559_1051755523300032039SoilNTLKGAPRLDVPDQFRPSFMAEVEKTHPEYFADLPPLK
Ga0318549_1039365713300032041SoilVLINTLKGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK
Ga0318556_1067698113300032043SoilMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK
Ga0318506_1007963413300032052SoilEVLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPLLK
Ga0318575_1037177213300032055SoilKGAPRLNVPDQFSPAFMAEVEKVYPEYFADLPPLN
Ga0315540_1040519013300032061Salt Marsh SedimentVLMNTLKGAARLDVPSLFRPQFMAEVEKEHPEYFADLPKLK
Ga0307472_10141945823300032205Hardwood Forest SoilNTLKGAPRLDVPKRFRPEFMQQVEKEHPEYFADLPKL
Ga0306920_10243924313300032261SoilKGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK
Ga0306920_10433767313300032261SoilINTLKGAPRLNVPDQFSPAFMAEVEEVHQEYFADLPPLK
Ga0310812_1050776123300032421SoilDEVLMNTLKGAPRLDVPKLFRPEFMQQVEKEHPDYFADLPKL
Ga0335085_1069195113300032770SoilPGAPRLNVPSLFKPQFMAEVEKEHPEYFADLPKLK
Ga0335074_1163125713300032895SoilDEVLMNTLKGAPRLDVPSLFRPQFMAEVEKQHPEYFADLPPLG
Ga0335073_1091104323300033134SoilENAEDEVLMNTLKGAPRLNVPSLFKPQFMAEVEKEHPEYFADLPPLK
Ga0318519_1021658243300033290SoilVLINTLKGAPRLDVPDQFRPSFMAEVGKAHPEYFADLPPFK
Ga0326726_1096469823300033433Peat SoilKGAPRLDVPSLFRPQVMTEVQKEHPEYFADLPTLK
Ga0316628_10185715713300033513SoilNAEDEVLVNTLPGAPRLNVPSLFRPEFMQQVEKEHPEYFADLPKLG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.