NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F042088

Metagenome / Metatranscriptome Family F042088

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042088
Family Type Metagenome / Metatranscriptome
Number of Sequences 159
Average Sequence Length 118 residues
Representative Sequence MSLSGMRCYGDDRNHSSLRAIIPEDPVGARCFLLGICLEDLFPVRPFEGSKFVRVQRGMPQVGFKKPQAFPDGFEDIPLRGVVFNLPKVGVGLGCEDQFVHRSLFGVLGKRSALDGSLLRKPGEDFL
Number of Associated Samples 99
Number of Associated Scaffolds 159

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 64.78 %
% of genes near scaffold ends (potentially truncated) 39.62 %
% of genes from short scaffolds (< 2000 bps) 79.25 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(37.107 % of family members)
Environment Ontology (ENVO) Unclassified
(47.170 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(54.088 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 10.32%    β-sheet: 0.00%    Coil/Unstructured: 89.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 159 Family Scaffolds
PF01850PIN 5.66
PF10049DUF2283 2.52
PF00041fn3 1.89
PF01934HepT-like 1.89
PF05016ParE_toxin 1.26
PF01402RHH_1 1.26
PF01609DDE_Tnp_1 1.26
PF03721UDPG_MGDP_dh_N 1.26
PF02452PemK_toxin 1.26
PF14602Hexapep_2 1.26
PF07927HicA_toxin 1.26
PF12441CopG_antitoxin 1.26
PF04365BrnT_toxin 0.63
PF04255DUF433 0.63
PF13470PIN_3 0.63
PF13458Peripla_BP_6 0.63
PF09721Exosortase_EpsH 0.63
PF07362CcdA 0.63
PF01909NTP_transf_2 0.63
PF13975gag-asp_proteas 0.63
PF00589Phage_integrase 0.63
PF01381HTH_3 0.63
PF13751DDE_Tnp_1_6 0.63
PF10387DUF2442 0.63
PF05534HicB 0.63
PF00483NTP_transferase 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 159 Family Scaffolds
COG2361HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 1.89
COG2445Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 familyGeneral function prediction only [R] 1.89
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.26
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 1.26
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 1.26
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 1.26
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 1.26
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 1.26
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 1.26
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 1.26
COG3293TransposaseMobilome: prophages, transposons [X] 1.26
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 1.26
COG5421TransposaseMobilome: prophages, transposons [X] 1.26
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 1.26
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 1.26
COG1598Antitoxin component HicB of the HicAB toxin-antitoxin systemDefense mechanisms [V] 0.63
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 0.63
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 0.63
COG4226Predicted nuclease of the RNAse H fold, HicB familyGeneral function prediction only [R] 0.63
COG5302Post-segregation antitoxin (ccd killing mechanism protein) encoded by the F plasmidMobilome: prophages, transposons [X] 0.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001371|BBDRAFT_10442433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18579Open in IMG/M
3300001749|JGI24025J20009_10147266All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18577Open in IMG/M
3300002465|LO132_10005448All Organisms → cellular organisms → Bacteria5878Open in IMG/M
3300003859|Ga0031653_10033064All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_121439Open in IMG/M
3300003859|Ga0031653_10045016All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181203Open in IMG/M
3300004113|Ga0065183_10230493All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18807Open in IMG/M
3300005145|Ga0068713_1103058All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18906Open in IMG/M
3300005252|Ga0068712_1090701All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300005588|Ga0070728_10087257All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181895Open in IMG/M
3300005833|Ga0074472_10683245All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300005917|Ga0075115_10017517All Organisms → cellular organisms → Bacteria2912Open in IMG/M
3300006224|Ga0079037_101913864All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300009078|Ga0105106_10621423All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18774Open in IMG/M
3300009087|Ga0105107_10148659All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions1648Open in IMG/M
3300009529|Ga0114919_10155865All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181641Open in IMG/M
3300010328|Ga0129298_10551268All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300017931|Ga0187877_1035936All Organisms → cellular organisms → Bacteria2404Open in IMG/M
3300017938|Ga0187854_10005894All Organisms → cellular organisms → Bacteria8644Open in IMG/M
3300017944|Ga0187786_10255717All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300017987|Ga0180431_10447636All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18909Open in IMG/M
3300017987|Ga0180431_10624064All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300018026|Ga0187857_10053390All Organisms → cellular organisms → Bacteria2064Open in IMG/M
3300018030|Ga0187869_10028766All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions3084Open in IMG/M
3300018055|Ga0184616_10035332All Organisms → cellular organisms → Bacteria1614Open in IMG/M
3300018055|Ga0184616_10245181All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18678Open in IMG/M
3300018068|Ga0184636_1129277All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18879Open in IMG/M
3300018068|Ga0184636_1333666All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300018070|Ga0184631_10006763All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3424Open in IMG/M
3300018070|Ga0184631_10033791All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions1799Open in IMG/M
3300018070|Ga0184631_10059100All Organisms → cellular organisms → Bacteria1422Open in IMG/M
3300021351|Ga0210365_10789050All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18883Open in IMG/M
3300022202|Ga0224498_10101181All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18832Open in IMG/M
3300022217|Ga0224514_10025541All Organisms → cellular organisms → Bacteria → Proteobacteria1923Open in IMG/M
3300022556|Ga0212121_10227679All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_611301Open in IMG/M
(restricted) 3300022913|Ga0233404_10072518All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18801Open in IMG/M
(restricted) 3300022938|Ga0233409_10092543All Organisms → cellular organisms → Bacteria946Open in IMG/M
(restricted) 3300023089|Ga0233408_10031366All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18875Open in IMG/M
(restricted) 3300023210|Ga0233412_10004466All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina6217Open in IMG/M
(restricted) 3300023210|Ga0233412_10488454All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18556Open in IMG/M
(restricted) 3300024059|Ga0255040_10360119All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18614Open in IMG/M
3300024429|Ga0209991_10249346All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18864Open in IMG/M
3300024432|Ga0209977_10380511All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18671Open in IMG/M
(restricted) 3300024529|Ga0255044_10458975All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18537Open in IMG/M
3300024997|Ga0209334_1024All Organisms → cellular organisms → Bacteria → Proteobacteria9125Open in IMG/M
3300025031|Ga0210024_1128826All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18770Open in IMG/M
3300025036|Ga0210049_1050344All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2437Open in IMG/M
3300025288|Ga0210044_10036319All Organisms → cellular organisms → Bacteria4336Open in IMG/M
3300025811|Ga0210004_1119902All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18682Open in IMG/M
3300027723|Ga0209703_1241755All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18653Open in IMG/M
3300027723|Ga0209703_1325245All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18541Open in IMG/M
3300027740|Ga0214474_1021331All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont2540Open in IMG/M
3300027740|Ga0214474_1206089All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18716Open in IMG/M
3300027758|Ga0209379_10136776All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300027790|Ga0209273_10343090All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18601Open in IMG/M
3300027792|Ga0209287_10176817All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18812Open in IMG/M
3300027811|Ga0256868_10019827All Organisms → cellular organisms → Bacteria3195Open in IMG/M
3300027811|Ga0256868_10075594All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181519Open in IMG/M
3300027887|Ga0208980_10271288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18985Open in IMG/M
3300027896|Ga0209777_10146231All Organisms → cellular organisms → Bacteria1953Open in IMG/M
3300027900|Ga0209253_10053638All Organisms → cellular organisms → Bacteria → Atribacterota → Atribacteria3342Open in IMG/M
3300027900|Ga0209253_10113270All Organisms → cellular organisms → Bacteria2216Open in IMG/M
3300027900|Ga0209253_10314393All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181212Open in IMG/M
3300027900|Ga0209253_10332161All Organisms → cellular organisms → Bacteria → Proteobacteria1172Open in IMG/M
3300027900|Ga0209253_10747681All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300027917|Ga0209536_102355288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18631Open in IMG/M
3300027980|Ga0209475_10081115All Organisms → cellular organisms → Bacteria → Proteobacteria1611Open in IMG/M
(restricted) 3300028045|Ga0233414_10006986All Organisms → cellular organisms → Bacteria4300Open in IMG/M
3300028191|Ga0265595_1109694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18888Open in IMG/M
3300028420|Ga0210366_10438395All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18553Open in IMG/M
3300028598|Ga0265306_10784732All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18528Open in IMG/M
3300028600|Ga0265303_10901842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18729Open in IMG/M
3300030613|Ga0299915_10056070All Organisms → cellular organisms → Bacteria2919Open in IMG/M
3300030613|Ga0299915_10445843All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300031539|Ga0307380_10008820All Organisms → cellular organisms → Bacteria12876Open in IMG/M
3300031585|Ga0315534_1105270All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181077Open in IMG/M
3300031586|Ga0315541_1149685All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18698Open in IMG/M
(restricted) 3300031593|Ga0315307_1008213All Organisms → cellular organisms → Bacteria4506Open in IMG/M
3300031673|Ga0307377_10142937All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions1900Open in IMG/M
3300031673|Ga0307377_10439914All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18961Open in IMG/M
3300031698|Ga0315537_1071811All Organisms → cellular organisms → Bacteria → Proteobacteria1791Open in IMG/M
3300031707|Ga0315291_10199275All Organisms → cellular organisms → Bacteria2043Open in IMG/M
3300031707|Ga0315291_11230903All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18610Open in IMG/M
3300031746|Ga0315293_10324815All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181228Open in IMG/M
3300031746|Ga0315293_10431345All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181031Open in IMG/M
3300031746|Ga0315293_10786421All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18698Open in IMG/M
3300031772|Ga0315288_10639481All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181017Open in IMG/M
3300031772|Ga0315288_10672464All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria982Open in IMG/M
3300031834|Ga0315290_10050180All Organisms → cellular organisms → Bacteria3387Open in IMG/M
3300031834|Ga0315290_11335444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18589Open in IMG/M
3300031834|Ga0315290_11587365All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18529Open in IMG/M
3300031862|Ga0315280_10245433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18955Open in IMG/M
3300031862|Ga0315280_10246134All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18953Open in IMG/M
3300031873|Ga0315297_10342626All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300031873|Ga0315297_10428804All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181110Open in IMG/M
3300031873|Ga0315297_11245909All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18608Open in IMG/M
3300031885|Ga0315285_10098557All Organisms → cellular organisms → Bacteria → Proteobacteria2556Open in IMG/M
3300031885|Ga0315285_10564738All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18764Open in IMG/M
(restricted) 3300031898|Ga0315312_1040583All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181854Open in IMG/M
3300031949|Ga0214473_10704337All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300031949|Ga0214473_10738653All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181068Open in IMG/M
3300031949|Ga0214473_11553445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18665Open in IMG/M
3300031949|Ga0214473_11857727All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300031952|Ga0315294_10287453All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181586Open in IMG/M
3300031952|Ga0315294_10397600All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions1291Open in IMG/M
3300031952|Ga0315294_10758330All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18842Open in IMG/M
3300031997|Ga0315278_10194734All Organisms → cellular organisms → Bacteria2084Open in IMG/M
3300031997|Ga0315278_10329288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181578Open in IMG/M
3300031997|Ga0315278_10932924All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18869Open in IMG/M
3300031999|Ga0315274_10943152All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18891Open in IMG/M
3300031999|Ga0315274_10975868All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18870Open in IMG/M
3300032020|Ga0315296_10340373All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300032053|Ga0315284_10874842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1029Open in IMG/M
3300032053|Ga0315284_11049255All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18912Open in IMG/M
3300032053|Ga0315284_11155252All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18855Open in IMG/M
3300032062|Ga0315551_10249827All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18693Open in IMG/M
3300032069|Ga0315282_10006485All Organisms → cellular organisms → Bacteria19572Open in IMG/M
3300032069|Ga0315282_10050351All Organisms → cellular organisms → Bacteria4551Open in IMG/M
3300032069|Ga0315282_10061032All Organisms → cellular organisms → Bacteria3878Open in IMG/M
3300032069|Ga0315282_10301831All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181043Open in IMG/M
3300032070|Ga0315279_10624402All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300032070|Ga0315279_10626554All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18670Open in IMG/M
3300032118|Ga0315277_10196032All Organisms → cellular organisms → Bacteria → Proteobacteria2201Open in IMG/M
3300032118|Ga0315277_10647890All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300032118|Ga0315277_11743694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18520Open in IMG/M
3300032143|Ga0315292_10110193All Organisms → cellular organisms → Bacteria2163Open in IMG/M
3300032143|Ga0315292_10149819All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181875Open in IMG/M
3300032143|Ga0315292_10246666All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181474Open in IMG/M
3300032156|Ga0315295_10156343All Organisms → cellular organisms → Bacteria2269Open in IMG/M
3300032156|Ga0315295_10221502All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181904Open in IMG/M
3300032156|Ga0315295_10471479All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300032156|Ga0315295_11289222All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18712Open in IMG/M
3300032156|Ga0315295_11634885All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18616Open in IMG/M
3300032163|Ga0315281_10130908All Organisms → cellular organisms → Bacteria2868Open in IMG/M
3300032163|Ga0315281_10156822All Organisms → cellular organisms → Bacteria → Proteobacteria2573Open in IMG/M
3300032163|Ga0315281_10299345All Organisms → cellular organisms → Bacteria1757Open in IMG/M
3300032163|Ga0315281_11773097All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18596Open in IMG/M
3300032177|Ga0315276_12114737All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18572Open in IMG/M
3300032262|Ga0316194_10166403All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181417Open in IMG/M
3300032342|Ga0315286_10473935All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181306Open in IMG/M
3300032342|Ga0315286_10762227All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18983Open in IMG/M
3300032397|Ga0315287_11159163All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18892Open in IMG/M
3300032401|Ga0315275_10831070All Organisms → cellular organisms → Bacteria → Proteobacteria1022Open in IMG/M
3300032401|Ga0315275_11822145All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18645Open in IMG/M
3300032516|Ga0315273_10487440All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181652Open in IMG/M
3300033429|Ga0316193_11223897All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18596Open in IMG/M
3300033480|Ga0316620_10688166All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18971Open in IMG/M
3300033480|Ga0316620_11022559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18804Open in IMG/M
3300033481|Ga0316600_10159500All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300033485|Ga0316626_10074309All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions2406Open in IMG/M
3300033485|Ga0316626_10979847All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18749Open in IMG/M
3300033485|Ga0316626_11581459All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300033487|Ga0316630_11814986All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18557Open in IMG/M
3300033489|Ga0299912_10990383All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18627Open in IMG/M
3300033489|Ga0299912_11327670All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18518Open in IMG/M
3300033513|Ga0316628_100253741All Organisms → cellular organisms → Bacteria2156Open in IMG/M
3300033513|Ga0316628_100781056All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B181258Open in IMG/M
3300033513|Ga0316628_102479204All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300033513|Ga0316628_103659805All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18553Open in IMG/M
3300033557|Ga0316617_101201384All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18753Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment37.11%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.55%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment5.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil5.03%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.40%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.77%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.14%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.52%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment2.52%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment2.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.52%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.89%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.89%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.89%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment1.26%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.26%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.26%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.26%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment1.26%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment1.26%
Enrichment CultureEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture1.26%
Anoxic Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water0.63%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment0.63%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.63%
AquiferEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer0.63%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake0.63%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.63%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine0.63%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.63%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.63%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine0.63%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.63%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.63%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.63%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.63%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001371Baker-B-sedEnvironmentalOpen in IMG/M
3300001749Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3EnvironmentalOpen in IMG/M
3300002465Anoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, ItalyEnvironmentalOpen in IMG/M
3300003859Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BREnvironmentalOpen in IMG/M
3300004113Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2)EnvironmentalOpen in IMG/M
3300005145Enrichment culture microbial communities om Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS2 (Arthur Kill Sulfidogenic replicate 2) MetaGEngineeredOpen in IMG/M
3300005252Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS1 (Arthur Kill Sulfidogenic replicate 1) MetaGEngineeredOpen in IMG/M
3300005588Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1EnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005917Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKHEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300010328Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaGEnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017987Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaGEnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018068Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2EnvironmentalOpen in IMG/M
3300018070Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1EnvironmentalOpen in IMG/M
3300021351Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.637 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022202Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022217Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022556Kivu_combined assemblyEnvironmentalOpen in IMG/M
3300022913 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MGEnvironmentalOpen in IMG/M
3300022938 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MGEnvironmentalOpen in IMG/M
3300023089 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024429Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024432Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024529 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21EnvironmentalOpen in IMG/M
3300024997Soil microbial communities from Rifle, Colorado, USA - 2008 BG 13ftEnvironmentalOpen in IMG/M
3300025031Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-25 (SPAdes)EnvironmentalOpen in IMG/M
3300025036Groundwater microbial communities from aquifer - Crystal Geyser CG06_land_8/20/14_3.00 (SPAdes)EnvironmentalOpen in IMG/M
3300025288Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/9/14 3 um filter (SPAdes)EnvironmentalOpen in IMG/M
3300025811Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/8/14 3 um filter (SPAdes)EnvironmentalOpen in IMG/M
3300027723Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027740Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeqEnvironmentalOpen in IMG/M
3300027758Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027790Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027792Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027811Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeqEnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300027980Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 (SPAdes)EnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028191Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_50mEnvironmentalOpen in IMG/M
3300028420Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028598Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300030613Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031585Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-40EnvironmentalOpen in IMG/M
3300031586Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-190EnvironmentalOpen in IMG/M
3300031593 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP2EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031698Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-70EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031862Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031898 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP7EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032020Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032062Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-90EnvironmentalOpen in IMG/M
3300032069Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20EnvironmentalOpen in IMG/M
3300032070Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032262Coastal sediment microbial communities from Maine, United States - Cross River sediment 1EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033429Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2EnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033489Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BBDRAFT_1044243323300001371Marine EstuarineMRCYGDDGNHSSFRAIIPEDPVGARCFLLGICLENLFSVRPFEGSKFVRVQRGMSEVGFKKPQAFPDGFEDIAWRGIVFKFPQVGIGLRSENQFVHRSLFGVFGKRSALDGSLLRK
JGI24025J20009_1014726613300001749MarineMRCYGDDCNHSSLRAIIPEDPVGARCFLLSICLENLFPFRPFEGSKFVCFQRGVPQAGFKKSKAFPDGFEDISLRRVVFNLPKIGVGLGRENQFVHRSLFGVLGKRSALDRSLLRKPG*
LO132_1000544853300002465Freshwater LakeMSLSWVRCYGDDGNHSSLRAIIPEDPVGAGCFLPGICLEDLFPVRAFEGSKFVRVQRGMPQVGFKKPQAFPDGFEDIFLRGIFFNRPKVGIGLRGEEQFVHRSLFGVLGKRSALDGALLRESGEDFL*
Ga0031653_1003306423300003859Freshwater Lake SedimentMGCYGDDRNHSSPGSIIPKNPVGARCFLLGISLKDLFPVRPLERTKFMCVQRGMAQVGFEKPQAFSDGFKGIFLRGIVFNLPKICVGLGCEN*
Ga0031653_1004501633300003859Freshwater Lake SedimentMNLLRMRCYGDDRNHSSSGAIIPENPVSARCFLMDISFKDLFPVGAFERAKFMCVQRGMAQVGFEKPQAFSDDFKGIFFRGIILNLPKICVGLGGENQFVHGILFSMPGERSAFDGSLLRKAGQDFP*
Ga0065183_1023049313300004113Pelagic MarineVRCYRDDRNHSSLRSIIPENPVGTRCFLLGVCLEDLFPIGPFEGSKFVGVQRRMTEVGFKKPKTFPDSLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGKGSAFDRSHL
Ga0068713_110305813300005145Enrichment CultureMGFSGMRCYGDDRNHSFPRAVIPEDPVGSRSFLLDIRLEDLFSVRPFERPKFVRLQRRMAQVGFKKLQAFPEGFKNIPLRGIVFNLSKVRVGLGGKNQFVHRLLFSVPGKRCAFNGSLLRKS
Ga0068712_109070123300005252Enrichment CultureMKLSGMRCYGGGRNHSSLRAIIPEDPVGARGFLLGICLEDLFPVRPIEGSKFVLVQRGMPQVGFKKPQAIPEGFKNIPLRGIVFNLSKVRVGLGGK
Ga0070728_1008725723300005588Marine SedimentVRCYRDDRNHSSLRSIIPENPVGTRCFLLGVCLEDLFPIGPFEGSKFVGVQRRMTEVGFKKPKTFPDSLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGKGSAFDRSHLR*
Ga0074472_1068324513300005833Sediment (Intertidal)DRDHSPLRAVIPEDPVGSWSFLLDIRLEDLFPVRAFERPKFVRLQRRMAQVGFKKPQTFLEGFKNIPLRGIVFNLPKVGVGLGGENQFVHRLLFSVPGERSALNGSLLRKPGQDFL*
Ga0075115_1001751723300005917Saline LakeMRCYGDDRNHSSLRAIIPEDPVGTRCFLLGICLEDFFPVRSFEGSKFVRVQRGMPQVGFKKPKTFPDGFEDILLRRVVFNLPKIGVGLGRENQFMHGALFGVLGKRSAFNRSHLR*
Ga0079037_10191386413300006224Freshwater WetlandsMEGEKKETASRKHFMSLLRMGCYGDDRDHSSLRAVIPKDPAGSWCFLLDISFKDLFPVRSFERTKFMCVQRRMAEVGFEKPQAFSNGFKGIFLSGIVLNLPKICVG
Ga0105106_1062142313300009078Freshwater SedimentMSLLRMRGYGDDRNHSSPWAVIPENPIGSWCFLLDISLENLFPVRPFQRPKFVRLQRRMAQVRLKKPQAFPDGFKNIPLRGIVFNLPKVGVGLRRENQFVHRLLFGVPGERSATNGSLLRKPCQDFLQGVLIFEKPSLLDRYLQHGFQHNS
Ga0105107_1014865913300009087Freshwater SedimentMSLLRMRGYGDDRNHSSPWAVIPENPIGSWCFLLDISLENLFPVRPFQRPKFVRLQRRMAQVRLKKPQAFPDGFKNIPLRGIVFNLPKVGVGLRRENQFVHRLLFGVPGERSALDGSLLRKPGQDFS*
Ga0114919_1015586513300009529Deep SubsurfaceRCYGDDCDHSSFRAIIPEDPVGARGFLLGIYLEDLFPVRTFEGPKFVRVQRGVPQVGFKKSQAFPDSLEDMPFRGIVFYLPKVGVGLSCENQFVHR*
Ga0129298_1055126813300010328Lake SedimentMGGEKKESASRKHFMSLLRMGCYGDDRYHSSLRAVIPEDPVGSWCFLLDISFKDLFPVRSFERTKFMCVQTRMAEVGFEKPQTFSDAFKGIFLSGIVLYLPKICVGLG
Ga0187877_103593613300017931PeatlandLRGSGFMSLSGMRYYGDDRNHSSLRAIIPEDPVGPRCFLLGICLEDLFPVRSFEGSKFVRVQRGMPQVGLKKPQAFPDGFEDIPLRGVVFNLPKVGIGLGCEN
Ga0187854_1000589463300017938PeatlandMSLSGMRYYGDDRNHSSLRAIIPEDPVGPRCFLLGICLEDLFPVRSFEGSKFVRVQRGMPQVGLKKPQAFPDGFEDIPLRGVVFNLPKVGIGLGCEN
Ga0187786_1025571723300017944Tropical PeatlandMGCYGDDGNHSSLRAVIPEDPVGSWSFLLDIRLEDLFPVRAFERPKFVRLQRRMAQVGFKKSQAFPEGFKSIPLRGIVFNLPKVGVGLGGENQFEHRFLFSVPGERSALNGSLLRKPGQDLL
Ga0180431_1044763623300017987Hypersaline Lake SedimentMRCYGGDRDHSFFRPIIPEDPVGARGFLLDICLEDLFPVRTSERSKFVHVQRGVPQVGFKKSQAFPHRFEDMPLRGIVFNLPKVRV
Ga0180431_1062406413300017987Hypersaline Lake SedimentMRCYGDDRNHSSLRSIIPEHPVGTRCFLPGVCLEDLFPIRPFERSKFVGIQRRMAEVGFKKPKTFPDGFEDILFRRVVFNLSKVSVSLGRENQFMHGSLFDVLSEGSAFDRPHLG
Ga0187857_1005339043300018026PeatlandMSLSGMRYYGDDRNHSSLRAIIPEDSVGPRCFLLGICLEDLFPVRPFEGSKFVRVQRGMPQVGLKKPQASPDGFEDIPLRGVVFNLPKVGIGLGCEN
Ga0187869_1002876633300018030PeatlandMSLSGMRYYGDDRNHSSLRAIIPEDPVGARCFLLGICLEDFFPVRPFEGSKFVRVQRGMPQVGLKKPQAFPDGFEDIPLRGVVFNLPKVGIGLGCEN
Ga0184616_1003533213300018055Groundwater SedimentLSGMGCYGNDRNHSSPGAIIPENPVGARCFLLDISFKDLFPVRPFERTKFMCVQRGMAEVGFEKPQAFSDGFKGIFLRGIVLNLPKICVGLGCENQFVHGLLFSTLAERSAFDGSLLRKPGQDFP
Ga0184616_1024518113300018055Groundwater SedimentMSLSGMRCYGNDRNHSSLRAIIPEDPAGTRCSLLGICLEDFFPIRPFEGLKFVRVQRGMPQVGFKKPEAFPDGFEDIPLRGVVFNLPKVGIGLGCENQFVHRSLFGVLGKRSALDGSLLRKPGEDFL
Ga0184636_112927723300018068Groundwater SedimentMSLSGMRCYGDDRNHSSLRAIIPEDPVGARCFLLGICLEDLFPVRPFEGSKFVRVQRGMPQVGFKKPQAFPDGFEDIPLRGVVFNLPKVGVGLGCEDQFVHRSLFGVLGKRSALDGSLLRKPGEDFL
Ga0184636_133366613300018068Groundwater SedimentPVGSWCFVLDIRLKNLFPVRPLERPKFVRLQRRMAQVGFKEPQAFPDGFENIPLRGIVSNLAKVGVGLGCESQFVHLLLFGVPGERSAINGSLLRKPGQDFL
Ga0184631_1000676353300018070Groundwater SedimentMSLLRMRCYGDDRDHSSLRAVIPEDSIGSWCFLLDIRLEDLFPVRRFERPKFVRLQRRVMQVGFKKPQAFPEGFKNIPLRGIVFNLPKVGVGLGGEN
Ga0184631_1003379143300018070Groundwater SedimentMSLSGMRCYGDDRNHSSLRAIIPEDPVGARCFLLGICLEDLFLVRPFEGSKFVRVQRGMPQVGFKKPQAFPDGFEDIPLRGVVFNLPKVGVGLGCEDQFVHRSLFGVLGKRPALDG
Ga0184631_1005910043300018070Groundwater SedimentMSLSGMRCYGDDRNHSSLRAIIPEDPVGARCFLLGICLEDLFPVRPFEGSKFVRVQRGMPRVGFKKPQAFPDGFENIPWRGGVFNLPKVGVGLGCEDQFVHRSLFGVLGKRSALDGSLLRKPGEDFL
Ga0210365_1078905033300021351EstuarineRSYFMTLSGMRCYRDDSNHSSLRSIIPENPVGTRRFLLGICLEDLFPIRSFEGSKFVGVQRRMTEVGFKKPKTFPDSLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGKGSAFDRSQLR
Ga0224498_1010118123300022202SedimentMSLSGVRCYRDDRNHSSLRSIIPENPVGTRCFLLGVCLEDLFPIGPFEGSKFVGVQRRMTEVGFKKPKTFPDSLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGKGSAFDRSHLR
Ga0224514_1002554113300022217SedimentMSLSEVRCYRDDRNHSSLRSIIPENPVGTRCFLLGVCLEDLFPIGPFEGSKFVGVQRRMTEVGFKKPKTFPDSLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGKGSAFDRSHLR
Ga0212121_1022767933300022556Anoxic Lake WaterMSLSWVRCYGDDRNHSSLGAIIPEDPVGAGCFLLGICLEDLFPVRALEGSKFVRVQRGMPQVGFKKPQAFPDRFEGIFLRGIFFNRPKVGIGLRGEDQFVHRSLFGVLGKRSPLDGAL
(restricted) Ga0233404_1007251813300022913SeawaterGGSSFLVTARKWLYEPSGMRCYGDDRNYSFLRAIIPEDSVGARCFLLSICLEDLFPIRPLEGSKFVGVQRRMTEVGFKKPKTFPDSLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGKGSAFDRSHLR
(restricted) Ga0233409_1009254333300022938SeawaterVKRRKGAVLFLVTARKWLYEPSGMRCYGDDRNYSFLRAIIPEDSVGARCFLLSICLENLFPFRPFEGSKFVCVQRGVPQVGFKQPKAFPDGFEDIFLRRVIFNLPK
(restricted) Ga0233408_1003136623300023089SeawaterVRCYRDDRNHSSLRSIIPENPVGTRCFLLGVCLEDLFPIGPFEGSKFVGVQRRMTEVGFKKPKTFPDSLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGKGSAFDRSHLR
(restricted) Ga0233412_1000446633300023210SeawaterMRCYRDDRNHSSLRSIIPENPVCTRCFLLGVCLEDLFPLRPFERSKFVGVQRRMAEVGFKKPKTFPDGLEDILFRRVVFNLLKVSVGLGRENQFMHGSLFDVLGKGSAFDRPHLR
(restricted) Ga0233412_1048845413300023210SeawaterMRCYGDDRNYSFLRAIIPEDSVGARCFLLSICLENLFPFRPFEGSKFVCVQRGVPQVGFKQPKAFPDGFEDIFLRRVIFNLPKIDVGLGRENQFVHRSLFGVLGKRAALDRSL
(restricted) Ga0255040_1036011913300024059SeawaterMSLSGVRCYRDDRNHSSLRSIIPENPVGTRCFLLGICLEDLFPIRPFEGSKFVGVQRRMTEVGFKKPKTFPDGLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGKGSAFDRSHLR
Ga0209991_1024934623300024429Deep SubsurfaceMRCYGDDRDHSPFRAIIPEDPVGARGFLLGICLEDLFPVRTFEGPKFVRVQRGVPQVGFKKSQAFPDGFEDMSLRGIVFNLPKVGVGLGCENQFVHR
Ga0209977_1038051123300024432Deep SubsurfaceMRCYGDDRDHSSFRAIIPEDPVGARGFLLGICLEDLFPIRTFEAPKFVRVQRGVPQVGFKKSQAFPDGFQDMPLRGIVFNLAKVSVGLGCENQFVHR
(restricted) Ga0255044_1045897513300024529SeawaterVRCYRDDRNHSSLRSIIPENPVGTRCFLLGVCLEDLFPIGPFEGSKFVGVQRRMTEVGFKKPKTFPDSLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGKGSAFDRS
Ga0209334_102433300024997SoilMSLLRVRCYSDDRDHSSLRTVIPEDPVGSWCFLLDIRLEDLFPVRPFERPKFVRLQRGMAQVGFKKPQAFPDGFKNIPLRGIVFNLPKVGVGLRRENQFVHRLLFSVPGERSALDGSLLRKPGQDFL
Ga0210024_112882623300025031AquiferMNLLRMRCYGDDRDHSPLRAVIPEDPVGSWCFLLDIRLVDLFPVRPFERPKFVRFQRRMAQIGFKEPQAFPDGFKNIPLRGIVFNLPKVGVGLGCENQFVHRLLFSVPGERSAFD
Ga0210049_105034423300025036GroundwaterMNLLRMRCYGDDRDHSPLRAVIPEDPVGSWCFLLDIRLVDLFPVRPFERPKFVRLQRRMAQIGFKEPQAFPDGFKNIPLRGIVFNLPKVGVGLGCENQFVHRLLFSVPGERSAFD
Ga0210044_1003631973300025288GroundwaterMNLLRMRCYGDDRDHSPLRAVIPEDPVGSWCFLLDIRLVDLFPVKPFERPKFVRFQRRMAQIGFKEPQAFPDGFKNIPLRGIVFNLPKVGVGLGCENQFVHRLLFSVPGERSAFD
Ga0210004_111990223300025811GroundwaterLRMRCYGDDRDHSPLRAVIPEDPVGSWCFLLDIRLVDLFPVRPFERPKFVRLQRRMAQIGFKEPQAFPDGFKNIPLRGIVFNLPKVGVGLGCENQFVHRLLFSVPGERSAFD
Ga0209703_124175523300027723Freshwater SedimentSGQEKGTANRKHFMSLLRMRGYGDDRNHSSPWAVIPENPIGSWCFLLDISLENLFPVRPFQRPKFVRLQRRMAQVRLKKPQAFPDGFKNIPLRGIVFNLPKVGVGLRRENQFVHRLLFGVPGERSALDGSLLRKPGQDFP
Ga0209703_132524523300027723Freshwater SedimentDRDHSSLSTVIPEDPVGSWCFLLDIRLEDLFPVRPFERPKFVRLQRRMAQVGFKKPKAFPDGFKNISLRGIVFDLPKVGVGLGRENQFVHRLLFSVPGERSALDGSLLRKPGQDFL
Ga0214474_102133143300027740SoilMSLSGMRCYGDDRNHSSLRAIIPEEPVGARCFLLGICLEDLFPVRPFEGSKFVRVQRGMPQVGFKKPQAFPDGFEDIFLRGNFFNCPKVVIGLRGEDQ
Ga0214474_120608923300027740SoilMGCYGDDRDHSSLRAVIPEDPVGSWCFLLDIRLKDFFPVWPFERPKFVRLQRGMAQVGFKKPQAFPDGFKNIPLRGILFNLPKVGVGLGCENQFVHRLLFSVPGERSALNGTLLRKPGQDFL
Ga0209379_1013677623300027758Marine SedimentSYFLTNYEWWISVYSMSLSGMRCYGDDRNHSALRAIIPEDPVGTRCFLLGICLEDLFPIRPFEGSKFVGVQRRMTEVGFKKPKTFPDSLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGKGSAFDRSHLR
Ga0209273_1034309023300027790Marine SedimentMSLLGVRCYRDDRNHSSLRSIIPENPVGTRCFLLGVCLEDLFPIGPFEGSKFVGVQRRMTEVGFKKPKTFPDSLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGKGSAFDRSHLR
Ga0209287_1017681723300027792Freshwater SedimentMRCDSDNRDPVLLRSVIPEDPIGARCFLLGICLEDLFSVRPFEGAKFMRVQRGMSQVGFKKPQAFPDGFENIPLRGVVFNFPKVGVGLGCKDQFLHRSLFGVLGKRSALNGSLLRKPGEHLL
Ga0256868_1001982723300027811SoilMSLSGMRCYGDDRNHSSLRAIIPEEPVGARCFLLGICLEDLFPVRPFERSKFVHVQRGMPQVGFKKPQAFPDGFEDIPLRGVAFNLPKVGVGLGCEDQFVHRSLFGVLGKRSALDGSLLRKPGEDFL
Ga0256868_1007559433300027811SoilMSLSWVRCYGDDRNHSSLRAIIPEDPVGAGCFLLGICLEDLFPVRPFEGSKFVRVQRGMPQVGFKKPQAFPDGFEDIFLRGNFFNCPKVVIGLRGEDQFVHRSLFGVLGKRSALDGALLRESGEDFL
Ga0208980_1027128813300027887WetlandMSHTGLLRMRCYGDDRDHSPLRAVIPEDPVGSWSFLLVIGVEDFFPVRAFERPKFVRLQRRMAQVGFKKSQAFPEGFKKIPLRGIVFNLPKVGVGLGGENQFVHRLLFSVPGERSALNGSLLRKPGQDFL
Ga0209777_1014623153300027896Freshwater Lake SedimentMSLSGMRCYGDDRNHSSLRAIIPEDPVDARCFLPGICLEDPLPVKPFEGSKFVRVQRRMPQVGLKKPQAFPDGFEDIPLRGVLFNLPKVGVGLGCEN
Ga0209253_1005363823300027900Freshwater Lake SedimentMRCYSNDRDHSSLRAVIPEDPVGSWSFLLDIRLEDLFPVRPFERPKFVRLQRRMAKVGFKKPQAFPEGFKNIPLRVIFFNLSKVGVGLGCENQFVHRLLFSVLGERSALNGSLLRKPGQNFL
Ga0209253_1011327033300027900Freshwater Lake SedimentMSLLRMGCYGDDRDHSSLRAVIPKDPVGSWCFLLDISFKDLFPVRPLERPKFVRLQRGMAQVGFKKPQAFPDGFKNIPLRGIVFNLPKICVGLGCENQLVHGLLFSAFGERSALDGSLLRKPRQDFS
Ga0209253_1031439323300027900Freshwater Lake SedimentAVIPEDPVGSWCCLLDIRLENLFPVRPFERPKFMRLQRRMAQVGFKEPQAFPDGFENIPLRGIVSNLSKVGVGLGCENQFMHLLLFGVPGERSATDGSLLRKPGQDFL
Ga0209253_1033216133300027900Freshwater Lake SedimentAVIPEDPVGSWCCLLDIRLENLFPVRPFERPKFVRLQRRMAQVGFKEPQAFPDGFKKIPLRGIVFNLPKVGVGLGCENQLVHRLLFSVSGERSAINGSLLRKPGQDFL
Ga0209253_1074768113300027900Freshwater Lake SedimentNHSSLRPIIPEDPVGDRCFLLGIGLEDLFPVRAFEGSKFVRVQRWMPRVGFKKAQAFPDGFENIPLRRVIFNLPKVGVGLGCEDQFVHRFLFGVLGKRSALDGSLLRKPGEDFF
Ga0209536_10235528823300027917Marine SedimentLTRLSGVRCYRDDRNHPSLRSIIPENPVGTRCFLLGVCLEDLFPIGPFEGSKFVGVQRRMTEVGFKKPKTFPDSLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGKGSAFDRSHL
Ga0209475_1008111513300027980Marine SedimentMSLSGVRCYRDDRNHSSLRSIIPENPVGTRCFLLGVCLEDLFPIGPFEGSKFVGVQRRMTEVGFKKPKTFPDSLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGKGSVFDRSHLR
(restricted) Ga0233414_1000698653300028045SeawaterMRCYRDDRNHSSLRSIIPENPVCTRCFLLGVCLEDLFPLRPFERSKFVGVQRRMAEVGFKKPKTFPDGLEDILFRRVVFNLSKVSVGLGRENQFMHGSLFDVLGKGSAFDRPHLR
Ga0265595_110969413300028191Saline WaterMRCYRDDRNHSSLRSIIPENPVGTRCFLLGICLEDLFPIRPFERSKFVGVQRRMAEVGFKKPKTFPDDLQDILFRRVVFNLSKVSVGLGRENQFMHGSLFDVFGK
Ga0210366_1043839523300028420EstuarineDEFLMSLSGVRCYRDDRNHSSLRSIIPENPVGTRCFLLGVCLEDLFPIGPFEGSKFVGVQRRMTEVGFKKPKTFPDSLEDILFRKVVFNLPKVSVGLGRENQLMHGSLFDVLGKGSAFDRSHLR
Ga0265306_1078473213300028598SedimentVRCYRDDRNHSSLRSIIPENPVGTRCFLLGVCLEDLFPIGPFEGSKFVGVQRRMTEVGFKKSKTFPDSLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGKGSAFDRSHL
Ga0265303_1090184223300028600SedimentVRRLEVRGRKTDDWDEFLMSLSGVRCYRDDRNHSSLRSIIPENPVGTRCFLLGVCLEDLFPIGPFEGSKFVGVQRRMTEVGFKKPKTFPDSLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGKGSAFDRSHLR
Ga0299915_1005607033300030613SoilLSGMGCYGNDRNHSSPGAIIPENPVGARCFLLDISFKDLFPVRPFERTKFMCVERGMTEVGFEKPQAFSDGFKGIFLRGIVLNLPKICVGLGCENQFVHGLLFSTLGERSAFNGSLLRKPGQDFP
Ga0299915_1044584323300030613SoilMSLSGMRCYGDDRNHSSLRPIIPEDPVGTGCFMLGVCFEALFPVRPFKGSEFVRVQRGMSPVGFKKPQAFPDGFENIPLRRVVFNLAEVGIGLGCENQFGHRSLFGILGKRSALDGSLLRKPGEDFL
Ga0307380_10008820133300031539SoilMRCYGDDRDHSSFRAIIPEDPVGARGFLLGICLEDLCPVRTFEGSKFVRVQRGVPQVGFKKSQAFPDGFEDMPLRGIVFNLPKVGVGLGCENQFVHR
Ga0315534_110527013300031585Salt Marsh SedimentVSMSGMRCYGDDRNQSSLGAIIPEDSVGAGCFLLSICLEDLFPVRTFEGSKFVRVQRGVPQVGFKKSQAFPDGFEDMPLRGIVFDLPKVGVGLGCENQFVHR
Ga0315541_114968523300031586Salt Marsh SedimentMSLSGMRCYGDDRDRSSFRAIIPEDPVGARGFLLGICLEYLSPVRTFEGSKFVRVQRGVAQVGFKKSQAFPDGFEGMPLRGIVFNLPKVGVGLGCENQFVHR
(restricted) Ga0315307_100821313300031593SedimentAVIPEDPVPSWSFLLDIRLEDLFPVRHFERPKFVRLQRRMAQVGFKKPQAFPEGFKNISLRGIVFNLPKVGVGLGGENQFVHRLLFSVPGERSALNGSLLRKPGHDFL
Ga0307377_1014293733300031673SoilMRCYGDDRDHSSFRAIIPEDPVGARGFLLGICLEDLCPVRTFEGSKFVRVQRGVPQVGFKKSQAFPDGFEDMPLRGIVFNLPKVGVGLGCENQF
Ga0307377_1043991423300031673SoilFIRDYLASGFMSLSGMRCYGDDRDHSSFRAIIPEDPVSARGFLLGICLEDLFPVRTSEGSKFVRVQRTVPQVGFKKSQAFPDSFEDMPLRGIVFNLPKVGVGLGCENQFVHR
Ga0315537_107181113300031698Salt Marsh SedimentVEKKHRAEKNSSFMSLSGMRGYGDDRNHSSLRAIIPEDPVGTRCFLLRICLEDLFPIRTFEGSEFVRVQRGVSQVGFKKPKTFPDSFEDILLRRVFFDLPKVGIGLRSENQFMHGSLFGVLGKRCAFDRSNLR
Ga0315291_1019927553300031707SedimentMSLSWVGCYGDDRNHSSLRAIIPEDPVGAGCFLLGICLEDLFPVRPFEGSKFVRVQRGMPQVNFKKPQAFPDGFEGIFLREIFFNRPKVGIGLRGEGQFVHGSLFGVLGKRSALDGALLRESGEDFL
Ga0315291_1123090313300031707SedimentMSLSGMRCYGDDRNHSSLRAIIPEDPAGTRCSLLGICLEDLFPIRPFEGSKCVRVQRGMPQVGFKKPEAFPDGFEDIPLRGVVFNLPKVGVGLGCEDQFVHRSLFGVLG
Ga0315293_1032481533300031746SedimentMGCYGNDRNHSSPGAIIPENPVGARCFLLDISFKDLFPVRPFERTKFMCVQRGMAEVGFEKPQAFSDGFKGIFLRGMVLNLPKICVGLGCENQFVHGLLFSTLGERSAFDGSLLRKPGQDFP
Ga0315293_1043134513300031746SedimentMSLSGMRCYGDDRNHSSLRAIIPEDPAGTRCSLLGICLEDLFPIRPFEGSKCVRVQRGMPQVGFKKPEAFPDGFEDIPLRGVVFNLPKVGIGLGCENQFVHRSLFGVLGKRSALDGSLLRKPGEDFL
Ga0315293_1078642133300031746SedimentMSLSWVGCYGDDRNHSSLRAIIPEDPVGAGCFLLGICLEDLFPVRPFEGSKFVRVQRGMPQVNFKKPQAFPDGFEGIFLREIFFNRPKVGIGLRGEGQFVHGSLFGVLGK
Ga0315288_1063948113300031772SedimentMSLLRMRCYGDDRDHSSLRAVIPEDPVGSWCFLLDIRLEDLFPVRPFERPKFVRLQRRMAQVGFKEPQAFPDGFENIPLRGIVSNLPKVGVGLGCENQSVHLLLFGVPGERSSTDGSLLRKPGQDFL
Ga0315288_1067246423300031772SedimentMSLSGMRCYGDDRNHSSLRAIIPEDPVGARCFLLGICLEDLFPVRPFEGSKFVRVQRGMPQVGFKKPQAFPDGFEDIPLRGGFFNLPKVGVGLGCEDQFVHRSLFGVLGKRSALDGSLLRKPGEDFL
Ga0315290_1005018033300031834SedimentLARGLQFISLSGMRCYGDDRNHSSLRAIIPEDPIGTRCFLLGVCFEDLFTVRPFKGTKFMRVQGGMSQVGFKKPQAFPDGFENIPLRRVVFNLPEIGVGLGCEDQLRHRSLFGVLRKRSALDGGFLRKPGEDFL
Ga0315290_1133544413300031834SedimentMRRYGDDRNHSSLGSIIPEDPVGARCFLLGIGLEDLFPVRAFEGLKFVRVQRWMPRVGFKKTQAFPDGFENIPLRGVIFNFPEVGVGLGCEDQFMHR
Ga0315290_1158736513300031834SedimentMNLLRMRCYGDDRDHSPLRAVIPEDPVGSWCCLLDIRLENLFPVGPFERPEFVCLQRGMAQVGFKEPQAFPYGFENIPLRGIVSNLPKVGVGLGCKNKSVHLLLFGVPGERSSTDGSLL
Ga0315280_1024543313300031862SedimentMNLLRMRCYGDDRDHSPLRAVIPEDPVGSWCFLLDIRLEDLFPVRPFERPKFVRLQRRMAQIGFKEPQAFPDGFKNIPLRGIVFNLPKVGVGLGCENQFVHRLLFSVPGERSTFD
Ga0315280_1024613423300031862SedimentMNLLRMRCYGDDRDHSPLRAVIPEDPVGSWCFLLDIRLVDLFPVRPFERPKFVRLQRKIGFKEPQAFPDGFKNIPLRGIVFNLPKVGVGLGCENQFVHRLLFSVPGERSAFD
Ga0315297_1034262623300031873SedimentMNLLRMGCYGDDRNHSSSGAIIPENPVSARCFLMDISFKDLFPVGAFERAKFMCVQRGMAQVGFEKPQAFSDDFKGIFFRGIILNLPKICVGLGGENQFVHGILFSMPGERSAFDGSLLRKAGQDFP
Ga0315297_1042880423300031873SedimentLARGLQFISLSGMRCYGDDRNHSSLRAIIPEDPIGTRCFLLGVCFEDLFTVRPFKGTKFMRVQGGMSQVGFKKPQAFPDGFENIPLRRVVFNLPEIGVGLGCEDQLRHRSLFGVLRKRSALNGGFLRKPGEDFL
Ga0315297_1124590923300031873SedimentMSLLRMRCYGDDRDHSSLRAVIPEDSIGSWCFLLDIRLEDLFPVRPFERPKFVRLQRRMVQVGFKKPQAFAEGFKNIPLRGIVFNLPKVGVGLGCEN
Ga0315285_1009855753300031885SedimentMRRYGDDRNHSSLRSIIPEDPVGGRCFLLGIGLEDLFPVRAFEGSKFVRVQRWMPHVGFKKAQAFPDGFENIPLRGVIFNLPKVGVGLGCEDQFVHRFLFGVLGKRSALDGSLLRKPGEDFF
Ga0315285_1056473813300031885SedimentMSLSGMRCYGDDRNHSSLRAIIPEDPIGTRCFLLGVCFEDLFTVRPFKGTKFMRVQGGMSQVGFKKPQAFPDGFENIPLRRVVFNLPEIGVGLGCEDQLRHRSLFGVLRKRSAL
(restricted) Ga0315312_104058323300031898SedimentMLERWASGKVARYETRGTGCRGWGGVKKKETANRKHFMSLLGVRCYGDDGNHSSPGAIIPKNPVGARCFLLGIGFKDLFPVRPFERPKFVRLERRMAQVGFKKPQAFPDGFKNIPLRGIVFNLPKVRIGLGCENQFVHRLLFSMPGERSAINGSLLRKPGEDFL
Ga0214473_1070433723300031949SoilMRCYGDDRDHSSLRAVIPEDPVGTRCFLLDISFKDLFPVRPFEGTKFMCVQRRMAKVGFKKPQAFSDGFKGISLRGIVLNLPEICVGLGCENQFVHGLLFSTFAERSALDGSLLRKPGEDFP
Ga0214473_1073865333300031949SoilMSLAGMRCYGDDRNHFPLRAIIPEDPVGARCFLLGICLEDLFPVRPFEGSKFVRVQRGMPQVGFKKPQAFPDGFEDIPLRRVVFNLPKVGVGLGCEDQFVHRSLFGVLGKRSALDGSLLRKPGEDFL
Ga0214473_1155344523300031949SoilDGVKKKETANRKNVMRLLRMRCYGDDCDHPFLRAVIAEDPVGSWSFLLDIRLEDLFPVRPFERPKFVRLQRRMAQVGFKKPQAFPEGFKNIPLRGIVFNLPKVGVGLGGENQFVHRLLFSVPGERSALNGSLLRKPGQDFL
Ga0214473_1185772713300031949SoilMSLSGMGCYGKDGDHSSLRTVIPEDPVGAWCFLLGICLKNLFSVRTLEGSKFMRVQGWVSEIGFKKPQTFSDGFENIPLRRIVFKLSQVGIGLKGEKQFVHRPLFGVFGKRSAL
Ga0315294_1028745313300031952SedimentMRRYGDDRNHSSLRSIIPEDPVGARCFLLGIGLEDLFSVRAFEGSKFVRVQRWMPHVGFKKAQAFPDGFENIPLRGVIFNLPKVGVGLGCEDQFVHRFLFGVLGKRSALDGSLLRKPGEDFF
Ga0315294_1039760033300031952SedimentMSLSGMRCYGDDRNHSSLRAIIPEDPIGTRCFLLGVCFEDLFTVRPFKGTKFMRVQGGMSQVGFKKPQAFPDGFENIPLRRVVFNLPEIGVGLGCEDQLRHRSLFGVLRKRSALDGGFLRKPGEDFL
Ga0315294_1075833023300031952SedimentMGCYGNDRNHSSPGAIIPENPVGARCFLLDISFKDLFPVRPFERTKFMCVQRGMAEVGFEKPQTFSDGFKGIFLRGIVLNLPKICVGLGCKNQFVHGLLFSTLGERSAFDGSLLRKPGQDFP
Ga0315278_1019473413300031997SedimentLARGLQFISLSGMRCYGDDRNHSSLRAIIPEDPIGTRCFLLGVCFEDLFTVRPFKGTKFMRVQGGMSQVGFKKPQAFPDGFENIPLRRVVFNLPEIGVGLGCEDQLRHRSLFGVLRKRSALNGGFLRKPGE
Ga0315278_1032928833300031997SedimentMRRYGDDRNHSSLGSIIPEDPVGARCFLLGIGLEDLFPVRAFEGLKFVRVQRWMPRVGFKKTQAFPDGFENIPLRGVIFNFPEVGVGLGCEDQFMHRFLFGVLGKRSALDGSLLRKPGEDFF
Ga0315278_1093292433300031997SedimentMSLLRMRCYGDDRDHSSLRAVIPEDSIGSWCFLLDIRLEDLFPVRPFERPKFVRLQRRMAQVGFKKPQAFPDGFKNIPLRGIVFNLPKVGVGLGGENQFVHRLLFSVPGERSALNGSLLRKPGQDFL
Ga0315274_1094315223300031999SedimentMGCYGNDRNHSSPGAIIPKNPVGARCFLLDISFKDLFPVRLFERTKFMCVQRGMAEVGFEKPQAFSDGFKGIFLRGITLNLPKICVGLGCENQFVHGLLFSTPGERSAFDGSLLRKPGQDSL
Ga0315274_1097586833300031999SedimentMSLLRMRGYGDDRDHSSLRAVIPEDPVGSWCFLLDIRLEDLFPVRPFERPKFVRLQRRMAEVGFKKPQAFPDGFKNIALRGIVSNLPKVGVGLGCENQFVHRLLFSV
Ga0315296_1034037343300032020SedimentHSSLRAIIPEDPVGARCFLLGICLEDLFPVRPFEGSKFVRVQRGMPQVGFKKPQAFPDGFEDIPLRGVVFNLPKVGVGLGCEDQFVHRSLFGVLGKRSALDGSLLRKPGEDFL
Ga0315284_1087484223300032053SedimentMSLSGMRCYGDDRNHSSRRAIIPEDPVGARCFLLGICREDLFPVRLFEGSKFVRVQRGMPQVGFKKPQAFPDGFEDIPLRGGFFNLPKVGVGLGCEDQFVHRSLFGVLGKRSALDGSLLRKPGEDFL
Ga0315284_1104925543300032053SedimentMRRYGDDRNHSSLRSIIPEDPVGARCFLLGIGLEDLFPVRAFEGSKFVRVQRWMPHVGFKKAQAFPDGFENIPLRGVIFNLPKVGVGLGCEDQFVHRFLFGVLGERSALDGSLLRKPGEDFF
Ga0315284_1115525223300032053SedimentMGCYGNDRNHSSPGAIIPKNPVGARCFLLDISFKDLFPVRPFERTKFMCVQGGMAEVGFEKAQAFSDGFKGIFLRGIVLNLPKICVGLGRENQFVHGLLFSTLGERSAFDGSLLRKPGQDFP
Ga0315551_1024982723300032062Salt Marsh SedimentWFIRDYLASGFMSLLGMRCYGHDRDHSSFRAIIPEDPVGARGFLLGICLEDLFPVRTFERSKFVRVQRGMPQVGFKKSQAFPDGFQDMPLRGIVFNLPKVGVGLGCENQFVHR
Ga0315282_10006485193300032069SedimentMGCYGDDRDHSPLGAVIPEDPVGSWCFLLDIRLENLFPVRPFERPKFVRLQRRMVQVGFKEPQAFPDGFENIPLRGIVSNLPKVGVGLGCENQFVHLLLFNVPGERSASDGSLLRKAGQDFL
Ga0315282_1005035153300032069SedimentMRCFGNDRNHSSPGAIIPKNPVGARCFLLDISFKDLFPVRPFERTKFMCVQRGMAEVGFEKPQAFSDGFKGIFLRGIVLNLPKICVGLGCENQLVHGLLFSTPGERSAFDGSLLRKPGQDSL
Ga0315282_1006103283300032069SedimentMSLSWVGCDGDDRNHSSLRAIIPEDPVGAGCFLPGICLEDLFPVRPFEGSKFVRVQRGMPQVGFKKPQAFPDGFEDIFWRGIFFNRPKVGIGLRGEDQFVHRSLFGVLGKRSALDGALLRESGEDFL
Ga0315282_1030183123300032069SedimentMNLLRMRCYGDDRDHSPLRAVIPEDPVGSWCFLLDIRLEDLFPVRPFERPKFVRLQRRMAQIGFKEPQAFPDGFKNIPLRGIVFNLPKVGVGLGCKNQFVHRLLFSVPGERSAFD
Ga0315279_1062440213300032070SedimentGARCFVLGICLEDLFPVRPFEGSKFVRVQRWMPRVGFKKPQAFPDGFENIPLRGVVFNLPKVGVGLGCEDQFVHRSLFGVLGKRSALDGSLLRKPGEDFL
Ga0315279_1062655413300032070SedimentMSLSEMRCYGDDRNHSSLRAIIPEDPVGARCFLLGICREDLFPLRPFEGSKFVRVQRWMPRVGFKKPQAFPDGFENIPWRGGVSNLPKVGVGLGCEDQFVHRSLFGVLGKRSTLDGSLLRKPGEDFL
Ga0315277_1019603233300032118SedimentMGCYGNDRNHSSPGAIIPKNPVGARCFLLDISFKDLFPVWPFERTKFMCVQRGMAEVGFEKPQAFSDGFKGIFLRGITLNLPKICVGLGCENQFVHGLLFSTPGERSAFDGSLLRKPGQDSL
Ga0315277_1064789013300032118SedimentMSLLRMGCYGDDRDHSSLRAVIRKDPVGSWCFLLDINFKDLFPVRPFERTKFMCVQRRMAEVGFEKPQTFSEGFKGIFLSGIVLNLPKICVGLGCENQLVHGLLFRAFGERTALDGSLLRKPGQDFL
Ga0315277_1174369413300032118SedimentMRRYGDDRNHSSLRSIIPEDPVGARCFLLGIGLEDLFPVRAFEGSKFVRVQRWMPHVGFKKAQAFPDGFENIPLRGVIFNLPKVGVGLGCEDQFVHRFLFGVLGKRSAL
Ga0315292_1011019333300032143SedimentMRCYGDDRNHSSLRAIIPEDPIGTRCFLLGVCFEDLFTVRPFKGTKFMRVQGGMSQVGFKKPQAFPDGFENIPLRRVVFNLPEIGVGLGCEDQLRHRSLFGVLRKRSALNGGFLRKPGEDFL
Ga0315292_1014981913300032143SedimentMRRYGDDRNHSSLRSIIPEDPVGARCFLLGIGLEDLFSVRAFEGSKFVRVQRWMPHVGFKKAQAFPDGFENIPLRGVIFNLPKVGVGLGCEDQFVHRFLFGVLGERSALDGSLLRKPGEDFF
Ga0315292_1024666623300032143SedimentVFPLPDPDPKVGGYVTSLSGMGCYGNDRNHSSPGAIIPKNPVGARCFLLDISFKDLFPVRPFERTKFMCVQRGMAEVGFEKAQAFSDGFKGIFLRGIVLNLPKICVGLGRENQFVHGLLFSTLGERSAFDGSLLRKPGQDFP
Ga0315295_1015634333300032156SedimentMGCYGDDRNHSSLGAIIPKNPVSARCFLMDISFKDLFPVRAFERAKFMCVQRGMAQVGFEKPHAFSDDFKDIFFRRIILNLPKICVGLGGENQFVHRMLFSMPGERSAFDGSLLRKPGQDFP
Ga0315295_1022150233300032156SedimentMGCYGNDCNHSSPGAIIPENPVGARCFLLDISFKDLFPVRPFERTKFMCVQRGMAEVGFEKPQAFSDGFKGIFLRGMVLNLPKICVGLGCENQFVHGLLFSTLGERSAFDGSLLRKPGQDFP
Ga0315295_1047147923300032156SedimentMSLLRMGCYGHDRDHSSLRAVIRKDPVGSWCFLLDINFKDLFPVRPFERTKFMCVQRRMAEVGFEKPQTFSEGFKGIFLSGIVLNLPKICVGLGCENQLVHRLLFSVPGERSAMNGSLLRKPGQDFL
Ga0315295_1128922213300032156SedimentMHLDSSQKKETANRKHFMSLLRMRCYGDDRDHSSLRAVIPEDPVGSWCFLLDIRLEDLFPVRPFERPKFVRLQRRMAQVGLKKPQAFPDGFKNIPLRGIVFNLSKVGVGLGCENQFVHRLLFSVPGERSAINGSLLRKPGEDFL
Ga0315295_1163488513300032156SedimentMRRYGDDRNHSSLRSIIPEDPVGARCFLLGIGLEDLFPVRAFEGSKFVRVQRWMPHVGFKKAQAFPDGFENIPLRGVIFNLPKVGVGLGCEDQLVHRFLFGVLGERSALDGSLLRKPGEDFF
Ga0315281_1013090843300032163SedimentLSGMGCYGNDRNHSSPGAIIPENQVGARCFLLDISFKDLFPVRPFERTKFMCVQRGMAEVGFEKPQAFSDGFKGIFLRGIVLNLPKICVGLGCENQFVHGLLFSTLGERSAFDGSLLRKPGQDFP
Ga0315281_1015682223300032163SedimentMNLSGMRYYGDDRNHSSLRAIIPEDPVGARCFLLSICLEDLFPVRPFEGSKFVRIQRGMPQVGFKKPQAFPDGFEDIPLRGVVSNLPKVGIGLGCEN
Ga0315281_1029934513300032163SedimentMRCYGDDRNHSSLWAIIPEDPVGTRCFLLGICLEDLFPVRPFEGTKFVRVQRGMPQVGFKKPQAFPNGFEDIPLRRAVFNLPKVSVGLGCEDQFGHRSLFGVLGKRSALDGSLLRKTGEDFL
Ga0315281_1177309713300032163SedimentMGCYGDDRDHSPLGAVIPEDPVGSWCFLLDIRLENLFPVRPFERPKFVRLQRRMVQVGFKEPQAFPDGFENIPLRGIVSNLPKVGVGLG
Ga0315276_1211473713300032177SedimentMSLSGMRCYGDDRDHSSLRAIIPEDPAGTRCSLLGICLEDLFPIRPFEGSKFVRVQRGMPQVGFKKPEAFPDSFEDIPLRGVVFNLPKVGIGLGCENQFVHRSLFGVLGKRSALDGSLL
Ga0316194_1016640323300032262SedimentMSLSGMRCYRDDRNHSSLRSIIPENPVGTRCFLLCICLEDLFPIRPFEGSKFVGVQRRMTEVGFKKPKAFPDGLEDIPFRRVVFNLPKVSVGLGRENQFMHGSLFDVLGEGSAFDRSHLR
Ga0315286_1047393533300032342SedimentMNLLRMRCYGDDRNHSSSGAIIPENPVSARCFLMDISFKDLFPVGAFERAKFMCVQRGMAQVGFEKPQAFSDDFKGIFFRGIILNLPKICVGLGGENQFVHGILFSMPGERSAFDGSLLRKAGQDFP
Ga0315286_1076222713300032342SedimentMSLSGMRCYGDDRNHSSLRAIIPEDPVGARCFLLGICLEDLFPVRPFEGSKFVRVQRGMPQVGFKKPEAFPDGFEDIPLRGVVFNLPKVGVGLGCEDQFVHRSLFGVLGKRSALDGSLLRKPGEDFL
Ga0315287_1115916313300032397SedimentKGKTEMSYSAISEGSREAHRRRASGREKKELSHTGLLRMRCYGDDRDHSPLRAIIPEDPVGSWSFLLDICLEDLFPVRAFERPKFVRLQRRMAQVGFKKPQAFPDGFKNIPLRGIVFNLPKVGVGLGGENQFVHRLLFSVPGERSALNGSLLRKPGQDFL
Ga0315275_1083107023300032401SedimentMSLSGMRCYGDDRNHSSLRAIIPEDPVGARCFLLGICLEDLFPVRPFEGSKFVRVQRGMPQVGFKKPQAFPDGFEDIPLRGVVFNLPKVGIGLGCENQFVHRSLFGVLGKRSALDGSLLRKPGEDFL
Ga0315275_1182214523300032401SedimentGGYFTSLSGMGCYGNDRNHSSPGAIIPENPVGARCFLLDISFKDLFPVRPFERTKFMCVQRGMAEVGFEKPQAFSDGFKGIFLRGIVLNLPKICVGLGCENQFVHGLLFSTLGERSAFDGSLLRKPGQDFP
Ga0315273_1048744013300032516SedimentMSYSAISEGSSEAHRRRASGREKKELSHTGLLRMRCYGDDRDHSPVRAVIPEDPVGSWSFLLDIRLEDLFSVRPFERPKFVRLQRRMAQVGFKKPQAFPDGFKNIPLRGIVFNLPKVGVGLGGENQFVHRLLFSVPGERSALNGSLLRKPGQDFL
Ga0316193_1122389713300033429SedimentVRCYRDDRNHSSLRSIIPENPVGTRCFLLGVCLEDLFPIGPFEGSKFVGVQRRMTEVGFKKPKKFPDSLEDILFRRVVFNLPKVSVGLGRENQFMHGSLFDILGK
Ga0316620_1068816633300033480SoilMNLSWVACYGDDRNHSSLRAIIPEDPVGAGCFLLGICLEDLFPVRPFEGSKFVRAQRGMPQVGFKKPQAFPDGFEDIFLRGIFFNRPKVGIGLRGEDQFVHRSLFGVLGKRSALDGALLRESGEDFL
Ga0316620_1102255923300033480SoilKLLRMRCYGDDRDHSPLRAVIPEDPVGSWCVLLDIRLEDLFPVRAFERAKFMCVQRGMAQVGFEKPQAFSDDFKDIFFRGIILNLPKICVGLGGENQFMHRMLLSMPGERSAFDRSLLRKPGQDFS
Ga0316600_1015950023300033481SoilMSFLWMRCYGDNRDHSSLRTVIPEDPVGSWCFLLDISFKDLFPVRPFERTKFMCVQRRMAEVGFEKPQAFSNGFKGIFLSGIVLNLPKICVGLGCENQFVHGLLFSAFGERSALDGSLLRKPRQDFS
Ga0316626_1007430943300033485SoilMSFLWMRCYGDNRDHSSLRTVIPEDPVGSWCFLLDISFKDLFPVRPFERTKFMCVQRRMVQVGFKKPQASPNGFENIPLRGILFNLPKIGVGLGGENQFVHRLLFSVPGERSAPDGSLLRKPGQDFL
Ga0316626_1097984723300033485SoilMKLLRMRCYGDDRDHSPLRAVIPEDPVGSWCVLLDIRLEDLFPVRAFERAKFMCVQRGMAQVGFEKPQAFSDDFKDIFFRGIILNLPKICVGLGGENQFMHRMLLSMPGERSAFDRSLLRKPGQDFS
Ga0316626_1158145923300033485SoilLKDRLQGMEGEKKETASRKHFMSLLRMGCYGDDRDHSSLRAVIPKDPAGSWCFLLDISFKDLFPVRSFERTKFMCVQRRMAEVGFEKPQAFSNGFKGIFLSGIVLNLPKICVGLGCENQFVHGLLFSAFGERSALDGSLLRKPRQDFS
Ga0316630_1181498613300033487SoilVFGDDRDHSSLRAVIPEDPVGSWCCLLDIRLENLFPVGPFERPEFVCLQRGMAQVGFKEPQAFPYRFENIPLRGIVSNLPKV
Ga0299912_1099038323300033489SoilMGCYGDDRDHSSLRAVIPEDPVGSWCFLLDIRLKDFFPVWPFERPKFVRLQRGMAQVGFKKPQAFPDGFKNIPLRGILFNLPKVGVGLGCENQFVHRLLFSVPGERSALNGTL
Ga0299912_1132767023300033489SoilMSLSGMRGYGDDCNRSSLRAIIPEDPVGARCFLLGVCFEDLFPVRPFEGSKFVRVQGGMSQVGFKKPQAFPDGFENIPLRGVIFNLPKVGVGLGCEKQFGHRSLFGVLGKRSTLDGSLL
Ga0316628_10025374153300033513SoilMSLSRMRCYGDDRDHSSLRAVIPEYPVGSWSFLLDIRLEDLFPVRPFERPKFVRLQRRMAQVGFKKPQAFPEGFKNVSFRGIVFNLPKVGVGLGGENQFVHRLLFSVPSERSALNGPLLRKPGQDFL
Ga0316628_10078105613300033513SoilMSLLRMGCYGDDRDHSSLRAVIPKDPAGSWCFLLDISFKDLFPVRPFERTKFMCVQRRMVQVGFKKPQASPNGFENIPLRGILFNLPKIGVGLGCE
Ga0316628_10247920423300033513SoilMSLSGMRCYGNDRNHSSLRPIIPEDPVGARCFVLGICLEDLFPGRPFEGSKFVRVQRWMPRVGFKKPQAFPDGFENIPLRGVVFNLPKVGVGLGCEDQFVHRSLFGVLGKRSALDGSLLRKPGEDFL
Ga0316628_10365980513300033513SoilMLRDFAHCDEVTFVSLSGMRCYGDDRNHFSLRAVIPEDPVGTRCCLLGICFEDHFPIRPFEGSKFVRVQRGMPQVGLKKPEAFPDGFEDIPLRGVVFNLAKVGIGLGCEDQLVHRSLFGVLGKRSALDGSLLRKPGEDFL
Ga0316617_10120138413300033557SoilMNLLRMRCYGDDRDHSPLRAVIPEDPVGSWCLLLDIRLEDLFPVRAFERAKFMCVQRGMAQVGFEKPQAFSDDFKGISFRGIILNLPKIGVGLGGE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.