


| Basic Information | |
|---|---|
| Family ID | F039165 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 164 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LYNLKYNNPKTPERDQQVQELIDDIQATCKLIANDTQPYDK |
| Number of Associated Samples | 137 |
| Number of Associated Scaffolds | 164 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.22 % |
| % of genes near scaffold ends (potentially truncated) | 96.95 % |
| % of genes from short scaffolds (< 2000 bps) | 82.93 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.098 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (19.512 % of family members) |
| Environment Ontology (ENVO) | Unclassified (67.683 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.195 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.13% β-sheet: 0.00% Coil/Unstructured: 60.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 164 Family Scaffolds |
|---|---|---|
| PF00462 | Glutaredoxin | 10.98 |
| PF09293 | RNaseH_C | 1.83 |
| PF02675 | AdoMet_dc | 1.22 |
| PF10263 | SprT-like | 0.61 |
| PF03288 | Pox_D5 | 0.61 |
| PF14240 | YHYH | 0.61 |
| PF02657 | SufE | 0.61 |
| PF01832 | Glucosaminidase | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
|---|---|---|---|
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 1.22 |
| COG2166 | Sulfur transfer protein SufE, Fe-S cluster assembly | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| COG3378 | DNA primase, phage- or plasmid-associated | Mobilome: prophages, transposons [X] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.10 % |
| All Organisms | root | All Organisms | 43.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000949|BBAY94_10179808 | Not Available | 571 | Open in IMG/M |
| 3300001967|GOS2242_1070433 | All Organisms → Viruses → Predicted Viral | 1725 | Open in IMG/M |
| 3300002231|KVRMV2_101455478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 806 | Open in IMG/M |
| 3300002242|KVWGV2_10246299 | Not Available | 580 | Open in IMG/M |
| 3300003185|JGI26064J46334_1121047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Mosig EXVC030M | 500 | Open in IMG/M |
| 3300004097|Ga0055584_100227642 | All Organisms → Viruses → Predicted Viral | 1899 | Open in IMG/M |
| 3300005430|Ga0066849_10148469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 923 | Open in IMG/M |
| 3300005605|Ga0066850_10167596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300005608|Ga0066840_10055446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
| 3300005747|Ga0076924_1007094 | All Organisms → Viruses → Predicted Viral | 2305 | Open in IMG/M |
| 3300005747|Ga0076924_1199967 | All Organisms → Viruses → Predicted Viral | 2273 | Open in IMG/M |
| 3300005837|Ga0078893_10014470 | All Organisms → Viruses → Predicted Viral | 1413 | Open in IMG/M |
| 3300006357|Ga0075502_1675984 | Not Available | 565 | Open in IMG/M |
| 3300006401|Ga0075506_1812211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300006735|Ga0098038_1049149 | All Organisms → Viruses → Predicted Viral | 1526 | Open in IMG/M |
| 3300006753|Ga0098039_1008489 | All Organisms → Viruses → Predicted Viral | 3827 | Open in IMG/M |
| 3300006802|Ga0070749_10724283 | Not Available | 531 | Open in IMG/M |
| 3300006874|Ga0075475_10213286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
| 3300006919|Ga0070746_10031378 | All Organisms → Viruses → Predicted Viral | 2859 | Open in IMG/M |
| 3300006919|Ga0070746_10220114 | Not Available | 897 | Open in IMG/M |
| 3300006921|Ga0098060_1092370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 861 | Open in IMG/M |
| 3300006990|Ga0098046_1125498 | Not Available | 559 | Open in IMG/M |
| 3300007074|Ga0075110_1008335 | All Organisms → Viruses → Predicted Viral | 3292 | Open in IMG/M |
| 3300007539|Ga0099849_1012543 | Not Available | 3765 | Open in IMG/M |
| 3300007540|Ga0099847_1140011 | Not Available | 723 | Open in IMG/M |
| 3300007541|Ga0099848_1203176 | Not Available | 710 | Open in IMG/M |
| 3300007992|Ga0105748_10217620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
| 3300009000|Ga0102960_1182422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
| 3300009001|Ga0102963_1224168 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
| 3300009071|Ga0115566_10080932 | All Organisms → Viruses → Predicted Viral | 2121 | Open in IMG/M |
| 3300009071|Ga0115566_10194694 | Not Available | 1241 | Open in IMG/M |
| 3300009103|Ga0117901_1322530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
| 3300009423|Ga0115548_1283953 | Not Available | 507 | Open in IMG/M |
| 3300009437|Ga0115556_1250667 | Not Available | 629 | Open in IMG/M |
| 3300009472|Ga0115554_1138964 | Not Available | 1010 | Open in IMG/M |
| 3300009476|Ga0115555_1203177 | Not Available | 816 | Open in IMG/M |
| 3300009507|Ga0115572_10526806 | Not Available | 654 | Open in IMG/M |
| 3300009508|Ga0115567_10528903 | Not Available | 716 | Open in IMG/M |
| 3300009593|Ga0115011_11546082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300010148|Ga0098043_1040757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1441 | Open in IMG/M |
| 3300010368|Ga0129324_10120718 | Not Available | 1113 | Open in IMG/M |
| 3300011013|Ga0114934_10078959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1634 | Open in IMG/M |
| 3300012520|Ga0129344_1241039 | Not Available | 727 | Open in IMG/M |
| 3300012919|Ga0160422_10350103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
| 3300012920|Ga0160423_10500750 | Not Available | 826 | Open in IMG/M |
| 3300012928|Ga0163110_10058668 | Not Available | 2451 | Open in IMG/M |
| 3300012928|Ga0163110_10223463 | Not Available | 1345 | Open in IMG/M |
| 3300012928|Ga0163110_10726805 | Not Available | 776 | Open in IMG/M |
| 3300012928|Ga0163110_10974927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300012954|Ga0163111_11459875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
| 3300012954|Ga0163111_11490127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
| 3300017706|Ga0181377_1019926 | Not Available | 1479 | Open in IMG/M |
| 3300017706|Ga0181377_1074225 | Not Available | 614 | Open in IMG/M |
| 3300017710|Ga0181403_1000750 | Not Available | 7895 | Open in IMG/M |
| 3300017714|Ga0181412_1068509 | Not Available | 870 | Open in IMG/M |
| 3300017717|Ga0181404_1016195 | Not Available | 1941 | Open in IMG/M |
| 3300017725|Ga0181398_1138985 | Not Available | 577 | Open in IMG/M |
| 3300017732|Ga0181415_1062925 | Not Available | 841 | Open in IMG/M |
| 3300017732|Ga0181415_1110877 | Not Available | 618 | Open in IMG/M |
| 3300017735|Ga0181431_1093071 | Not Available | 675 | Open in IMG/M |
| 3300017739|Ga0181433_1089631 | Not Available | 753 | Open in IMG/M |
| 3300017741|Ga0181421_1015717 | Not Available | 2080 | Open in IMG/M |
| 3300017745|Ga0181427_1183887 | Not Available | 503 | Open in IMG/M |
| 3300017746|Ga0181389_1162663 | Not Available | 589 | Open in IMG/M |
| 3300017749|Ga0181392_1078377 | Not Available | 997 | Open in IMG/M |
| 3300017755|Ga0181411_1148946 | Not Available | 674 | Open in IMG/M |
| 3300017756|Ga0181382_1159465 | Not Available | 584 | Open in IMG/M |
| 3300017757|Ga0181420_1022216 | All Organisms → Viruses → Predicted Viral | 2109 | Open in IMG/M |
| 3300017758|Ga0181409_1029737 | All Organisms → Viruses → Predicted Viral | 1739 | Open in IMG/M |
| 3300017758|Ga0181409_1079108 | Not Available | 992 | Open in IMG/M |
| 3300017759|Ga0181414_1124631 | Not Available | 676 | Open in IMG/M |
| 3300017762|Ga0181422_1110100 | Not Available | 857 | Open in IMG/M |
| 3300017762|Ga0181422_1218638 | Not Available | 570 | Open in IMG/M |
| 3300017763|Ga0181410_1018202 | All Organisms → Viruses → Predicted Viral | 2340 | Open in IMG/M |
| 3300017763|Ga0181410_1129111 | Not Available | 718 | Open in IMG/M |
| 3300017767|Ga0181406_1055081 | Not Available | 1226 | Open in IMG/M |
| 3300017767|Ga0181406_1137994 | Not Available | 733 | Open in IMG/M |
| 3300017768|Ga0187220_1042703 | Not Available | 1366 | Open in IMG/M |
| 3300017768|Ga0187220_1219949 | Not Available | 570 | Open in IMG/M |
| 3300017771|Ga0181425_1204587 | Not Available | 619 | Open in IMG/M |
| 3300017773|Ga0181386_1060906 | Not Available | 1204 | Open in IMG/M |
| 3300017776|Ga0181394_1024363 | All Organisms → Viruses → Predicted Viral | 2155 | Open in IMG/M |
| 3300017779|Ga0181395_1158106 | Not Available | 713 | Open in IMG/M |
| 3300017781|Ga0181423_1263796 | Not Available | 642 | Open in IMG/M |
| 3300017783|Ga0181379_1225240 | Not Available | 653 | Open in IMG/M |
| 3300017951|Ga0181577_10035856 | Not Available | 3575 | Open in IMG/M |
| 3300017956|Ga0181580_10651477 | Not Available | 674 | Open in IMG/M |
| 3300017967|Ga0181590_10353892 | Not Available | 1053 | Open in IMG/M |
| 3300017967|Ga0181590_10788069 | Not Available | 633 | Open in IMG/M |
| 3300017967|Ga0181590_11104457 | Not Available | 511 | Open in IMG/M |
| 3300018421|Ga0181592_10658421 | Not Available | 704 | Open in IMG/M |
| 3300018424|Ga0181591_10078883 | All Organisms → Viruses → Predicted Viral | 2722 | Open in IMG/M |
| 3300018424|Ga0181591_11094337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300018428|Ga0181568_11074239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300019459|Ga0181562_10610821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300019756|Ga0194023_1118649 | Not Available | 538 | Open in IMG/M |
| 3300020165|Ga0206125_10155315 | Not Available | 917 | Open in IMG/M |
| 3300020173|Ga0181602_10274955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 708 | Open in IMG/M |
| 3300020178|Ga0181599_1163897 | Not Available | 926 | Open in IMG/M |
| 3300020178|Ga0181599_1280134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300020187|Ga0206130_10186581 | Not Available | 1019 | Open in IMG/M |
| 3300020241|Ga0211479_103378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 658 | Open in IMG/M |
| 3300020258|Ga0211529_1059437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 652 | Open in IMG/M |
| 3300020264|Ga0211526_1046683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 730 | Open in IMG/M |
| 3300020301|Ga0211650_1029709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 803 | Open in IMG/M |
| 3300020308|Ga0211693_1011691 | Not Available | 953 | Open in IMG/M |
| 3300020308|Ga0211693_1028116 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300020320|Ga0211597_1033456 | All Organisms → Viruses → Predicted Viral | 1054 | Open in IMG/M |
| 3300020349|Ga0211511_1000696 | Not Available | 10137 | Open in IMG/M |
| 3300020357|Ga0211611_1160503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300020362|Ga0211488_10123377 | Not Available | 747 | Open in IMG/M |
| 3300020365|Ga0211506_1134996 | Not Available | 696 | Open in IMG/M |
| 3300020381|Ga0211476_10009507 | Not Available | 5017 | Open in IMG/M |
| 3300020402|Ga0211499_10239768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
| 3300020403|Ga0211532_10137322 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| 3300020421|Ga0211653_10414048 | Not Available | 580 | Open in IMG/M |
| 3300020434|Ga0211670_10075106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1279 | Open in IMG/M |
| 3300020438|Ga0211576_10103741 | Not Available | 1570 | Open in IMG/M |
| 3300020445|Ga0211564_10202482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 984 | Open in IMG/M |
| 3300020446|Ga0211574_10075151 | All Organisms → Viruses → Predicted Viral | 1500 | Open in IMG/M |
| 3300020446|Ga0211574_10084401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1405 | Open in IMG/M |
| 3300020449|Ga0211642_10503607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300020451|Ga0211473_10306077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 816 | Open in IMG/M |
| 3300020460|Ga0211486_10488727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300021356|Ga0213858_10002533 | Not Available | 8618 | Open in IMG/M |
| 3300021356|Ga0213858_10550282 | Not Available | 529 | Open in IMG/M |
| 3300021368|Ga0213860_10416804 | Not Available | 580 | Open in IMG/M |
| 3300021389|Ga0213868_10503395 | Not Available | 650 | Open in IMG/M |
| 3300021957|Ga0222717_10063700 | All Organisms → Viruses → Predicted Viral | 2364 | Open in IMG/M |
| 3300021957|Ga0222717_10484638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 668 | Open in IMG/M |
| 3300021959|Ga0222716_10470512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300021964|Ga0222719_10238736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1215 | Open in IMG/M |
| 3300022068|Ga0212021_1035475 | Not Available | 986 | Open in IMG/M |
| 3300022925|Ga0255773_10038909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 2970 | Open in IMG/M |
| 3300022925|Ga0255773_10358110 | Not Available | 570 | Open in IMG/M |
| 3300023178|Ga0255759_10497849 | Not Available | 715 | Open in IMG/M |
| 3300023242|Ga0222708_1014874 | Not Available | 1320 | Open in IMG/M |
| 3300023243|Ga0222630_1054019 | Not Available | 784 | Open in IMG/M |
| 3300024235|Ga0228665_1077342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300024235|Ga0228665_1137166 | Not Available | 503 | Open in IMG/M |
| 3300024332|Ga0228659_1124944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300024346|Ga0244775_11123512 | Not Available | 615 | Open in IMG/M |
| 3300025102|Ga0208666_1109566 | Not Available | 669 | Open in IMG/M |
| 3300025759|Ga0208899_1106784 | Not Available | 1033 | Open in IMG/M |
| 3300025840|Ga0208917_1211530 | Not Available | 641 | Open in IMG/M |
| 3300025869|Ga0209308_10010021 | Not Available | 6548 | Open in IMG/M |
| 3300025869|Ga0209308_10101932 | All Organisms → Viruses → Predicted Viral | 1387 | Open in IMG/M |
| 3300025886|Ga0209632_10375792 | Not Available | 683 | Open in IMG/M |
| 3300026125|Ga0209962_1004808 | All Organisms → Viruses → Predicted Viral | 2736 | Open in IMG/M |
| 3300026130|Ga0209961_1001145 | Not Available | 8281 | Open in IMG/M |
| 3300026138|Ga0209951_1005807 | Not Available | 2695 | Open in IMG/M |
| 3300026183|Ga0209932_1058347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 915 | Open in IMG/M |
| 3300026187|Ga0209929_1013386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 2636 | Open in IMG/M |
| 3300026189|Ga0208405_1011885 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1397 | Open in IMG/M |
| 3300026201|Ga0208127_1005981 | Not Available | 5217 | Open in IMG/M |
| 3300027752|Ga0209192_10008041 | Not Available | 6074 | Open in IMG/M |
| 3300027752|Ga0209192_10020303 | All Organisms → Viruses → Predicted Viral | 3322 | Open in IMG/M |
| 3300027791|Ga0209830_10234422 | Not Available | 840 | Open in IMG/M |
| 3300027801|Ga0209091_10404933 | Not Available | 617 | Open in IMG/M |
| 3300031775|Ga0315326_10130072 | All Organisms → Viruses → Predicted Viral | 1648 | Open in IMG/M |
| 3300032006|Ga0310344_11067870 | All Organisms → Viruses | 675 | Open in IMG/M |
| 3300032073|Ga0315315_10281196 | All Organisms → Viruses → Predicted Viral | 1551 | Open in IMG/M |
| 3300032073|Ga0315315_11450608 | Not Available | 597 | Open in IMG/M |
| 3300032360|Ga0315334_11670029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 19.51% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 14.02% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.59% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.76% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.93% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 6.10% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 4.27% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.27% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.05% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.44% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.44% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.22% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.22% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.22% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.22% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.22% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.22% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.61% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.61% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.61% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.61% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.61% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.61% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.61% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.61% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.61% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.61% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.61% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001967 | Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300003185 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300005608 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009103 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020241 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291768-ERR318619) | Environmental | Open in IMG/M |
| 3300020258 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949) | Environmental | Open in IMG/M |
| 3300020264 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556116-ERR599158) | Environmental | Open in IMG/M |
| 3300020301 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX556086-ERR598997) | Environmental | Open in IMG/M |
| 3300020308 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556085-ERR599046) | Environmental | Open in IMG/M |
| 3300020320 | Marine microbial communities from Tara Oceans - TARA_B000000441 (ERX556072-ERR598990) | Environmental | Open in IMG/M |
| 3300020349 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859) | Environmental | Open in IMG/M |
| 3300020357 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX555950-ERR598956) | Environmental | Open in IMG/M |
| 3300020362 | Marine microbial communities from Tara Oceans - TARA_A100001234 (ERX556035-ERR599049) | Environmental | Open in IMG/M |
| 3300020365 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020402 | Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020434 | Marine microbial communities from Tara Oceans - TARA_B100001013 (ERX555944-ERR599071) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020449 | Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300023242 | Saline water microbial communities from Ace Lake, Antarctica - #1576 | Environmental | Open in IMG/M |
| 3300023243 | Saline water microbial communities from Ace Lake, Antarctica - #3 | Environmental | Open in IMG/M |
| 3300024235 | Seawater microbial communities from Monterey Bay, California, United States - 79D | Environmental | Open in IMG/M |
| 3300024332 | Seawater microbial communities from Monterey Bay, California, United States - 73D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026125 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026130 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026189 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A (SPAdes) | Environmental | Open in IMG/M |
| 3300026201 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY94_101798081 | 3300000949 | Macroalgal Surface | GVKATSDRLYNLKYNNPKTPERDLQVQELIDDIQATCKLIASDKQPYDK* |
| GOS2242_10704336 | 3300001967 | Marine | LKYNNPKTPERDQQVQELIDDIQATCKLIANDKQPYDK* |
| KVRMV2_1014554783 | 3300002231 | Marine Sediment | KIDSIKAQADKLYNLKYNQPKTPERDAEVNHLIEDIQSMCKLVGNDNKPYDI* |
| KVWGV2_102462991 | 3300002242 | Marine Sediment | ISDRLYNTKYNQPKTTSRDAMVNSMIEDIQATCKLIASDNKPYDK* |
| JGI26064J46334_11210471 | 3300003185 | Marine | MLHRISEFCKKIDSIQAQSNRLYNLKYKQPKTTERDAEINHLIEDIQSQCKLLGNDKNPYNT* |
| Ga0055584_1002276421 | 3300004097 | Pelagic Marine | SEFCKKIDSIQALSNRLYNLKYNNPKTVERDAEINHLIDDIQAQCKIIGSDDKPYDKP* |
| Ga0066849_101484693 | 3300005430 | Marine | NLKYNHPKTPERDAEVNHLIEDIQSTCKIVANDKKPYDL* |
| Ga0066850_101675963 | 3300005605 | Marine | YNNPKTVERDAEINHLIDDIQAQCKIIGSDDKPYDKP* |
| Ga0066840_100554461 | 3300005608 | Marine | DSIKAQADKLYNLKYNHPKTPERDAEVNHLIDDIQSMCKVVGNDNKPYDL* |
| Ga0076924_10070941 | 3300005747 | Marine | FCKKIDSIKAQADKLYNLKYNQIKTPERDAEVNHLIDDIQSMCKVVGNDNKPYDL* |
| Ga0076924_11999676 | 3300005747 | Marine | FCKKIDSIKAQADKLYNLKYNHPKTPERDAEVNHLIDDIQSTCKIVANDTKPYDL* |
| Ga0078893_100144703 | 3300005837 | Marine Surface Water | MKYKQPKTPERDAEINHLIQDIQSQCKLLGSDKNPYNT* |
| Ga0075502_16759841 | 3300006357 | Aqueous | LKIQSDRLYNLKYNSPKTPERDLEVDYLISDIQMICNLIANDKSKYDR* |
| Ga0075506_18122113 | 3300006401 | Aqueous | NLKYNHPKTPERDAEVNHLIDDIQSTCKLLANDTKPYDL* |
| Ga0098038_10491491 | 3300006735 | Marine | YNLKYNNPKTPERDQQVQELIDDIQATCLLIAKDTQPYDK* |
| Ga0098039_100848911 | 3300006753 | Marine | SDRLYNLKYNNPKTPERDLQVQELIDDIQATCKLIANDKQPYDK* |
| Ga0070749_107242832 | 3300006802 | Aqueous | KLKYENKKTTERDAEIDFLISDIQYLCKNIANDKSKYEKD* |
| Ga0075475_102132861 | 3300006874 | Aqueous | NNPKTPERDAEINHLIEDIQLMCKVVSNDTSPYDKK* |
| Ga0070746_100313789 | 3300006919 | Aqueous | NNPKTPERDLEVDYLISDIQMICNLIANDKSKYDR* |
| Ga0070746_102201141 | 3300006919 | Aqueous | LYNLKYNSPKTSARDMEVDYLIQDIQYICKLISSDKGKYDR* |
| Ga0098060_10923703 | 3300006921 | Marine | DGLKTLSTKLYEVKYNNPKSDVRDAEVRHLIDDIQATCRLIANDTQPYDKG* |
| Ga0098046_11254983 | 3300006990 | Marine | YNNPKTPERDAEVNNLVADIQATSKLIANDTGPYDK* |
| Ga0075110_100833510 | 3300007074 | Saline Lake | CLKIDGLKKTSDRLYNIKYNNPKTPERDAQVAELIDDIQSTCLLIAKDNKPYDK* |
| Ga0099849_101254311 | 3300007539 | Aqueous | KYNNPKTKERDIEVDNLIEDIQMQCRLIANDKSKYDR* |
| Ga0099847_11400113 | 3300007540 | Aqueous | VKKTSDRLYNLKYNNIKTPERDQQIQELIDDIQATCKLIANDTQPYDK* |
| Ga0099848_12031763 | 3300007541 | Aqueous | LYNLKYNNPKTPERDLEVDYLISDIQMICNLIANDKSKYDR* |
| Ga0105748_102176203 | 3300007992 | Estuary Water | SIKAQADKLYNLKYNHPKTPERDAEVNHLIDDIQSTCKIVANDTKPYDL* |
| Ga0102960_11824221 | 3300009000 | Pond Water | TVKSQSDKLYNLKYNNPKTPERDAEINHLIDDIQYMCKIIGNDTSPYDK* |
| Ga0102963_12241683 | 3300009001 | Pond Water | KSQSDKLYNLKYNNPKTPERDAEINHLIDDIQYMCKIIGNDTSPYDK* |
| Ga0115566_100809321 | 3300009071 | Pelagic Marine | TSDRLYNIKYNNPKTPERDQQIQELIDDIQATCLLIANDKQPYDK* |
| Ga0115566_101946944 | 3300009071 | Pelagic Marine | DGVKKTSDRLYNLKYNNPKTPERDQQVQELIDDIQATCLLIAKDTQPYDK* |
| Ga0117901_13225302 | 3300009103 | Marine | MKYNQPKTPERDAEINNLIDDIQAQCKLIGSDDKPYDKP* |
| Ga0115548_12839531 | 3300009423 | Pelagic Marine | NLKYNNPKTPERDQQVQELIDDIQATCLLIAKDTQPYDK* |
| Ga0115556_12506673 | 3300009437 | Pelagic Marine | VKKTSDRLYNLKYNNPKTPERDQQVQELIDDIQATCLLIAKDTQPYDK* |
| Ga0115554_11389641 | 3300009472 | Pelagic Marine | YNLKYNNPKTPERDQQVQELIDDIQATCKLIANDTQPYDK* |
| Ga0115555_12031773 | 3300009476 | Pelagic Marine | CLKVDGVKKTSDRLYNLKYNNPKTPERDQQVQELIDDIQATCKLIANDTQPYDK* |
| Ga0115572_105268061 | 3300009507 | Pelagic Marine | NLKYNNIKTPERDQQIQELIDDIQATCKLIANDTQPYDK* |
| Ga0115567_105289031 | 3300009508 | Pelagic Marine | KTSDRLYNLKYNNPKTPERDQQVQELIDDIQATCLLIAKDTQPYDK* |
| Ga0115011_115460821 | 3300009593 | Marine | NNPKTVERDAEINHLIDDIQAQCKIIGSDDKPYDKP* |
| Ga0098043_10407574 | 3300010148 | Marine | HPKTPERDAEVNHLIEDIQSMCKVVSNDKKPYDL* |
| Ga0129324_101207184 | 3300010368 | Freshwater To Marine Saline Gradient | KYNNIKTPERDQQIQELIDDIQATCKLIANDTQPYDK* |
| Ga0114934_100789595 | 3300011013 | Deep Subsurface | IDSIKAQADKLYNLKYNQPKTPERDAEVNHLIEDIQSMCKLVGNDNKPYDI* |
| Ga0129344_12410393 | 3300012520 | Aqueous | LYNLKYNNPKTKERDLEVDYLISDIQMICNLIANDKSKYDR* |
| Ga0160422_103501032 | 3300012919 | Seawater | MLHQISDFSKKIDSIKAQADKLYNLKYNHPKTPERDAEVNHLIEDIQSMCKVVGSDNKPYDI* |
| Ga0160423_105007503 | 3300012920 | Surface Seawater | TSDRLYNLKYNNPKTPERDMQIQELIDDIQATCLLIAKDKQPYDK* |
| Ga0163110_100586681 | 3300012928 | Surface Seawater | KVSDRLYNLKYNNPKTPERDAEVDNLVADVQMQCKLIASDKEKYAG* |
| Ga0163110_102234631 | 3300012928 | Surface Seawater | KLYNLKYNNPKTVERDAEINHLIDDIQAQCKIIGSDDKPYDKP* |
| Ga0163110_107268051 | 3300012928 | Surface Seawater | SDRLYNTKYNQPKTPERDAEVNSMIDDIQATCKLIANDNKPYDK* |
| Ga0163110_109749273 | 3300012928 | Surface Seawater | DSIKAQADKLYNLKYNHPKTPERDAEVNHLIEDIQSMCKVVGNDNKPYDI* |
| Ga0163111_114598751 | 3300012954 | Surface Seawater | QADKLYNLKYNHPKTPERDAEVNHLIEDIQSMCKVVGNDNKPYDI* |
| Ga0163111_114901273 | 3300012954 | Surface Seawater | IKAQADKLYNLKYNHPKTPERDAEVNHLIEDIQSMCKVVGNDNKPYDI* |
| Ga0181377_10199266 | 3300017706 | Marine | LKVDGVKKTSDRLYNLKYNNPKTPERDMQIQELIDDIQATCLLIANDKQPYDK |
| Ga0181377_10742253 | 3300017706 | Marine | LKVDGVKKTSDRLYNLKYNNPKTPERDMQIQELIDDIQATCLLIAKDTQPYDK |
| Ga0181403_100075020 | 3300017710 | Seawater | LKVDGVKKTSDRLYNLKYNNPKTPERDMQIQELIDDIQATCKLIANDTQPYDK |
| Ga0181412_10685092 | 3300017714 | Seawater | KKTSDRLYNLKYNNPKTPERDQQVQELIDDIQATCLLIAKDTQPYDR |
| Ga0181404_10161957 | 3300017717 | Seawater | DGVKKTSDRLYNLKYNNPKTPERDQQVQELIDDIQATCKLIANDTQPYDK |
| Ga0181398_11389851 | 3300017725 | Seawater | DGLKKTSDRLYNLKYNNPKTPERDQQVQELIDDIQATCLLIAKDTQPYDK |
| Ga0181415_10629251 | 3300017732 | Seawater | NNPKTPERDAEVKNLVADIQATSKLIANDTGPYDK |
| Ga0181415_11108771 | 3300017732 | Seawater | NLKYNNPKTPERDQQVQELIDDIQATCLLIAKDTQPYDK |
| Ga0181431_10930713 | 3300017735 | Seawater | TSDRLYNLKYNNPKTPERDQQVQELIDDIQATCKLIANDTQPYDK |
| Ga0181433_10896311 | 3300017739 | Seawater | LKYNNPKTPERDMQIQELIDDIQATCLLIANDKQPYDK |
| Ga0181421_10157171 | 3300017741 | Seawater | RLQKLKYDNPKTPERDAEVDNLIADIQMQCKLIANDKGNYDK |
| Ga0181427_11838871 | 3300017745 | Seawater | KTSDRLYNLKYNNPKTPERDQQVQELIDDIQATCLLIANDKQPYDK |
| Ga0181389_11626633 | 3300017746 | Seawater | YNLKYNNPKTPERDQQVQELIDDIQATCKLIANDTQPYDK |
| Ga0181392_10783771 | 3300017749 | Seawater | DGVKKTSDRLYNLKYNNPKTPERDMQIQELIDDIQATCLLIANDKQPYDK |
| Ga0181411_11489461 | 3300017755 | Seawater | IDSIKAQADKLYNLKYNHPKTPERDAEVNHLIDDIQSTCKIVANDTKPYDL |
| Ga0181382_11594654 | 3300017756 | Seawater | KYDNPKTPERDAEVDNLIADIQMQCKLIANDKGNYDK |
| Ga0181420_10222161 | 3300017757 | Seawater | ERDDGVKKTSDRLYNLKYNNPKTPERDQQVQELIDDIQATCKLIASDTQPYDK |
| Ga0181409_10297377 | 3300017758 | Seawater | LKIDGVKKTSDRLYNLKYNNPKTPERDQQVQELIDDIQATCKLIASDTQPYDK |
| Ga0181409_10791081 | 3300017758 | Seawater | YNNPKTPERDQQVQELIDDIQATCLLIAKDTQPYDR |
| Ga0181414_11246313 | 3300017759 | Seawater | LYNLKYNNPKTPERDQQVQELIDDIQATCKLIANDTQPYDK |
| Ga0181422_11101004 | 3300017762 | Seawater | KKTSDRLYNLKYNNPKTPERDQQVQELIDDIQATCKLIANDTQPYDK |
| Ga0181422_12186381 | 3300017762 | Seawater | DRLYNLKYNNPKTPERDQQVQELIDDIQATCKLIASDTQPYDK |
| Ga0181410_10182021 | 3300017763 | Seawater | GEEKTPARDEEVNNLIDDIQSTCKVIASDDKPYDK |
| Ga0181410_11291113 | 3300017763 | Seawater | RLYNLKYNNPKTPERDMQIQELIDDIQATCLLIANDKQPYDK |
| Ga0181406_10550811 | 3300017767 | Seawater | LKYNNPKTPERDQQVQELIDDIQATCLLIAKDTQPYDR |
| Ga0181406_11379941 | 3300017767 | Seawater | KYNNPKTPERDMQIQELIDDIQATCLLIANDKQPYDK |
| Ga0187220_10427035 | 3300017768 | Seawater | VDGVKKTSDRLYNLKYNNPKTPERDMQIQELIDDIQATCLLIANDKQPYDK |
| Ga0187220_12199493 | 3300017768 | Seawater | LYNLKYNNPKTPERDQQVQELIDDIQATCLLIAKDTQPYDK |
| Ga0181425_12045871 | 3300017771 | Seawater | NLKYNNPKTPERDMQIQELIDDIQATCLLIANDKQPYDK |
| Ga0181386_10609064 | 3300017773 | Seawater | SDRLYNLKYNNPKTPERDQQVQELIDDIQATCLLIAKDTQPYDK |
| Ga0181394_10243631 | 3300017776 | Seawater | AGLAKLKYNNPKTPERDQVVQELIDDIQATCKLIANDTQPYDK |
| Ga0181395_11581061 | 3300017779 | Seawater | KKTSDRLYNLKYNNPKTPERDMQIQELIDDIQATCLLIANDKQPYDK |
| Ga0181423_12637961 | 3300017781 | Seawater | VKKTSDRLYNLKYNNPKTPERDMQIQELIDDIQATCLLIANDKQPYDK |
| Ga0181379_12252401 | 3300017783 | Seawater | KTSDRLYNLKYNNPKTPERDMQIQELIDDIQATCKLIANDTQPYDK |
| Ga0181577_1003585611 | 3300017951 | Salt Marsh | YNLKYNNPKTPERDMQIQELIDDIQATCKLIANDKQPYDK |
| Ga0181580_106514771 | 3300017956 | Salt Marsh | LKYNNPKTKERDLEVDYLISDIRMICNLIANDKGKYDR |
| Ga0181590_103538921 | 3300017967 | Salt Marsh | LKYNNPKTKERDLEVDYLISDIQMICNLIANDKGKYDR |
| Ga0181590_107880691 | 3300017967 | Salt Marsh | LYNLKYNNPKTPERDAEINHLIEDIQLMCKVVSNDTSPYDKK |
| Ga0181590_111044572 | 3300017967 | Salt Marsh | LKIQSDRLYNLKYNNPKTKERDLEVDYLISDIQMICSLIANDKGKYDRXKIY |
| Ga0181592_106584213 | 3300018421 | Salt Marsh | LYNLKYNTPKTPARDIEVDYLIQDIQYICKLISSDKGKYDR |
| Ga0181591_100788838 | 3300018424 | Salt Marsh | LYNLKYNNPKTPERDLEVDYLISDIQMICNLIANDKSKYDR |
| Ga0181591_110943371 | 3300018424 | Salt Marsh | YNLKYNNPKTPERDAEINHLIEDIQLMCKVVSNDTSPYDKK |
| Ga0181568_110742392 | 3300018428 | Salt Marsh | NHPKTPERDAEVNHLIEDIQSMCKVVGNDNKPYDI |
| Ga0181562_106108211 | 3300019459 | Salt Marsh | DKLYNLKYNHPKTPERDAEVNHLIEDIQSMCKVVGNDNKPYDL |
| Ga0194023_11186493 | 3300019756 | Freshwater | LKYNNPKTPERDMQIQELIDDIQATCKLIANDKQPYDK |
| Ga0206125_101553154 | 3300020165 | Seawater | DRLYNLKYNNPKTPERDAEVKNLVADIQATSKLIANDTGPYDK |
| Ga0181602_102749551 | 3300020173 | Salt Marsh | DKLYNLKYNNPKTPERDAEINHLIDDIQYMCKMIGNDISPYDK |
| Ga0181599_11638974 | 3300020178 | Salt Marsh | IKTISDRLYNLKYNNTKTPERDIEVNNLIEDIQMQCRLIANDKGKYDR |
| Ga0181599_12801341 | 3300020178 | Salt Marsh | QLDKLYNLKYNNPKTPERDAEINHLIDDIQYMCKMIGNDISPYDK |
| Ga0206130_101865811 | 3300020187 | Seawater | SDRLYNLKYNNIKTPERDQQIQELIDDIQATCKLIANDTQPYDK |
| Ga0211479_1033783 | 3300020241 | Marine | KTLSTKLYEVKYNNPKTPERDAEVNHLIEDIQATCRLIANDKKPYDNG |
| Ga0211529_10594371 | 3300020258 | Marine | KYNNPKTPERDAEVDHLINDIQATCRLIANDNQPYDK |
| Ga0211526_10466833 | 3300020264 | Marine | LKTQSDHLYNIKYNNPKTPERDAEVDHLINDIQATCRLIANDNQPYDK |
| Ga0211650_10297093 | 3300020301 | Marine | KYNHPKTPERDAEVNHLIEDIQSMCKVVGSDKKPYDL |
| Ga0211693_10116912 | 3300020308 | Marine | MLHRISEFCKKIDSIQAQSNRLYNLKYKQPKTTERDAEINHLIEDIQSQCKLLGNDKNPYNT |
| Ga0211693_10281161 | 3300020308 | Marine | IQAQSNRLYNMKYKQPKTPERDAEINHLIQDIQSQCKLLGSDKNPYNT |
| Ga0211597_10334563 | 3300020320 | Marine | IDSIKAQADKLYNLKYNHPKTPERDAEVNHLIEDIQSMCKVVGSDNKPYDI |
| Ga0211511_10006961 | 3300020349 | Marine | YNNPKTVERDAEINHLIDDIQAQCKIIGSDDKPYDKP |
| Ga0211611_11605032 | 3300020357 | Marine | KYNQPKTVERDAEINHLIDDIQATCKLIGSDDKPYDKPXEIKVL |
| Ga0211488_101233771 | 3300020362 | Marine | DRLYNTKYNQPKTPERDAEVNAMIEDIQATCKLIANDDKPYDK |
| Ga0211506_11349961 | 3300020365 | Marine | TSDRLYNLKYNNPKTPERDLQVQELIDDIQATCKLIANDKQPYDK |
| Ga0211476_100095071 | 3300020381 | Marine | KIISDRLYNTKYNQPKTPERDAEVNALIEDIQATCKVIASDDKPYDK |
| Ga0211499_102397681 | 3300020402 | Marine | SDFCKKIDSIKAQADKLYNLKYNHPKTPERDAEVNHLIEDIQSMCKVVGSDNKPYDI |
| Ga0211532_101373221 | 3300020403 | Marine | YNTKYNQPKTPERDAEVNSMIEDIQATCKLIASDNQPYDK |
| Ga0211653_104140483 | 3300020421 | Marine | DGLKTMSDRLYNLKYNNPKTPERDAEVKNLVADIQATSKLIANDTGPYDK |
| Ga0211670_100751064 | 3300020434 | Marine | QADKLYNLKYNNTKTPGRDAEINHLIEDIQSTCKIVGADKTPYQKG |
| Ga0211576_101037414 | 3300020438 | Marine | KYNNPKTPERDQQVQELIDDIQATCLLIAKDTQPYDR |
| Ga0211564_102024821 | 3300020445 | Marine | ISEFCKKIDSIQALSNRLYNLKYNNPKTVERDAEINHLIDDIQAQCKIIGSDDKPYDKP |
| Ga0211574_100751511 | 3300020446 | Marine | KKIDSIKAQADKLYNLKYNHPKTPERDAEVNHLIEDIQSMCKIVSNDQKPYDL |
| Ga0211574_100844011 | 3300020446 | Marine | IDSIKAQADKLYNLKYNHPKTPERDAEVNHLIEDIQSMCKVVGNDDKPYDL |
| Ga0211642_105036072 | 3300020449 | Marine | CKKIDAVQAQSNRLYDLKYNQPKTVERDAEINHLIDDIQATCKLIGSDDKPYDKP |
| Ga0211473_103060773 | 3300020451 | Marine | YNIKYNNPKTPERDSEINHLISDIQATCKIIAADTKPYDK |
| Ga0211486_104887272 | 3300020460 | Marine | YNLKYNHPKTPERDAEVNHLIEDIQSMCKVVGSDNKPYDI |
| Ga0213858_100025331 | 3300021356 | Seawater | DKLYNLKYNHPKTPERDAEVNHLIEDIQSMCKVVGNDDKPYDL |
| Ga0213858_105502822 | 3300021356 | Seawater | VVSDRLYNTKYNQPKTPERDAEVNSMIEDIQATCKLIASDSQPYDK |
| Ga0213860_104168041 | 3300021368 | Seawater | VFCKKIDSIKTQADKLYNLKYNNPKTPERDAEINHLIEDIQLMCKVVSNDTSPYDKK |
| Ga0213868_105033953 | 3300021389 | Seawater | LKYNNPKTKERDIEVDNLIEDIQMQCRLIANDKSKYDR |
| Ga0222717_100637001 | 3300021957 | Estuarine Water | LKYNNPKTPERDQQVQELIDDIQATCKLIANDTQPYDK |
| Ga0222717_104846382 | 3300021957 | Estuarine Water | LYNLKYNNPKTPERDAEVNHLIDDIQYMCKMIGNDISPYDK |
| Ga0222716_104705121 | 3300021959 | Estuarine Water | IKSQSDKLYNLKYNNPKTPERDAEVNHLIDDIQYMCKMIGNDTSPYDK |
| Ga0222719_102387363 | 3300021964 | Estuarine Water | KIDTVKSQSDKLYNLKYNNPKTPERDAEINHLIDDIQYMCKIIGNDTSPYDK |
| Ga0212021_10354754 | 3300022068 | Aqueous | DRLYNLKYNHPKTPERDIEIDNMISDIQATCKLIANDTKPYDK |
| Ga0255773_100389099 | 3300022925 | Salt Marsh | LKYNHPKTPERDIEIDNMISDIQATCKLIANDTKPYDK |
| Ga0255773_103581101 | 3300022925 | Salt Marsh | SDRLYNLKYNNPKTPERDQQVQELIDDIQATCLLIANDKQPYDK |
| Ga0255759_104978492 | 3300023178 | Salt Marsh | FCKKIDSIKTQADKLYNLKYNNPKTPERDAEINHLIEDIQLMCKVVSNDTSPYDKK |
| Ga0222708_10148746 | 3300023242 | Saline Water | YNIKYNNPKTPERDAQVAELIDDIQSTCLLIAKDNKPYDK |
| Ga0222630_10540191 | 3300023243 | Saline Water | TSDRLYNLKYNNIKTPERDAEVNELIDDIQATCGLIAKDTKPYDK |
| Ga0228665_10773422 | 3300024235 | Seawater | SIKAQADKLYNLKYNHPKTPERDAEVNHLIDDIQSTCKIVANDTKPYDL |
| Ga0228665_11371661 | 3300024235 | Seawater | NLKYNNPKTPERDAEVNNLVADIQATSKLIANDTGPYDK |
| Ga0228659_11249441 | 3300024332 | Seawater | QADKLYNLKYNHPKTPERDAEVNHLIDDIQSTCKIVANDTKPYDL |
| Ga0244775_111235123 | 3300024346 | Estuarine | NLKYNNPKTPERDQQVQELIDDIQATCKLIANDTQPYDK |
| Ga0208666_11095663 | 3300025102 | Marine | CLKVDGLKKTSDRLYNLKYNNPKTPERDQQVQELIDDIQATCKLIANDTQPYDK |
| Ga0208899_11067841 | 3300025759 | Aqueous | NNPKTKERDLEVDYLISDIQMICNLIANDKGKYDR |
| Ga0208917_12115301 | 3300025840 | Aqueous | YNLKYNNPKTPERDAEVNHLIEDIQFQCKLIANDKGEYDR |
| Ga0209308_1001002116 | 3300025869 | Pelagic Marine | GVKKTSDRLYNLKYNNIKTPERDQQIQELIDDIQATCKLIANDTQPYDK |
| Ga0209308_101019321 | 3300025869 | Pelagic Marine | YNIKYNNPKTPERDQQIQELIDDIQATCLLIANDKQPYDK |
| Ga0209632_103757921 | 3300025886 | Pelagic Marine | KSQADKLYTLKYNNPKTPERDAEINHLIDDIQATCKLIGQDTKPYDK |
| Ga0209962_10048088 | 3300026125 | Water | NLKYNNPKTPERDAEVNHLIDDIQYMCKMIGNDTSPYDK |
| Ga0209961_100114524 | 3300026130 | Water | KLYNLKYNNPKTPERDAEVNHLIDDIQYMCKMIGNDTSPYDK |
| Ga0209951_10058079 | 3300026138 | Pond Water | KLYNMKYNNPKTPERDMQIQELIDDIQATCKLIANDKQPYDK |
| Ga0209932_10583473 | 3300026183 | Pond Water | KLYNLKYNNPKTPERDAEINHLIDDIQYMCKIIGNDTSPYDK |
| Ga0209929_10133868 | 3300026187 | Pond Water | SDKLYNLKYNNPKTPERDAEINHLIDDIQYMCKIIGNDTSPYDK |
| Ga0208405_10118854 | 3300026189 | Marine | LYNLKYNHPKTPERDAEVNHLIEDIQSMCKVVGNDDKPYDL |
| Ga0208127_10059811 | 3300026201 | Marine | LKYNHPKTPERDAEVNHLIEDIQSMCKVVGNDDKPYDL |
| Ga0209192_1000804115 | 3300027752 | Marine | DRLYNLKYNNPKTPERDAQVAELIDDIQSTCLLIAKDVKPYDK |
| Ga0209192_1002030310 | 3300027752 | Marine | DRLYNLKYNNPKTPERDAQVAELIDDIQSTCLLIAKDVKPYDR |
| Ga0209830_102344221 | 3300027791 | Marine | YNLKYNNVKTPERDAEVNELINDIQATCLVIAKDTKPYDK |
| Ga0209091_104049331 | 3300027801 | Marine | DRLYNLKYNNPKTPERDAQVAELIDDIQSTCLLIAKDNKPYDK |
| Ga0315326_101300726 | 3300031775 | Seawater | YNNPKTPERDQQVQELIDDIQATCKLIANDTQPYDK |
| Ga0310344_110678701 | 3300032006 | Seawater | DGLKTLSTKLYEVKYNNPKTPERDAEVNHLIEDIQATCRLIANDKKPYDNG |
| Ga0315315_102811966 | 3300032073 | Seawater | DGIKKTSDRLYNLKYNNPKTPERDQQVQELIDDIQATCKLIANDTQPYDK |
| Ga0315315_114506081 | 3300032073 | Seawater | VDGVKKTSDRLYNLKYNNPKTPERDQQVQELIDDIQATCLLIAKDTQPYDK |
| Ga0315334_116700292 | 3300032360 | Seawater | KAQADKLYNLKYNNTKTPGRDAEINHLIEDIQSTCKIVGADKTPYQKG |
| ⦗Top⦘ |