NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F036032

Metagenome / Metatranscriptome Family F036032

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036032
Family Type Metagenome / Metatranscriptome
Number of Sequences 171
Average Sequence Length 43 residues
Representative Sequence LALNALDLMPRGFRLLVVQLRGSGARQPPLRAVHNRHHHFQIA
Number of Associated Samples 161
Number of Associated Scaffolds 171

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 26.32 %
% of genes near scaffold ends (potentially truncated) 23.39 %
% of genes from short scaffolds (< 2000 bps) 90.64 %
Associated GOLD sequencing projects 152
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.322 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(9.357 % of family members)
Environment Ontology (ENVO) Unclassified
(20.468 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.047 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.80%    β-sheet: 0.00%    Coil/Unstructured: 66.20%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 171 Family Scaffolds
PF13384HTH_23 23.39
PF00665rve 19.88
PF01695IstB_IS21 4.09
PF02195ParBc 1.75
PF00589Phage_integrase 1.17
PF16355DUF4982 0.58
PF13183Fer4_8 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 171 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 19.88
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 19.88
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 19.88
COG4584TransposaseMobilome: prophages, transposons [X] 19.88
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 4.09

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.32 %
UnclassifiedrootN/A4.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908041|P3_CLC_ConsensusfromContig83492All Organisms → cellular organisms → Bacteria1617Open in IMG/M
2140918006|ConsensusfromContig119092All Organisms → cellular organisms → Bacteria776Open in IMG/M
2140918007|ConsensusfromContig195764All Organisms → cellular organisms → Bacteria950Open in IMG/M
2140918024|NODE_190269_length_2220_cov_8.247747All Organisms → cellular organisms → Bacteria2270Open in IMG/M
3300000567|JGI12270J11330_10035724All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter2844Open in IMG/M
3300001356|JGI12269J14319_10169161All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300001385|JGI20193J14888_1015244All Organisms → cellular organisms → Bacteria1401Open in IMG/M
3300002068|JGIcombinedJ21913_10108131All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300002347|JGIcombinedJ26865_1054263All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300002558|JGI25385J37094_10107185All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300004019|Ga0055439_10026095All Organisms → cellular organisms → Bacteria1447Open in IMG/M
3300005179|Ga0066684_10758560All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300005340|Ga0070689_100994278All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300005355|Ga0070671_101390443All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300005518|Ga0070699_100666550All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300005526|Ga0073909_10614560All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300005559|Ga0066700_10975612All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300005568|Ga0066703_10156240All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1371Open in IMG/M
3300005587|Ga0066654_10080306All Organisms → cellular organisms → Bacteria1527Open in IMG/M
3300005602|Ga0070762_10750182All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300005944|Ga0066788_10035987All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300005949|Ga0066791_10034844All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300005980|Ga0066798_10222463All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium508Open in IMG/M
3300005993|Ga0080027_10268941All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300005995|Ga0066790_10109466All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300005995|Ga0066790_10171772All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300006034|Ga0066656_10115326All Organisms → cellular organisms → Bacteria1647Open in IMG/M
3300006050|Ga0075028_100964143All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300006052|Ga0075029_101117983All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300006059|Ga0075017_100537029All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300006162|Ga0075030_100039416All Organisms → cellular organisms → Bacteria3996Open in IMG/M
3300006358|Ga0068871_101578553All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300006642|Ga0075521_10547160Not Available569Open in IMG/M
3300006791|Ga0066653_10273376All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300006794|Ga0066658_10766265All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300006795|Ga0075520_1371283All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300006800|Ga0066660_10510188All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300006854|Ga0075425_102522784All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300006864|Ga0066797_1322813All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300006893|Ga0073928_10616211All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300009088|Ga0099830_10547899All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300009523|Ga0116221_1200514All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300009524|Ga0116225_1168379All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300009547|Ga0116136_1037003All Organisms → cellular organisms → Bacteria1444Open in IMG/M
3300009636|Ga0116112_1058256All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300009660|Ga0105854_1329284All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium540Open in IMG/M
3300009665|Ga0116135_1190752All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300009672|Ga0116215_1105454All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300009672|Ga0116215_1307361All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300009814|Ga0105082_1008866All Organisms → cellular organisms → Bacteria1396Open in IMG/M
3300009824|Ga0116219_10094851All Organisms → cellular organisms → Bacteria1743Open in IMG/M
3300010039|Ga0126309_10801316All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium615Open in IMG/M
3300010303|Ga0134082_10285732All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300010337|Ga0134062_10717293All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300010375|Ga0105239_11848030All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300011269|Ga0137392_11155050All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300012205|Ga0137362_10426094Not Available1149Open in IMG/M
3300012206|Ga0137380_11257310All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300012208|Ga0137376_10916617All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300012210|Ga0137378_10362843All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300012285|Ga0137370_11015601All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium510Open in IMG/M
3300012350|Ga0137372_10368083All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300012354|Ga0137366_10610648All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300012362|Ga0137361_11399630All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300012922|Ga0137394_10581057Not Available948Open in IMG/M
3300012958|Ga0164299_10203287All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300012960|Ga0164301_10278274All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300012972|Ga0134077_10080880All Organisms → cellular organisms → Bacteria1237Open in IMG/M
3300014169|Ga0181531_10125246All Organisms → cellular organisms → Bacteria1545Open in IMG/M
3300014201|Ga0181537_10466676All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300014490|Ga0182010_10138416All Organisms → cellular organisms → Bacteria1247Open in IMG/M
3300014490|Ga0182010_10371302All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300014494|Ga0182017_10033150All Organisms → cellular organisms → Bacteria3504Open in IMG/M
3300014495|Ga0182015_10956140Not Available534Open in IMG/M
3300014496|Ga0182011_10646647All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300014498|Ga0182019_11429162All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300014499|Ga0182012_10108933All Organisms → cellular organisms → Bacteria2064Open in IMG/M
3300014501|Ga0182024_11154947All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300014501|Ga0182024_12842633Not Available514Open in IMG/M
3300014654|Ga0181525_10484127All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300014658|Ga0181519_10042591All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3059Open in IMG/M
3300014839|Ga0182027_12103823All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300015082|Ga0167662_1047916All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium532Open in IMG/M
3300015197|Ga0167638_1028184All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1292Open in IMG/M
3300015245|Ga0137409_11014114All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300016270|Ga0182036_11861787All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300017941|Ga0187850_10324075All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300017948|Ga0187847_10108322All Organisms → cellular organisms → Bacteria1529Open in IMG/M
3300018004|Ga0187865_1296384Not Available534Open in IMG/M
3300018006|Ga0187804_10385530All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300018020|Ga0187861_10482342All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300018034|Ga0187863_10414613All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300018046|Ga0187851_10230016All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300018076|Ga0184609_10285190All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300020022|Ga0193733_1152507All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300021180|Ga0210396_11453242All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300021363|Ga0193699_10415287All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300021477|Ga0210398_10942027All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300021478|Ga0210402_10005292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus11581Open in IMG/M
3300022756|Ga0222622_10025729All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3068Open in IMG/M
3300023091|Ga0224559_1071824All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1326Open in IMG/M
3300024225|Ga0224572_1068934All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300024288|Ga0179589_10558537All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300025324|Ga0209640_10452859All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1052Open in IMG/M
3300025457|Ga0208850_1058687All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300025484|Ga0208587_1032881All Organisms → cellular organisms → Bacteria1430Open in IMG/M
3300025907|Ga0207645_10142740All Organisms → cellular organisms → Bacteria1560Open in IMG/M
3300025913|Ga0207695_10457177All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300025931|Ga0207644_11025727All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300025960|Ga0207651_11646033All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300026216|Ga0209903_1020915All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300026216|Ga0209903_1022270All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300026217|Ga0209871_1008558All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1925Open in IMG/M
3300026294|Ga0209839_10088846All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300026370|Ga0256816_1003424All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300026524|Ga0209690_1234971Not Available576Open in IMG/M
3300026537|Ga0209157_1149026All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300026982|Ga0207854_1017150All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300027273|Ga0209886_1019989All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300027590|Ga0209116_1104042All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300027625|Ga0208044_1058991All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300027641|Ga0208827_1216832Not Available503Open in IMG/M
3300027667|Ga0209009_1071415All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300027831|Ga0209797_10057108All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1733Open in IMG/M
3300027831|Ga0209797_10456163All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300027846|Ga0209180_10179734All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300027853|Ga0209274_10656410All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300027862|Ga0209701_10286490All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300027882|Ga0209590_10237896All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300027884|Ga0209275_10587055All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300027895|Ga0209624_10026453All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3682Open in IMG/M
3300027895|Ga0209624_10540047All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300027908|Ga0209006_10107301All Organisms → cellular organisms → Bacteria2473Open in IMG/M
3300028020|Ga0265351_1001558All Organisms → cellular organisms → Bacteria1559Open in IMG/M
3300028651|Ga0302171_10170840All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium537Open in IMG/M
3300028665|Ga0302160_10034056All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300028768|Ga0307280_10328635All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300029984|Ga0311332_10610082All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300030007|Ga0311338_11188922All Organisms → cellular organisms → Bacteria → Acidobacteria724Open in IMG/M
3300030019|Ga0311348_10143132All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1774Open in IMG/M
3300030399|Ga0311353_10695428All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300030659|Ga0316363_10034757All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2535Open in IMG/M
3300030707|Ga0310038_10340218All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300030737|Ga0302310_10446683All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300030763|Ga0265763_1036546All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300030838|Ga0311335_10967101All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300031122|Ga0170822_10952392All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300031231|Ga0170824_124891996All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300031234|Ga0302325_11956240All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300031236|Ga0302324_101852816All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300031344|Ga0265316_10558714All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300031446|Ga0170820_15895042All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300031474|Ga0170818_115101498All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300031521|Ga0311364_11650340All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300031823|Ga0307478_11274233All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300031938|Ga0308175_100170731All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2109Open in IMG/M
3300031939|Ga0308174_10186107All Organisms → cellular organisms → Bacteria1574Open in IMG/M
3300031996|Ga0308176_12066731All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300031996|Ga0308176_12821445All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300032074|Ga0308173_10096186All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2292Open in IMG/M
3300032076|Ga0306924_11356533All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300032160|Ga0311301_10025089All Organisms → cellular organisms → Bacteria → Acidobacteria16170Open in IMG/M
3300032160|Ga0311301_12507121All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300032160|Ga0311301_12751239All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300032770|Ga0335085_11453615All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300032828|Ga0335080_10172053All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2392Open in IMG/M
3300033402|Ga0326728_10178180All Organisms → cellular organisms → Bacteria → Acidobacteria2207Open in IMG/M
3300033433|Ga0326726_11852401All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300033486|Ga0316624_12180218All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300034065|Ga0334827_119763All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300034124|Ga0370483_0059558All Organisms → cellular organisms → Bacteria1216Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.36%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.19%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil5.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.09%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil4.09%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.51%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen3.51%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.51%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.34%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil2.34%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.92%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.92%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.75%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.17%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.17%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.17%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.17%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.17%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.17%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.17%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.17%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.58%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.58%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.58%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.58%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.58%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.58%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.58%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.58%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.58%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.58%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.58%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.58%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.58%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.58%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.58%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.58%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.58%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.58%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.58%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.58%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908041Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
2140918006Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1EnvironmentalOpen in IMG/M
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2140918024Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001385Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012EnvironmentalOpen in IMG/M
3300002068Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010)EnvironmentalOpen in IMG/M
3300002347Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219)EnvironmentalOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300005949Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051EnvironmentalOpen in IMG/M
3300005980Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009660Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009814Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015082Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300015197Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025457Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025484Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026216Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes)EnvironmentalOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026370Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 F5EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026982Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 7 (SPAdes)EnvironmentalOpen in IMG/M
3300027273Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028020Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4EnvironmentalOpen in IMG/M
3300028651Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_2EnvironmentalOpen in IMG/M
3300028665Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030763Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P3_CLC_012566302124908041SoilMELLLNALQLMPRGLALLVIQLRGSRARQPTLRAVHNRHHHFQIA
P1_C_019200402140918006SoilLALNALDLMPRGFALLGIQIRGRGASQSTLRAVHNRHHHLQIA
A_all_C_026159602140918007SoilLALNALDLMPRGFRLLVVQLRGSGARQPPLRAVHNRHHHFQIA
B_all_v_017542102140918024SoilMELLLNALQLMPRGLALLVIQLRGSRARQPTLRAAHNRHHHFQIA
JGI12270J11330_1003572433300000567Peatlands SoilMELFLNAIDLLPRGVRLLVIQIRGSGARQSPLRTVHNRHHHFQIA*
JGI12269J14319_1016916123300001356Peatlands SoilLALNALDLMPRGFRLLVIQLRDSGPRQSPLRAVHNRHHHFQIA*
JGI20193J14888_101524423300001385Arctic Peat SoilMELLLNALQLMLRGLALLVIQLRGSRARQPTLRAAHNRHHHFQIA*
JGIcombinedJ21913_1010813113300002068Arctic Peat SoilLNALQLMLRGLALLVIQLRGSRARQPTLRAAHNRHH
JGIcombinedJ26865_105426323300002347Arctic Peat SoilLNALQLMLRGLALLVIQLRGSRARQPTLRAAHNRHHHF
JGI25385J37094_1010718523300002558Grasslands SoilLVLNALDLMPRSLRLLVIQLRASGARQPPLRAVRNRHHHFQIA*
Ga0055439_1002609513300004019Natural And Restored WetlandsMELLLNTFQLIPRGLALLVIQLRGSCARQPTLRAVHNRHHHFQIA*
Ga0066684_1075856023300005179SoilLDYFVDAVELALNAFDLVPRGLRLLVIQLRGSGASQPPLRAVHNRHHHFQIA*
Ga0070689_10099427813300005340Switchgrass RhizosphereLNAVDLAPRGFALLVIQLRGSGAGQPPLRSVHNRGHHLQIP*
Ga0070671_10139044323300005355Switchgrass RhizosphereLNALDLALGGFAWLAIQLQSRGAGQSPVRTVHDRGHHLQIPYQFGR
Ga0070699_10066655023300005518Corn, Switchgrass And Miscanthus RhizosphereLNAIDLMPRRFRLLGIQLHGSGAGQPPLRAVHDRHHHFQIA*
Ga0073909_1061456013300005526Surface SoilLNAIDLAPRGFALLVIQLRGSGAGQPPLRSVHNRGHHLQIP*
Ga0066700_1097561223300005559SoilLALNALDLMPRSLRLLVIQLHGSGARQPPLRAVHNRHHHFQIA*
Ga0066703_1015624023300005568SoilLVLNALDLMPRSLRLLVIQLCGSGARQPPLRSVHNRHHHLQIA*
Ga0066654_1008030623300005587SoilLLLNAFNLVPCGFRLLVIQLRDNGARQPPLRAVHNRHHHFQIA*
Ga0070762_1075018213300005602SoilLVLNTLDLTPRGLRLLLIQLRNSGASQPPLRAVHNRHHHFQIA*
Ga0066788_1003598723300005944SoilLLLNAFDLVPCGFRLLVIQLRDNGARQPPLRAIHYCHHHFQIA*
Ga0066791_1003484423300005949SoilLALNALDLMPRGLRLLGIQLGGSSASQSPLRAIHNRCHHLQIA*
Ga0066798_1022246323300005980SoilLALNALDLMPRGFALLVIQLGDRCARQPPLRAVHNRHHHFQIA*
Ga0080027_1026894123300005993Prmafrost SoilLALNALDLMPRGFALLVVQLRGRGASQSTLRAVHNRHHHLQIA*
Ga0066790_1010946623300005995SoilMELLLNALDLMPRGLRLLVIQIGGRARQSPLRAVHNRHHHFQIA*
Ga0066790_1017177223300005995SoilLALNALDLMPRGFALLVVHLGGSGASQPPLRAVQNRHHHFQIA*
Ga0066656_1011532623300006034SoilLALNALDLMPRGFALLVIQLRGSGASQPPLRAVHNRHHHLQIA*
Ga0075028_10096414313300006050WatershedsVELLLNAVDLMPRGFRLLLIQLRGSGAGQPSLRAIHNRHHHLQ
Ga0075029_10111798313300006052WatershedsLVLNVVDLMPRGFELLVIQLRGSGARQPTMHAVRDGGHHFQIA*
Ga0075017_10053702923300006059WatershedsLALNAFYLMSRTFRLLLIQLRGSGAGQPPLRAVHDRHYHLQIA*
Ga0075030_10003941683300006162WatershedsLVLNALDLMPRGLALLGIQLRGSGAGQPPLRAGHNRHHHLQIA*
Ga0068871_10157855313300006358Miscanthus RhizosphereMELLLNALDLMPRGSRLLAIQLHGTGAGQPPLRAVHNPHHHFQIAQ
Ga0075521_1054716013300006642Arctic Peat SoilMELLLNALQLMLRGLALLVIQLRGSRARQPALRAVHNRHHHFQIA*
Ga0066653_1027337623300006791SoilLVLNALDLLPRSLRLLVIQLRGGSPRQPPLRAVHNRHHHFQIA*
Ga0066658_1076626533300006794SoilLNALDLMPRSLRLLVIQLRASGARQPPLRAVRNRHHHFQ
Ga0075520_137128323300006795Arctic Peat SoilMELLLNAFQLMPRGLALLVIQLRGSCARQPALRAVHNRHHHFQIA*
Ga0066660_1051018823300006800SoilLVLNTIDLVPCGLALLVIQLCGSGARQPPLRAAHNRHHHLQIS*
Ga0075425_10252278413300006854Populus RhizosphereVELFLNAIHLVPRGLRLLVIQLSGSGPRQPALRAVHNRHHHF
Ga0066797_132281313300006864SoilLDFFVDAMELLLNAVDLMPHGFALLGIQLHGSGPRQPAMRTVHNRHHHFQIA*
Ga0073928_1061621123300006893Iron-Sulfur Acid SpringLNAVDLMPRSLELLVIQLRGSGARQPTMRAVRDGGHHF
Ga0099830_1054789913300009088Vadose Zone SoilLVLNTIDLAPCGFALLVIQLGGSGARQPPLRAVHNRHHHLQIS*
Ga0116221_120051423300009523Peatlands SoilLLLNAFDLVPCGFRLLVIQLRDNGASQPPLRAVHNLHHHFQIA*
Ga0116225_116837923300009524Peatlands SoilMELLLNPIDLVPRGFRLLFIQLCGSGAGQPPLRAVDDRHHHLQVA*
Ga0116136_103700323300009547PeatlandVELLLNAFDLMPRGFRLLLIQLRDSGASQPPLRAVYNRYHHFQIA*
Ga0116112_105825623300009636PeatlandVELLLNAFDLMPRGFRLLLIQLRDSTARQPPLRAVHNRHHHFQIA*
Ga0105854_132928423300009660Permafrost SoilMPRGIRLLGIQIHGSGARQPSLRPVHNRHHHFQIA*
Ga0116135_119075223300009665PeatlandVAEFVLNALDLMPRGSRLLAVQLRGCGAGQSPLRAVHN
Ga0116215_110545423300009672Peatlands SoilLVLNALDLVLGGFRLLVIQLRGRGSGQPPVRAVYDRHHHFQIA*
Ga0116215_130736123300009672Peatlands SoilMELLLNALNLLPRGFRLLLIQFRGSGAGQPTLRAVHNRHHHFQIA*
Ga0105082_100886623300009814Groundwater SandLVLNALDLMPRGFRLLGIQLHGSGAGQPPLRAVHDGHHHI
Ga0116219_1009485123300009824Peatlands SoilVDLALNALDLLPRGFRLLVIQLRGSGARQSPLRAVHNRHHHLQVA*
Ga0126309_1080131623300010039Serpentine SoilLLLNAVDLMPRGFRLLGIQLRGSGARQPSLRAVHDRHHHFQIA*
Ga0134082_1028573223300010303Grasslands SoilLVLNTLDLMPRGFALLVVQLRGSGPRQPPLRSVHNRHHHFQIA*
Ga0134062_1071729323300010337Grasslands SoilLVLNALDLMPRSLRLLVIQLHGSGARQPPLRSVHDRRHHLQI
Ga0105239_1184803023300010375Corn RhizosphereLVLNALDLLPRSLRLLVIQLRGSSPHQPPLRAGHNRQRHFQIA*
Ga0137392_1115505023300011269Vadose Zone SoilLVFNTIDLAPCGIALLSIQFCDSGSGQPPLRAVHNRDHHLQIS*
Ga0137362_1042609423300012205Vadose Zone SoilLVLNAVDLMPRGLALLVIQLRGSGARQPPLGAVHNRDHHLQIS*
Ga0137380_1125731023300012206Vadose Zone SoilMELLLNALQLMPRGLALLVIQLRGSRARQPTLRAVHNRHHHFQIA*
Ga0137376_1091661713300012208Vadose Zone SoilLVLNALDLMPRGSRLLTIQLRRGGARQPPLRAVHNRHHHFQIA*
Ga0137378_1036284313300012210Vadose Zone SoilLVLNALDLLPRGLHLLVIQLCDSGARQPPLRAVHNRRHHLQIA*
Ga0137370_1101560123300012285Vadose Zone SoilLNTIDLMPRSFRLLVIQLCGARQPPLRSVHNRHHHLQIA*
Ga0137372_1036808313300012350Vadose Zone SoilLAFNTLDLMPRGFRLLVVQLRGSGARQPPLRAGHN
Ga0137366_1061064823300012354Vadose Zone SoilLAFNTLDLMPRGFRLLVVQLRGSGARQPPLRAVHNRHHHFQIA*
Ga0137361_1139963023300012362Vadose Zone SoilLTLNALDLIPRSLRLLVIQLCGSGARQPPLRSVHNR
Ga0137394_1058105723300012922Vadose Zone SoilLVLNAVDLMPRGLALLVIQLRGSGARQPPLRAVHNRHH
Ga0164299_1020328713300012958SoilLALNALDLMPRGFRLLVVQLRDRGASQSPLRAIHNRHHHLQIA*
Ga0164301_1027827413300012960SoilLALNALDLMPRGFRLLVVQLRDRGASQSPLRAIHNRHHRLQIA*
Ga0134077_1008088023300012972Grasslands SoilLNAVDLMLRGFALLVIQLRGSGARQPAMRAVHDGGHHFQIA*
Ga0181531_1012524613300014169BogVLNAVDLMPRGLALLVIQLRGSGARQPPMHSVHNRDHHLQIS*
Ga0181537_1046667623300014201BogLNALDLMPCGFRLLVIQLRSSGAGQSPLRTGYNRDHHLKVA*
Ga0182010_1013841613300014490FenLFLNAIDLLPRGFRLLVIQIRGGGAGQSPLRAVHDRQHHLQVA*
Ga0182010_1037130223300014490FenMELALNAVDLAPRGFRLLVIQLHGSGASQPSLRAGHDRHHHLQIA*
Ga0182017_1003315053300014494FenLFLNAIDLLPRGFRLLVIQIRGGGAGQSPLRAVHDRHH
Ga0182015_1095614023300014495PalsaLLLNAFNLVPCGFRLLVIQLRDSRARQPPLRTVHNRHHHFQIA*
Ga0182011_1064664723300014496FenLALNALDLMPRGFALLVVHLGGSGARQPTLRAVHNRHHHFQIA*
Ga0182019_1142916223300014498FenLFLNAFNLVPCGFRLLVIQLRDNGARQSPLRAVHNRHHHLQIA*
Ga0182012_1010893323300014499BogLLLNAFNLVPCGFRLLVIQLRDNGARQPPLRAVHNRHHHFQIAQ*
Ga0182024_1115494723300014501PermafrostMELLLNAVDLMPRSFALLVIQLGGSGGRQPTMRSVRDGGHHFQ
Ga0182024_1284263323300014501PermafrostMELLLNALDLVPRGFRLLVIQLRDSSARQPPLRAVHYRHHHFQIA*
Ga0181525_1048412733300014654BogLNAVDLMPRGFALLVIQLRGSGARQPTMRAVHNRDNHLQVA*
Ga0181519_1004259143300014658BogVLNAVDLMPRGFALLVIQLRGSGARQPPMHSVHNRDHHLQIS*
Ga0182027_1210382313300014839FenVELPLNPIDLVPRGFRLLFIQLCGSGAGQLPLRAVDDRHHHLQVA*
Ga0167662_104791623300015082Glacier Forefield SoilLNALDLMPRGFRLLVVQLRGSGARQPPLRAVHNRHHHFQIA*
Ga0167638_102818423300015197Glacier Forefield SoilLALNALDLMPRGFRLLRIQVHGSGASQPPLRAVHNRHHHFQIA*
Ga0137409_1101411423300015245Vadose Zone SoilLALNALNLMAYCFALLVVQLRGSGARQPPLGAVHNRDHHLQIS*
Ga0182036_1186178713300016270SoilMELLLNAIDLMPRGAALLVIQLRGSGAGQPPLRSVHNRHHHLQLAQEFSAGS
Ga0187850_1032407513300017941PeatlandLALNTLDLMPRGFRLLVIQLRHSGAGQLPLRAVHNRHHHFQIA
Ga0187847_1010832223300017948PeatlandVELLLNAFDLMPRGFRLLLIQLRDSGASQPPLRAVYNRYHHFQIA
Ga0187865_129638413300018004PeatlandVLNAVDLMPRGFALLVIQLRGSGARQPPMHSVHNRDHHLQIS
Ga0187804_1038553023300018006Freshwater SedimentMELLLNAIDLVPRGFRLLIIQLRGSGARQPPLRAVHNRHHHLQIA
Ga0187861_1048234213300018020PeatlandVAEFVLNALDLMPRGSRLLAVQLRGCGAGQSPLRAVHNRHHHFQIA
Ga0187863_1041461313300018034PeatlandLVLNAVDLMPRGFALLVIQLRDNGTRQPPLRAVHNRHHHFQIA
Ga0187851_1023001613300018046PeatlandLALNALDLMPRGFPLLVVQLRAGGARQPPLRAVHNRYHHFQIA
Ga0184609_1028519013300018076Groundwater SedimentLVLNALDLMPRSLRLLVIQLCGSSARQPPLRSVHNRHRHFQIA
Ga0193733_115250723300020022SoilLALNALDLMPRGFALLVVQLRGRCARQSTLRAVHNRHHHLQIA
Ga0210396_1145324223300021180SoilLNAFNLVPCGFRLLVIQLRDNGARQPPLRAVHNRHHHFQIA
Ga0193699_1041528723300021363SoilLNALDLMPRGLRLLVIQLRHSGARQSPLRAVHNRHHHFQIA
Ga0210398_1094202713300021477SoilMKLLLNAVDLMPRGCALLVIQLRGSGARQPTMRSVRDGGHHFQIA
Ga0210402_10005292103300021478SoilLALNALDLMPRGFRLLVVHLGGSGARQPPLRAVHNRHHHLQIA
Ga0222622_1002572953300022756Groundwater SedimentLALNALDLMPRGFALLVVQLLGRCARQSTLRAVHNRHHHLQIT
Ga0224559_107182423300023091SoilVELALNALDLMPRGFALLVVQLSGRCARQSTLRAVYNRHHHFEIA
Ga0224572_106893423300024225RhizosphereLNALNLAPRGVALLAIQIDRRRAGQPPLRAVHNRRHHFQIAEQFGARPRGRPGCSSL
Ga0179589_1055853713300024288Vadose Zone SoilLNALDLMLCGFALLGIQIRGSGASQSTLRPVHNRHHHLQIA
Ga0209640_1045285913300025324SoilMAELVLNALDLMPRGLRLLAIQLRGSGVGQPPLRPVHDRHHHFQIA
Ga0208850_105868713300025457Arctic Peat SoilMELLLNALQLMLRGLALLVIQLRGSRARQPTLRAAHNRHHHFQIA
Ga0208587_103288123300025484Arctic Peat SoilMELLLNALQLMPRGLALLVIQLRGCRARQPTLRAVHNRHHHFQIA
Ga0207645_1014274023300025907Miscanthus RhizosphereLNAFDLLPCGFRLLVIQLRRGGARQPPLRAVHNCHHHFQIA
Ga0207695_1045717713300025913Corn RhizosphereLNVLDLMPRDFCLLVIQLRGSGSGQPPLRAVHDRHHHLQIAQQFGA
Ga0207644_1102572723300025931Switchgrass RhizosphereLNAVDLAPRGLALLVIQLRGSGAGQPPLRSVHNRGY
Ga0207651_1164603313300025960Switchgrass RhizosphereLFLNAFNLVPCGFRLLVIQLRDNGARQPPLRAVHNRHHHFQIA
Ga0209903_102091513300026216SoilLLLNAFDLVPCGFRLLVIQLRDNGARQPPLRAIHYCHHHFQIA
Ga0209903_102227023300026216SoilLALNALDLMPRGLRLLGIQLGGSSASQSPLRAIHNRCHHLQIA
Ga0209871_100855813300026217Permafrost SoilMELLLNALDLMPRGFALLVIQLRGRGASQPPLGSVHNRYYHFQIA
Ga0209839_1008884623300026294SoilMELLLNALDLMPRGLRLLGIQLGGSSASQSPLRAIHNRCHHLQIA
Ga0256816_100342423300026370SedimentLVLNALDLMPRGSRLLAIQLRGSGAVQPPLRAVHDSHHHLQIPQQFGASPG
Ga0209690_123497123300026524SoilLALNALDLMPRSLRLLVIQLHGSGARQPPLRAVHNRHHHFQIA
Ga0209157_114902623300026537SoilLVLNALDLLPRSLRLLGIQLHGGGARQPPLRAVHNRHHHFQIA
Ga0207854_101715013300026982Tropical Forest SoilMKPFLNALDLMPRCFGLLVIQLHGSGARQPPLGAVYNRHHHLQIA
Ga0209886_101998923300027273Groundwater SandLNALDLMPRGFRLLGIQLHGSGAAQPPLRAVHDGHHHFQ
Ga0209116_110404223300027590Forest SoilLVLNVVDLTPRGFELLVIQLRGSGAREPTKRAVRDGGHHFQIA
Ga0208044_105899123300027625Peatlands SoilMELLLNALNLLPRGFRLLLIQFRGSGAGQPTLRAVHNRHHHFQIA
Ga0208827_121683223300027641Peatlands SoilLLLNAFDLVPCGFRLLVIQLRDNGASQPPLRAVHNLHPHFQIA
Ga0209009_107141513300027667Forest SoilLALNALDLMPRGFRLLVIQLRGSSASQPSLRAVHNRHYHFQIT
Ga0209797_1005710813300027831Wetland SedimentVDAAELVLNALDLLPRGFRLLRIQLHGCGASQPPLRPGHNRQRHFQIA
Ga0209797_1045616323300027831Wetland SedimentLVLNALDLMPRGFALLVVQFGGSGARQPPLRPVHNRHHHFQIA
Ga0209180_1017973423300027846Vadose Zone SoilLVLNALDLMPRSLRLLVIQLRASGARQPPLRAVRNRHHHFQIA
Ga0209274_1065641023300027853SoilLVLNALDLMPCGFRLLVIQLRGRGASQSPLRAVHNRHHHLQIA
Ga0209701_1028649023300027862Vadose Zone SoilLVLNTIDLAPCGFALLVIQLGGSGARQPPLRAVHNRHHHLQIAQ
Ga0209590_1023789613300027882Vadose Zone SoilLALNALDLMPRGFRLLGIQIDHRCAGQPPLRAAHNRGHHLQIP
Ga0209275_1058705523300027884SoilLVLNTLDLTPRGLRLLLIQLRNSGASQPPLRAVHNRHHHFQIA
Ga0209624_1002645313300027895Forest SoilMELLLNPIDLVPRGFRLLFIQLCGSGAGQPPLRAVDDSHHHLQVA
Ga0209624_1054004723300027895Forest SoilLLLNALNLVPCGFRLLVIQLRDNGARQPPLRAVHNRHHHFQIA
Ga0209006_1010730123300027908Forest SoilLLLNAFNLVPCGFRLLVIQLRDNGARQPPLRAVHNRHHHFQIA
Ga0265351_100155823300028020SoilLLLNAFNLVPCGFRLLVIQLRDSRARQPPLRTVHNRHHHFQIA
Ga0302171_1017084023300028651FenLALNALDLMPRGFRLLVIQLGGGGASQPPLRAVHNRHYHFQIA
Ga0302160_1003405623300028665FenMELLLNALDLMPRGFGLLVIQLRGSRARQPPLRAVHNRHYHF
Ga0307280_1032863523300028768SoilLALNTLDLMPRGFRLLVVQLRGSGARQPPLRAVHNRHHHFQIA
Ga0311332_1061008223300029984FenLLLNAFNLVPCGFRLLVIQFRDNGARQPPLRAVHNRHHHFQIA
Ga0311338_1118892223300030007PalsaMELPLNAVDLIPRGFALLVIQLRGGGARQPAMRSVRYGNHHFQIA
Ga0311348_1014313233300030019FenMELLLNALDLMPRGFGLLVIQLRGSRARQPPLRAVHNRHYHFQI
Ga0311353_1069542823300030399PalsaMELFFNTFDLMPRGFRLLVIQLRRGGGQSPLRTVHNRHHHFQIA
Ga0316363_1003475743300030659Peatlands SoilMELFLNAIDLLPRGVRLLVIQIRGSGARQSPLRTVHN
Ga0310038_1034021823300030707Peatlands SoilLVLNALDLVLGGFRLLVIQLRGRGSGQPPVRAVYDRHHHFQIA
Ga0302310_1044668323300030737PalsaVLNAVDLMPRGFALLLIQLRGSGARQPTMRAVRDGGHHFQIAQQFG
Ga0265763_103654623300030763SoilVELALNALDLMPRGLRLLVIQLGGRGASQPPLRAVHNRHHHFQIA
Ga0311335_1096710113300030838FenVNALDLMPCGFRLLVIQLRGCGASQSPLRAVHNRHHHLQIA
Ga0170822_1095239223300031122Forest SoilLNALDLMPRGFALLVIQLRGSGASQPPLRAVHNRHHHFQ
Ga0170824_12489199623300031231Forest SoilMELLLNAVDLMPRGFRLLLIQLRGSGASQSPLRAVHDRHHHFQIAQQFGARSG
Ga0302325_1195624023300031234PalsaLVLNAVNLMLRGVELLVIQLRGSGTSQPTMRAIRDGGHHFQIA
Ga0302324_10185281623300031236PalsaLVLNAVNLMLRGFELLVIQLRGSGTSQPTMRAIRDGGHHFQIA
Ga0265316_1055871423300031344RhizosphereLFLNAIDLLPRGFRLLVIQIRGGGAGQSPLRAVHDRHHHLQIA
Ga0170820_1589504213300031446Forest SoilLNAFNLVPCGFRLLVIQLRDNGARLPPLRAVHNRHHQ
Ga0170818_11510149823300031474Forest SoilLLLNAFNLVPCGFRSLVIQLRGNGARQPPLRAVHNRHHHFQIA
Ga0311364_1165034023300031521FenLLLNAFDLVSCGFRLLVIQLRDNGARQPPLRTVHNRHHHFQIA
Ga0307478_1127423323300031823Hardwood Forest SoilLNAIDLMPRRFRLLGIQLHGSGAGQPPLRAVHDRHHHFQIA
Ga0308175_10017073133300031938SoilVELALNALDLMPRGFALLVVQLSGRCARQSTLRAVHNRHHHFQIA
Ga0308174_1018610723300031939SoilVELALNALDLMPRGFRLLVVQLRDNGARQPPLRAVHNRHHHFQIA
Ga0308176_1206673113300031996SoilVELFLNAIHLVPRGLRLLVIQLSGSGPRQPALRAVHNRHHHFEIAQ
Ga0308176_1282144523300031996SoilMELLLNAIDLVSRGFRLLIIQFRGRGPRQPALRTVYNRHYHFQIAQQFGAR
Ga0308173_1009618613300032074SoilVELFLNAIHLVPRGLRLLVIQLSGSGPRQPALRAVHNRHH
Ga0306924_1135653323300032076SoilLYALDLMPRGFALLVIQLRDSGARQSPLRAVHNRHHHF
Ga0311301_1002508943300032160Peatlands SoilMELFLNAIDLLPRGVRLLVIQIRGSGARQSPLRTVHNRHHHFQIA
Ga0311301_1250712123300032160Peatlands SoilLNALDLMPRGFALLVVQLRGGGARQPPLRAVHNRRHHFQIAQQFGAGP
Ga0311301_1275123913300032160Peatlands SoilMELLLNPLDLVPRGFRLLVIQLRGGGAGQSPLRAVHDRRYHFQIAQQFG
Ga0335085_1145361523300032770SoilLVLNAVDLMPRGFALLVIQLRGSGARQPTMRSVRDGGHHLQIA
Ga0335080_1017205333300032828SoilLLLNAFNLVPCGFRFLVIQLRDNGARQPPLRAVHNRHHHFQIA
Ga0326728_1017818053300033402Peat SoilLLLNALDLAPRGFALLVIQLHGSGPGQPPLRAVHNRRHHLQIA
Ga0326726_1185240113300033433Peat SoilLALNAIDLMPRGFRLLGIQFHGCRTRQPSMRAVHDR
Ga0316624_1218021823300033486SoilMELLLNAIDLMPRGFRLLLIQLRGSCAGQPPLRAVHNRRYHFQ
Ga0334827_119763_642_7763300034065SoilLLLNAFNLVPCGFRLLVIQLRDNGARQPPLRAVHNRHHHFQIAQ
Ga0370483_0059558_858_9833300034124Untreated Peat SoilLNAFDLMPRGLRLLVVQIRGSGASQPPLRAVYNRHHHFQIA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.