NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045072

Metagenome / Metatranscriptome Family F045072

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045072
Family Type Metagenome / Metatranscriptome
Number of Sequences 153
Average Sequence Length 77 residues
Representative Sequence MARSAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGIGRSRNLVRFRND
Number of Associated Samples 115
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.30 %
% of genes near scaffold ends (potentially truncated) 33.99 %
% of genes from short scaffolds (< 2000 bps) 73.20 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.778 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(29.412 % of family members)
Environment Ontology (ENVO) Unclassified
(33.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(42.484 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.72%    β-sheet: 12.82%    Coil/Unstructured: 38.46%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF05136Phage_portal_2 54.25
PF05876GpA_ATPase 6.54
PF10124Mu-like_gpT 3.27
PF12728HTH_17 1.31

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG5511Phage capsid proteinMobilome: prophages, transposons [X] 54.25
COG5525Phage terminase, large subunit GpAMobilome: prophages, transposons [X] 6.54


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.04 %
UnclassifiedrootN/A1.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002199|metazooDRAFT_1250360All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium714Open in IMG/M
3300002408|B570J29032_109871367All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1824Open in IMG/M
3300003860|Ga0031658_1017957All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1190Open in IMG/M
3300005216|Ga0068994_10270030All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium501Open in IMG/M
3300005525|Ga0068877_10129819All Organisms → Viruses → Predicted Viral1556Open in IMG/M
3300005525|Ga0068877_10129820All Organisms → Viruses → Predicted Viral1556Open in IMG/M
3300005527|Ga0068876_10746769All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium520Open in IMG/M
3300005528|Ga0068872_10027064All Organisms → cellular organisms → Bacteria3775Open in IMG/M
3300005528|Ga0068872_10114613All Organisms → Viruses → Predicted Viral1597Open in IMG/M
3300005581|Ga0049081_10213007All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium689Open in IMG/M
3300005662|Ga0078894_10024794All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium4894Open in IMG/M
3300005758|Ga0078117_1080902All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium955Open in IMG/M
3300005805|Ga0079957_1240546All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium846Open in IMG/M
3300005805|Ga0079957_1354130All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium642Open in IMG/M
3300006637|Ga0075461_10030314All Organisms → Viruses → Predicted Viral1781Open in IMG/M
3300006641|Ga0075471_10220127All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium983Open in IMG/M
3300006802|Ga0070749_10060256All Organisms → Viruses → Predicted Viral2292Open in IMG/M
3300006802|Ga0070749_10191860All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1173Open in IMG/M
3300006802|Ga0070749_10232109All Organisms → Viruses → Predicted Viral1049Open in IMG/M
3300006802|Ga0070749_10746438All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium521Open in IMG/M
3300006802|Ga0070749_10790724All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium504Open in IMG/M
3300006805|Ga0075464_10731616All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium613Open in IMG/M
3300006863|Ga0075459_1000429All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium6552Open in IMG/M
3300006869|Ga0075477_10137953All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1025Open in IMG/M
3300006875|Ga0075473_10367671All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium582Open in IMG/M
3300006916|Ga0070750_10147895All Organisms → Viruses → Predicted Viral1064Open in IMG/M
3300006916|Ga0070750_10422766All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium554Open in IMG/M
3300006917|Ga0075472_10403220All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium676Open in IMG/M
3300007202|Ga0103274_1150901All Organisms → Viruses → Predicted Viral1365Open in IMG/M
3300007234|Ga0075460_10199444All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium681Open in IMG/M
3300007344|Ga0070745_1088176All Organisms → Viruses → Predicted Viral1225Open in IMG/M
3300007346|Ga0070753_1064500All Organisms → Viruses → Predicted Viral1475Open in IMG/M
3300007363|Ga0075458_10000702All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium11009Open in IMG/M
3300007363|Ga0075458_10087891All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium970Open in IMG/M
3300007538|Ga0099851_1052873All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1593Open in IMG/M
3300007538|Ga0099851_1299919All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium567Open in IMG/M
3300007541|Ga0099848_1046019All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1771Open in IMG/M
3300007541|Ga0099848_1068096All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1405Open in IMG/M
3300007542|Ga0099846_1088350All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1149Open in IMG/M
3300007542|Ga0099846_1126612All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium930Open in IMG/M
3300007640|Ga0070751_1108715All Organisms → Viruses → Predicted Viral1140Open in IMG/M
3300007735|Ga0104988_10878All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium35655Open in IMG/M
3300007973|Ga0105746_1356273All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium511Open in IMG/M
3300008116|Ga0114350_1007324All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium5210Open in IMG/M
3300008117|Ga0114351_1112765All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1562Open in IMG/M
3300008266|Ga0114363_1047581All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1722Open in IMG/M
3300008266|Ga0114363_1049870All Organisms → Viruses → Predicted Viral1670Open in IMG/M
3300008266|Ga0114363_1072798All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium3158Open in IMG/M
3300008266|Ga0114363_1110049All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium976Open in IMG/M
3300008266|Ga0114363_1132331All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium851Open in IMG/M
3300008450|Ga0114880_1007291All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium5636Open in IMG/M
3300008450|Ga0114880_1068117All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1452Open in IMG/M
3300009081|Ga0105098_10004504All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium5019Open in IMG/M
3300009085|Ga0105103_10334934All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium829Open in IMG/M
3300009124|Ga0118687_10013836All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2639Open in IMG/M
3300009163|Ga0114970_10062720All Organisms → Viruses → Predicted Viral2368Open in IMG/M
3300009168|Ga0105104_10777031All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium555Open in IMG/M
3300009179|Ga0115028_11621903All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium555Open in IMG/M
3300009384|Ga0103868_1000870All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1764Open in IMG/M
3300010297|Ga0129345_1290495All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium567Open in IMG/M
3300010354|Ga0129333_10368040All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1276Open in IMG/M
3300010354|Ga0129333_10602256All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium953Open in IMG/M
3300010354|Ga0129333_10637480All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium922Open in IMG/M
3300010354|Ga0129333_10864235All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium767Open in IMG/M
3300010370|Ga0129336_10291692All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium909Open in IMG/M
3300011995|Ga0153800_1000640All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium3155Open in IMG/M
3300012013|Ga0153805_1034031All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium865Open in IMG/M
(restricted) 3300013123|Ga0172368_10033007All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium3829Open in IMG/M
(restricted) 3300013126|Ga0172367_10610333All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium584Open in IMG/M
3300013372|Ga0177922_11202422All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium512Open in IMG/M
3300017754|Ga0181344_1011514All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2828Open in IMG/M
3300017785|Ga0181355_1011888All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium3824Open in IMG/M
3300017788|Ga0169931_10101038All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2768Open in IMG/M
3300017951|Ga0181577_10079504All Organisms → Viruses → Predicted Viral2292Open in IMG/M
3300017951|Ga0181577_10210797All Organisms → Viruses → Predicted Viral1293Open in IMG/M
3300017951|Ga0181577_10425506All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium841Open in IMG/M
3300018416|Ga0181553_10742653All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium511Open in IMG/M
3300019747|Ga0193978_1014277All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium921Open in IMG/M
3300019750|Ga0194000_1016492All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium916Open in IMG/M
3300019756|Ga0194023_1000944All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium5684Open in IMG/M
3300019756|Ga0194023_1097056All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium594Open in IMG/M
3300019765|Ga0194024_1034296All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1107Open in IMG/M
3300019784|Ga0181359_1113584All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium978Open in IMG/M
3300020048|Ga0207193_1027728All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium6698Open in IMG/M
3300020074|Ga0194113_10251316All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1373Open in IMG/M
3300020527|Ga0208232_1016081Not Available1106Open in IMG/M
3300020547|Ga0208361_1052725All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium521Open in IMG/M
3300020570|Ga0208465_1000679All Organisms → cellular organisms → Bacteria8437Open in IMG/M
3300021961|Ga0222714_10037795All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium3491Open in IMG/M
3300021961|Ga0222714_10381881All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium749Open in IMG/M
3300021962|Ga0222713_10229264All Organisms → Viruses → Predicted Viral1223Open in IMG/M
3300021962|Ga0222713_10570384All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium665Open in IMG/M
3300021963|Ga0222712_10364852All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium887Open in IMG/M
3300022063|Ga0212029_1053086All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium588Open in IMG/M
3300022176|Ga0212031_1024211All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium959Open in IMG/M
3300022176|Ga0212031_1085017All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium540Open in IMG/M
3300022179|Ga0181353_1023567All Organisms → Viruses → Predicted Viral1624Open in IMG/M
3300022183|Ga0196891_1011363All Organisms → Viruses → Predicted Viral1757Open in IMG/M
3300022187|Ga0196899_1031321All Organisms → Viruses → Predicted Viral1864Open in IMG/M
3300022198|Ga0196905_1137538All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium634Open in IMG/M
3300022198|Ga0196905_1151802All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium596Open in IMG/M
3300022200|Ga0196901_1211534All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium618Open in IMG/M
3300024554|Ga0255242_1010152All Organisms → Viruses → Predicted Viral2223Open in IMG/M
3300024560|Ga0256306_1020863All Organisms → Viruses → Predicted Viral1633Open in IMG/M
3300024566|Ga0256309_1045146All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1167Open in IMG/M
3300024569|Ga0255243_1050904All Organisms → Viruses → Predicted Viral1053Open in IMG/M
3300025445|Ga0208424_1000351All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium5597Open in IMG/M
3300025585|Ga0208546_1104958All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium630Open in IMG/M
3300025630|Ga0208004_1018708All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2184Open in IMG/M
3300025635|Ga0208147_1000460All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium14466Open in IMG/M
3300025635|Ga0208147_1107960All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium671Open in IMG/M
3300025635|Ga0208147_1135052All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium582Open in IMG/M
3300025646|Ga0208161_1073912All Organisms → Viruses → Predicted Viral1007Open in IMG/M
3300025746|Ga0255241_1018276All Organisms → Viruses → Predicted Viral1039Open in IMG/M
3300025771|Ga0208427_1177510All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium689Open in IMG/M
3300025889|Ga0208644_1188584All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium907Open in IMG/M
3300025889|Ga0208644_1201172All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium865Open in IMG/M
3300026565|Ga0256311_1104641All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium617Open in IMG/M
3300027213|Ga0208555_1061160All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium578Open in IMG/M
3300027486|Ga0255086_1043864All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium728Open in IMG/M
3300027659|Ga0208975_1030410All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1728Open in IMG/M
3300027721|Ga0209492_1036920All Organisms → Viruses → Predicted Viral1712Open in IMG/M
3300027736|Ga0209190_1095919All Organisms → Viruses → Predicted Viral1377Open in IMG/M
3300027793|Ga0209972_10007312All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium7792Open in IMG/M
3300027793|Ga0209972_10086430All Organisms → Viruses → Predicted Viral1603Open in IMG/M
3300027805|Ga0209229_10094376All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1347Open in IMG/M
3300027806|Ga0209985_10083991All Organisms → Viruses → Predicted Viral1673Open in IMG/M
3300027816|Ga0209990_10061644All Organisms → Viruses → Predicted Viral1885Open in IMG/M
3300027888|Ga0209635_10744681All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium710Open in IMG/M
3300027899|Ga0209668_10215607All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1201Open in IMG/M
3300027956|Ga0209820_1015611All Organisms → Viruses → Predicted Viral1908Open in IMG/M
3300028108|Ga0256305_1068577All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium871Open in IMG/M
3300028108|Ga0256305_1123951All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium619Open in IMG/M
3300031758|Ga0315907_10034600All Organisms → cellular organisms → Bacteria4533Open in IMG/M
3300031758|Ga0315907_11293817All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium504Open in IMG/M
3300031787|Ga0315900_10051411All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium4343Open in IMG/M
3300031857|Ga0315909_10101262All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2481Open in IMG/M
3300031857|Ga0315909_10165921All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1796Open in IMG/M
3300031857|Ga0315909_10289232All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1232Open in IMG/M
3300031951|Ga0315904_10038116All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium5496Open in IMG/M
3300031951|Ga0315904_10150291All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2360Open in IMG/M
3300031951|Ga0315904_10747320All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium814Open in IMG/M
3300032050|Ga0315906_10030744All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium5813Open in IMG/M
3300032050|Ga0315906_10033041All Organisms → cellular organisms → Bacteria5577Open in IMG/M
3300033993|Ga0334994_0007446All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium7667Open in IMG/M
3300034012|Ga0334986_0044970All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2834Open in IMG/M
3300034061|Ga0334987_0058933All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium3130Open in IMG/M
3300034073|Ga0310130_0002121All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium9660Open in IMG/M
3300034096|Ga0335025_0397382All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium713Open in IMG/M
3300034103|Ga0335030_0265043All Organisms → Viruses → Predicted Viral1166Open in IMG/M
3300034106|Ga0335036_0011999All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium7099Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous29.41%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake9.15%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater7.19%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.88%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater5.88%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton4.58%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient3.92%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.27%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.61%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.96%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.96%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.31%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.31%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.31%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.31%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.31%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.65%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake0.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.65%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.65%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.65%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.65%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.65%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice0.65%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.65%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.65%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.65%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.65%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.65%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.65%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002199Freshwater microbial communities from San Paulo Zoo lake, Brazil - JUN 2013EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300005216Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLA_D2EnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006863Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007202Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007735Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014OctEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009384Microbial communities of water from Amazon river, Brazil - RCM21EnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300011995Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300013123 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11mEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019747Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_5-6_MGEnvironmentalOpen in IMG/M
3300019750Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States - FLT_6-7_MGEnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020527Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020547Freshwater microbial communities from Lake Mendota, WI - 05AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020570Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300024554Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024560Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024566Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024569Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025445Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025746Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026565Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027213Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027486Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027806Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027888Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028108Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
metazooDRAFT_125036023300002199LakeMIRSMARSAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQREPTSTWLAELDARIADLRRQASGGIGRSRNLVRFRND*
B570J29032_10987136723300002408FreshwaterMQHARMARSPQERLTLFENIRDKVESALASGSPVVSYSMDGQTVQKEPTSTWLAELDARIADLRSQAGTGLAGRRNLVRFQR*
Ga0031658_101795713300003860Freshwater Lake SedimentMIVMAKSASERLALFEQIRDKVEGALLSGSPVVSYSVDGQVVTKEPTSSWLAELDSRISDLRRQSSGGLAAGRNLVRFRNV*
Ga0068994_1027003023300005216Natural And Restored WetlandsMARSASERLALYEGIRDKVESALLGGAPIVSYTLDGQLVQKEATSTWLAELDARIADLRRQASGGVFAARNNVRFVR*
Ga0068877_1012981923300005525Freshwater LakeDRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGIGRSRNLVRFRND*
Ga0068877_1012982023300005525Freshwater LakeDRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGMSRSRNLVRFRNV*
Ga0068876_1074676923300005527Freshwater LakeMARSASERLTLFENIRDKVESALASGSPVVSYSVDGQTVQKEPTSTWLAELDARIADLRSQAGTGLAGRKNLVRFQR*
Ga0068872_1002706433300005528Freshwater LakeMIRSMARSAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGMSRSRNLVRFRNV*
Ga0068872_1011461323300005528Freshwater LakeRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGIGRSRNLVRFRND*
Ga0049081_1021300723300005581Freshwater LenticMARSATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNLVRFSQ*
Ga0078894_1002479443300005662Freshwater LakeMARSATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQANGGIHGARNLVRFSQ*
Ga0078117_108090233300005758Lake WaterMIRSMARSAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGIGRSRNLVRFRND*
Ga0079957_124054613300005805LakeTGDNSASVCDCASMARSATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNLVRFSQ*
Ga0079957_135413023300005805LakeARSAADRLALFERIRDKVEEALACGAPVVSYSVDGQMVQKEPTSTWLAELDARIADLRSQAGSGLAGRRNLVRFRYD*
Ga0075461_1003031443300006637AqueousMARSPSQRLQLFEELRDRVESGLLSGAPVVTYTVDGQTVSKEPTSVWLAELDGRIADLRRQSSGGLGASRNVVRFRQ*
Ga0075471_1022012723300006641AqueousMARSATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNLVR
Ga0070749_1006025623300006802AqueousMARSSSERLALFESLRDRVESALLSGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRMSSGGLASGRNYVRFTNNG*
Ga0070749_1019186023300006802AqueousMARSATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIAELRRQASGGIHGARNLVRFSQ*
Ga0070749_1023210933300006802AqueousMARSSSERLALFESLRDRVESALLSGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRMSSGGLAGGRNFVRFTNG*
Ga0070749_1074643813300006802AqueousMARSASERLELFENLRDRVESALLAGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRQASGGLGRSRNYVRFTNG*
Ga0070749_1079072423300006802AqueousMARSSSERLALFENLRDRVESALLSGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRMSSGGLASGRNFVRFTNNG*
Ga0075464_1073161623300006805AqueousMARSASERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNLVRFSQ*
Ga0075459_100042933300006863AqueousMQHAGMARSPSERLTLFENIRDKVESALASGSPVVSYSMDGQTVQKEPTSTWLAELDARIADLRSQAGTGLAGRRNLVRFQR*
Ga0075477_1013795313300006869AqueousMARSPSQRLQLFEELRDRVESGLLSGAPVVTYTVDGQTVSKEPTSVWLAELDSRIADLRRQSSGGLGASRNAVRFRQ*
Ga0075473_1036767123300006875AqueousMARSAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGIGRSRN
Ga0070750_1014789543300006916AqueousMARSPSQRLQLFEELRDRVESGLLSGAPVVTYTVDGQTVSKEPTSVWLAELDSRIADLRRQSPGGLGASRNVV
Ga0070750_1042276613300006916AqueousLQLFEELRDRVESGLLSGAPVVTYTVDGQTVSKEPTSVWLAELDSRIADLRRQSSGGLGASRNAVRFRQ*
Ga0075472_1040322023300006917AqueousMARSATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGILGARNLVRFSQ*
Ga0103274_115090123300007202Freshwater LakeMIRCMARSAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGIGRSRNLVRFRNE*
Ga0075460_1019944413300007234AqueousMARSATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHG
Ga0070745_108817623300007344AqueousMARSSSERLALFENLRDRVESALLSGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRMSSG
Ga0070753_106450033300007346AqueousMARSASERLELFENLRDRVESALLAGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRQASGGLGRSRNYVRFTDG*
Ga0075458_10000702143300007363AqueousMARSPSERLTLFENIRDKVESALASGSPVVSYSMDGQTVQKEPTSTWLAELDARIADLRSQAGTGLAGRRNLVRFQR*
Ga0075458_1008789123300007363AqueousMARSASERLALFEGIRDKVEGALLSGAPIVSYTVDGQMVQKEATSTWLAELDARIADLRRQASGGLSRSRNLVRFRNV*
Ga0099851_105287333300007538AqueousMARSASERLALYEDLRDRVEGALLAGSPVISYTVDGQMVQKEATSTWLAELDARIADLRKQASGGIHSARNLVRFQR*
Ga0099851_129991913300007538AqueousALPCDSVRMARSASERLALYEGIRDKVESALLGGAPVVSYTLDGQLVQKEATSTWLAELDARIADLRRQASGGVFAARNNVRFVR*
Ga0099848_104601933300007541AqueousMARSASERLTLYEDLRDRVETGLLAGAPVITYTVDGQMVQKEPTSTWLAELDARISDLRRQASGGIHAARNLVRFQR*
Ga0099848_106809633300007541AqueousMARSSAERLALYESIRDKVESALMGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGLQGARNLVRFSQ*
Ga0099846_108835033300007542AqueousMARSASERLTLYEDLRDRVETGLLAGAPIITYTVDGQMVQKEPTSTWLAELDARISDLRRQASGGIHAARNLVRFQR*
Ga0099846_112661233300007542AqueousMARSSSERLALFESLRDRVESALLSGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRMSSGGLAGGRNFVRFTNNG*
Ga0070751_110871523300007640AqueousMARSSSERLALFESLRDRVESALLSGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRMSSGGLASGRNFVRFTNNG*
Ga0104988_1087843300007735FreshwaterMARSAAERLALFESIRDKVEGALASGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGMSRSRNLVRFRNV*
Ga0105746_135627313300007973Estuary WaterMARSAAERLALFERIRDKVEGALASGAPVVSYTVDGQMVQKEATSTWLAELDARIADLRRQASGGMSRSRNLVRFRNV*
Ga0114350_100732433300008116Freshwater, PlanktonMARSAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGIGRSRNLVRFRND*
Ga0114351_111276513300008117Freshwater, PlanktonMARSAAERLALFESIRDKVEGALASGAPVVSYTVDGQMVQKEATSTWLAELDARIADLRRQASGGMSRSRNLVRLRNV*
Ga0114363_104758123300008266Freshwater, PlanktonMRNMARSAADRLALFERIRDKVEEALACGAPVVSYSVDGQMVQKEPTSTWLAELDARIADLRSQAGSGLAGRRNLVRFRYD*
Ga0114363_104987023300008266Freshwater, PlanktonMIRSMARSAAERLALFESIRDKVEGALASGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGIGRSRNLVRFRND*
Ga0114363_107279823300008266Freshwater, PlanktonMARSAARDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGMSRSRNLVRLRNV*
Ga0114363_111004923300008266Freshwater, PlanktonMHSMARSPAERLALFEQLRDKVEGALLSGAPIVSYSLDGQMVTKEPTSTWLAELDARIADLRRQAGAGLSASRNLVRFQ*
Ga0114363_113233113300008266Freshwater, PlanktonHSMARSPAERLALFEQLRDKVEGALLSGAPVVSYSLDGQMVTKEPTSTWLAELDARIADLRRQAGTGLSASRNLVRFQ*
Ga0114880_100729133300008450Freshwater LakeMARSPAERLALFEQLRDKVEGALLSGAPVVSYSLDGQMVTKEPTSTWLAELDARIADLRRQAGTGLSASRNLVRFQ*
Ga0114880_106811723300008450Freshwater LakeMARSPAERLALFEQLRDKVEGALLSGAPIVSYSLDGQMVTKEPTSTWLAELDARIADLRRQAGAGLSASRNLVRFQ*
Ga0105098_1000450423300009081Freshwater SedimentMARSSSERLALYESIRDKVESALMGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGLHGARNLVRFSQ*
Ga0105103_1033493423300009085Freshwater SedimentMARSSSERLALYESIRDKVESALMGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGLHGARNLVRFS
Ga0118687_1001383613300009124SedimentMARSPSQRLQLFEELRDRVESGLLSGAPVVTYTVDGQTVSKEPTSVWLAELDSRIADLRRQSSGGLGAS
Ga0114970_1006272023300009163Freshwater LakeMIVMAKSASERLALFEQIRDKVEGALLSGSPVVSYSVDGQVVTKEPTSSWLAELDSRISDLRRQSSGGLSAGRNLVRFRNV*
Ga0105104_1077703113300009168Freshwater SedimentASERLALFEQIRDKVEGALLSGSPVVSYSVDGQVVTKEPTSSWLAELDSRISDLRRQSSGGLAAGRNLVRFRNV*
Ga0115028_1162190313300009179WetlandRSAAERLALFESIRDKVEGALASGAPVVSYTVDGQMVQKEATSTWLAELDARIADLRRQASGGMSRSRNLVRFRNV*
Ga0103868_100087023300009384River WaterMARSSAERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNLVRFSQ*
Ga0129345_129049523300010297Freshwater To Marine Saline GradientSQRLQLFKELRDRVESGLLSGAPVVTYTVDGQTVSKEPTSVWLAELDSRIADLRRQSSGGLGASRNAVRFRQ*
Ga0129333_1036804013300010354Freshwater To Marine Saline GradientTLYEDLRDRVETGLLAGAPVITYTVDGQMVQKEPTSTWLAELDARISDLRRQASGGIHAARNLVRFQR*
Ga0129333_1060225623300010354Freshwater To Marine Saline GradientMARSASERLALYEDLRDRVETGLLAGSPIITYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGITKARNLVRFQS*
Ga0129333_1063748023300010354Freshwater To Marine Saline GradientMARSASERLALYEDLRDRVETGLLAGSPIITYTVDGQMVQKEPTSTWLAELDARISDLRRQASGGITKARNLVRFQS*
Ga0129333_1086423523300010354Freshwater To Marine Saline GradientMRNMARSAADRLALFERIRDKVEEALACGAPVVSYSVDGQMVQKEPTSTWLAELDARIADLRSQAGNGLAGRRNLVRFRYD*
Ga0129336_1029169213300010370Freshwater To Marine Saline GradientPCTMHSMARSPAERLALFEQLRDKVEGALLTGAPVVSYSLDGQMVTKEPTSTWLAELDARIADLRRQAGSGLAASRNLVRFQ*
Ga0153800_100064033300011995FreshwaterMARSATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQREPTSEWLAELDARIADLRRQASGGIHGARNLVRFSQ*
Ga0153805_103403123300012013Surface IceTGDNGASVCDCASMARSATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNLVRFSQ*
(restricted) Ga0172368_1003300723300013123FreshwaterMRIMARSAAERLTLFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGLSRSRNLVRFQND*
(restricted) Ga0172367_1061033313300013126FreshwaterMQSMARSAAERLTLFEGIRDKVEGALLSGAPIVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGLPRSRNLVRFRYD*
Ga0177922_1120242213300013372FreshwaterMARSATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNLV
Ga0181344_101151433300017754Freshwater LakeMIVMAKSASERLALFEQIRDKVEGALLSGSPVISYSVDGQVVTKEPTSSWLAELDSRISDLRRQSSGGLAAGRNLVRFRNV
Ga0181355_101188823300017785Freshwater LakeMARSASERLALFEGIRDKVEGALLSGAPIVSYTVDGQMVQKEATSTWLAELDARIADLRRQASGGLSRSRNLVRFRNV
Ga0169931_1010103823300017788FreshwaterMRIMARSAAERLTLFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGLSRSRNLVRFQND
Ga0181577_1007950423300017951Salt MarshMARSASERLELFENLRDRVESALLAGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRQASGGLGRSRSYVRFTNG
Ga0181577_1021079723300017951Salt MarshMARSPSQRLQLFEELRDRVESGLLSGAPVVTYTVDGQTVAKEPTSVWLAELDSRIADLRRQSSGGLGASRNVVRFRQ
Ga0181577_1042550623300017951Salt MarshMARSASERLELFENLRDRVESALLAGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRQASGGLGRSR
Ga0181553_1074265323300018416Salt MarshMARSASERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNLVRFSQ
Ga0193978_101427723300019747SedimentPSQRLQLFEELRDRVESGLLSGAPVVTYTVDGQTISKEPTSVWLAELDSRIADLRRQSSGGLGASRNAVRFRQ
Ga0194000_101649213300019750SedimentRSPSQRLQLFEELRDRVESGLLSGAPVVTYTVDGQTVSKEPTSVWLAELDSRIADLRRQSSGGLGASRNAVRFRQ
Ga0194023_100094443300019756FreshwaterMARSSSERLALFENLRDRVESALLSGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRMSSGGLAGGRNFVRFTNG
Ga0194023_109705623300019756FreshwaterQLFEELRDRVESGLLSGAPVVTYTVDGQTVSKEPTSVWLAELDGRIADLRRQSSGGLGASRNVVRFRQ
Ga0194024_103429613300019765FreshwaterSQRLQLFEELRDRVESGLLSGSPVVTYTVDGQTVSKEPTSVWLAELDGRIADLRRQSSGGLGASRNAVRFRQ
Ga0181359_111358413300019784Freshwater LakeMARSATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQANGGIHGARNLVRFSQ
Ga0207193_102772833300020048Freshwater Lake SedimentMIVMAKSASERLALFEQIRDKVEGALLSGSPVVSYSVDGQVVTKEPTSSWLAELDSRISDLRRQSSGGLAAGRNLVRFRNV
Ga0194113_1025131623300020074Freshwater LakeMHSMARSAAERLTLFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGLSRSRNLVRFRND
Ga0208232_101608123300020527FreshwaterMQHAGMARSASERLTLFENIRDKVESALASGSPVVSYSVDGQTVQKEPTSTWLAELDARIADLRSQAGTGLAGRKNLVRFQR
Ga0208361_105272513300020547FreshwaterTLFENIRDKVESALASGSPVVSYSVDGQTVQKEPTSTWLAELDARIADLRSQAGTGLAGRKNLVRFQR
Ga0208465_100067933300020570FreshwaterMQHARMARSASERLTLFENIRDKVESALASGSPVVSYSVDGQTVQKEPTSTWLAELDARIADLRSQAGTGLAGRKNLVRFQR
Ga0222714_1003779523300021961Estuarine WaterMARSAAERLALFESIRDKVEGALASGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGIGRSRNLVRFRNV
Ga0222714_1038188133300021961Estuarine WaterMIRSMARSAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGG
Ga0222713_1022926423300021962Estuarine WaterMIRSMARSAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGIGRSRNLVRFRND
Ga0222713_1057038423300021962Estuarine WaterMARSAAERLVLFESIRDKVEGALASGAPVVSYTVDGQMVQKEATSTWLAELDARIADLRRQASGGMSRSRNLVRFRNV
Ga0222712_1036485223300021963Estuarine WaterMARSASERLALYEDLRDRVETGLLAGAPVITYTVDGQMVQKEPTSTWLAELDARISDLRRQASGGIHAARNLVRFQR
Ga0222719_1014497813300021964Estuarine WaterEELRDRVESGLLSGAPVVTYTVDGQTVSKEPTSVWLAELDSRIADLRRQSSGGLGASRNAVRFRQ
Ga0212029_105308623300022063AqueousMARSSSERLALFESLRDRVESALLSGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRMSSGGLAGGRNFVRFTNG
Ga0212031_102421133300022176AqueousMARSASERLELFENLRDRVESALLAGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRQASGGLGRSRNYVRFTDG
Ga0212031_108501723300022176AqueousMARSASERLALYEDLRDRVEGALLAGSPVISYTVDGQMVQKEATSTWLAELDARIADLRKQASGGIHAARNLVRFQR
Ga0181353_102356723300022179Freshwater LakeMARSAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGIGRSRNLVRFRND
Ga0196891_101136313300022183AqueousMARSPSQRLQLFEELRDRVESGLLSGAPVVTYTVDGQTVSKEPTSVWLAELDGRIADLRRQSSGGLGASRNVVRFRQ
Ga0196899_103132123300022187AqueousMARSPSQRLQLFEELRDRVESGLLSGAPVVTYTVDGQTVSKEPTSVWLAELDSRIADLRRQSSGGLGASRNAVRFQQ
Ga0196905_113753823300022198AqueousMARSASERLTLYEDLRDRVETGLLAGAPVITYTVDGQMVQKEPTSTWLAELDARISDLRRQASGGIHAARNLVRFQR
Ga0196905_115180213300022198AqueousLYESIRDKVESALMGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGLQGARNLVRFSQ
Ga0196901_121153413300022200AqueousMARSASERLALYEDLRDRVEGALLAGSPVISYTVDGQMVQKEATSTWLAELDARIADLRKQASGGIHSARNLVRFQR
Ga0255242_101015223300024554FreshwaterMARSAAERLALFESIRDKVEGALASGAPVVSYTVDGQMVQKEATSTWLAELDARIADLRRQASGGISRSRNLVRFRNV
Ga0256306_102086323300024560FreshwaterAERLALFESIRDKVEGALASGAPVVSYTVDGQMVQKEATSTWLAELDARIADLRRQASGGISRSRNLVRFRNV
Ga0256309_104514623300024566FreshwaterEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNLVRFSQ
Ga0255243_105090413300024569FreshwaterSAAERLALFESIRDKVEGALASGAPVVSYTVDGQMVQKEATSTWLAELDARIADLRRQASGGISRSRNLVRFRNV
Ga0208424_100035133300025445AqueousMQHAGMARSPSERLTLFENIRDKVESALASGSPVVSYSMDGQTVQKEPTSTWLAELDARIADLRSQAGTGLAGRRNLVRFQR
Ga0208546_110495823300025585AqueousCASMARSATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNLVRFSQ
Ga0208004_101870823300025630AqueousMARSPSQRLQLFEELRDRVESGLLSGAPVVTYTVDGQTVSKEPTSVWLAELDSRIADLRRQSSGGLGASRNAVRFRQ
Ga0208147_100046033300025635AqueousMARSPSERLTLFENIRDKVESALASGSPVVSYSMDGQTVQKEPTSTWLAELDARIADLRSQAGTGLAGRRNLVRFQR
Ga0208147_110796023300025635AqueousRLEVLPSCGMIRSMARSAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGIGRSRNLVRFRND
Ga0208147_113505213300025635AqueousEDSGGSVCDCASMARSATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNLVRFSQ
Ga0208161_107391213300025646AqueousAMARSSSERLALFESLRDRVESALLSGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRMSSGGLAGGRNFVRFTNG
Ga0255241_101827623300025746FreshwaterLFESIRDKVEGALASGAPVVSYTVDGQMVQKEATSTWLAELDARIADLRRQASGGISRSRNLVRFRNV
Ga0208767_105866123300025769AqueousLRDRVESGLLSGAPVVTYTVDGQTVSKEPTSVWLAELDSRIADLRRQSSGGLGASRNAVRFRQ
Ga0208427_117751013300025771AqueousPDMARSPSQRLQLFEELRDRVESGLLSGAPVVTYTVDGQTVSKEPTSVWLAELDSRIADLRRQSSGGLGASRNVVRFQQ
Ga0208644_118858423300025889AqueousMARSSSERLALFESLRDRVESALLSGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRMSSGGLASGRNYVRFTNNG
Ga0208644_120117213300025889AqueousMARSSSERLALFENLRDRVESALLSGAPVVTYTVDGQTVQKEPTSTWLAELDARIADLRRMSSGGLASGRNFVRFTNNG
Ga0256311_110464123300026565FreshwaterALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNLVRFSQ
Ga0208555_106116013300027213EstuarineCDCASMARSATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNLVRFSQ
Ga0255086_104386423300027486FreshwaterMARSATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNL
Ga0208975_103041023300027659Freshwater LenticMQHAGMARSASERLTLFENIRDKVESALASGSPVVSYSMDGQTVQKEPTSTWLAELDARIADLRSQAGTGLAGRRNLVRFTNG
Ga0209492_103692013300027721Freshwater SedimentMAKSASERLALFEQIRDKVEGALLSGSPVVSYSVDGQVVTKEPTSSWLAELDSRISDLRRQSSGGLAAGRNLVRFRNV
Ga0209190_109591923300027736Freshwater LakeMIVMAKSASERLALFEQIRDKVEGALLSGSPVVSYSVDGQVVTKEPTSSWLAELDSRISDLRRQSSGGLSAGRNLVRFRNV
Ga0209972_1000731263300027793Freshwater LakeMIRSMARSAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGMSRSRNLVRFRNV
Ga0209972_1008643023300027793Freshwater LakeRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGIGRSRNLVRFRND
Ga0209229_1009437623300027805Freshwater And SedimentMARSAADRLALFEGIRDKVEGALASGAPVVSYTVDGQMVQKEATSTWLAELDARIADLRRQASGGMSRSRNLVRFRNV
Ga0209985_1008399123300027806Freshwater LakeAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGMSRSRNLVRFRNV
Ga0209990_1006164413300027816Freshwater LakeAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGIGRSRNLVRFRND
Ga0209635_1074468123300027888Marine SedimentMVRSASERLALYEGIRDKVESALLGGAPVVSYTLDGQLVQKEATSTWLAELDARIADLRRQASGGVFAARNNVRFVR
Ga0209668_1021560723300027899Freshwater Lake SedimentMARTASDRLALYEQIRDKVEGALLSGSPVVSYSVDGQVVTKEPTSSWLAELDSRIADLRKQTTGGLASARNLVRFRNV
Ga0209820_101561123300027956Freshwater SedimentMARSSSERLALYESIRDKVESALMGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGLHGARNLVRFSQ
Ga0256305_106857723300028108FreshwaterATERLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNLVRFSQ
Ga0256305_112395113300028108FreshwaterCDSGSMARSAAERLALFESIRDKVEGALASGAPVVSYTVDGQMVQKEATSTWLAELDARIADLRRQASGGISRSRNLVRFRNV
Ga0315907_1003460053300031758FreshwaterMARSPAERLALFEQLRDKVEGALLSGAPVVSYSLDGQMVTKEPTSTWLAELDARIADLRRQAGTGLSASRNLVRFQ
Ga0315907_1129381713300031758FreshwaterYARIARSASERLTLFENIRDKVESALASGSPVVSYSVDGQTVQKEPTSTWLAELDARIADLRSQAGTGLAGRKNLVRFQR
Ga0315900_1005141143300031787FreshwaterMARSASERLTLFENIRDKVESALASGSPVVSYSVDGQTVQKEPTSTWLAELDARIADLRSQAGTGLAGRKNLVRFQR
Ga0315909_1010126233300031857FreshwaterIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGMSRSRNLVRLRNV
Ga0315909_1016592123300031857FreshwaterMMRNMARSAADRLALFERIRDKVEEALACGAPVVSYSVDGQMVQKEPTSTWLAELDARIADLRSQAGSGLAGRRNLVRFRYD
Ga0315909_1028923223300031857FreshwaterMARSPAERLALFEQLRDKVEGALLSGAPIVSYSLDGQMVTKEPTSTWLAELDARIADLRRQAGAGLSASRNLVRFQ
Ga0315904_1003811633300031951FreshwaterMARSAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGMSRSRNLVRFRNV
Ga0315904_1015029123300031951FreshwaterMHSMARSPAERLALFEQLRDKVEGALLSGAPVVSYSLDGQMVTKEPTSTWLAELDARIADLRRQAGTGLSASRNLVRFT
Ga0315904_1074732023300031951FreshwaterMARSATDRLALYEGIRDKVESALLGGAPVVAYTLDGQMVQKEPTSEWLAELDARIADLRRQASGGIHGARNLVRFSQ
Ga0315906_1003074453300032050FreshwaterMIRSMARSAADRLALFEGIRDKVEGALLSGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGMSRSRNLVRLRNV
Ga0315906_1003304123300032050FreshwaterMHSMARSPAERLALFEQLRDKVEGALLSGAPVVSYSLDGQMVTKEPTSTWLAELDARIADLRRQAGTGLSASRNLVRFQ
Ga0334994_0007446_3063_32963300033993FreshwaterMARSPQERLTLFENIRDKVESALASGSPVVSYSMDGQTVQKEPTSTWLAELDARIADLRSQAGTGLAGRRNLVRFQR
Ga0334986_0044970_590_8203300034012FreshwaterMARSPAERLALFEQLRDKVEGALLSGAPVVSYSLDGQMVTKEPTSTWLAELDARIADLRRQAGSGLAASRNLVRFQ
Ga0334987_0058933_556_7953300034061FreshwaterMHSMARSPAERLALFEQLRDKVEGALLTGAPVVSYSLDGQMVTKEPTSTWLAELDARIADLRRQASGGLSASRNLVRFQ
Ga0310130_0002121_2951_31843300034073Fracking WaterMARSASERLALYEDLRDRVEGALLAGSPVISYTVDGQMVQREATSTWLAELDARIADLRKQASGGIHSARNLVRFQR
Ga0335025_0397382_418_6543300034096FreshwaterMARSAADRLALFEGIRDKVEGALASGAPVVSYTVDGQMVQKEPTSTWLAELDARIADLRRQASGGMSRSRNLVRFRNV
Ga0335030_0265043_905_11533300034103FreshwaterMQHACMARSASERLTLFENIRDKVESALASGSPVVSYSVDGQTVQKEPTSTWLAELDARIADLRSQAGTGLAGRKNLVRFQR
Ga0335036_0011999_6488_66973300034106FreshwaterLALYEDLRDRVETGLLAGAPVITYTVDGQMVQKEPTSTWLAELDARISDLRRQASGGIHAARNLVRFQR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.