NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F029499

Metagenome / Metatranscriptome Family F029499

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F029499
Family Type Metagenome / Metatranscriptome
Number of Sequences 188
Average Sequence Length 40 residues
Representative Sequence MRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW
Number of Associated Samples 148
Number of Associated Scaffolds 188

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 75.53 %
% of genes near scaffold ends (potentially truncated) 22.34 %
% of genes from short scaffolds (< 2000 bps) 93.62 %
Associated GOLD sequencing projects 141
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (66.489 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.170 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.489 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 51.47%    β-sheet: 0.00%    Coil/Unstructured: 48.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 188 Family Scaffolds
PF00027cNMP_binding 1.60
PF00486Trans_reg_C 1.06
PF05099TerB 1.06
PF00501AMP-binding 0.53
PF02245Pur_DNA_glyco 0.53
PF00581Rhodanese 0.53
PF00155Aminotran_1_2 0.53
PF16576HlyD_D23 0.53
PF00359PTS_EIIA_2 0.53
PF01431Peptidase_M13 0.53
PF09361Phasin_2 0.53
PF13406SLT_2 0.53
PF03092BT1 0.53
PF00285Citrate_synt 0.53
PF01757Acyl_transf_3 0.53
PF14023DUF4239 0.53
PF01965DJ-1_PfpI 0.53
PF13751DDE_Tnp_1_6 0.53
PF01799Fer2_2 0.53
PF02738MoCoBD_1 0.53
PF07721TPR_4 0.53
PF00083Sugar_tr 0.53
PF17200sCache_2 0.53

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 188 Family Scaffolds
COG3793Tellurite resistance protein TerBInorganic ion transport and metabolism [P] 1.06
COG0372Citrate synthaseEnergy production and conversion [C] 0.53
COG20943-methyladenine DNA glycosylase MpgReplication, recombination and repair [L] 0.53
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 0.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A66.49 %
All OrganismsrootAll Organisms33.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035918004|FACENC_F56XM5W01A48ZYNot Available547Open in IMG/M
2189573003|GZIR7W402GNRJANot Available508Open in IMG/M
2209111006|2214564396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1202Open in IMG/M
3300004058|Ga0055498_10068993Not Available662Open in IMG/M
3300004157|Ga0062590_102826052Not Available519Open in IMG/M
3300004480|Ga0062592_101801320Not Available599Open in IMG/M
3300005093|Ga0062594_100840464Not Available856Open in IMG/M
3300005093|Ga0062594_102448562Not Available572Open in IMG/M
3300005093|Ga0062594_102699296Not Available550Open in IMG/M
3300005105|Ga0066812_1002083Not Available1022Open in IMG/M
3300005158|Ga0066816_1008886Not Available715Open in IMG/M
3300005169|Ga0066810_10007019Not Available1545Open in IMG/M
3300005276|Ga0065717_1016783Not Available506Open in IMG/M
3300005294|Ga0065705_10552162Not Available738Open in IMG/M
3300005328|Ga0070676_10907435Not Available657Open in IMG/M
3300005328|Ga0070676_11566062Not Available509Open in IMG/M
3300005332|Ga0066388_100468119Not Available1900Open in IMG/M
3300005332|Ga0066388_101194676Not Available1299Open in IMG/M
3300005332|Ga0066388_104609462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium701Open in IMG/M
3300005332|Ga0066388_105339414Not Available652Open in IMG/M
3300005332|Ga0066388_106242007Not Available601Open in IMG/M
3300005347|Ga0070668_100493876Not Available1058Open in IMG/M
3300005365|Ga0070688_101034261Not Available654Open in IMG/M
3300005367|Ga0070667_100597488All Organisms → cellular organisms → Bacteria → Proteobacteria1016Open in IMG/M
3300005406|Ga0070703_10240554Not Available730Open in IMG/M
3300005439|Ga0070711_100643060Not Available888Open in IMG/M
3300005455|Ga0070663_101180838Not Available672Open in IMG/M
3300005459|Ga0068867_101821792Not Available573Open in IMG/M
3300005539|Ga0068853_101005949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium802Open in IMG/M
3300005547|Ga0070693_101452678Not Available535Open in IMG/M
3300005564|Ga0070664_101492604Not Available640Open in IMG/M
3300005614|Ga0068856_101902231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium606Open in IMG/M
3300005713|Ga0066905_100023360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium3348Open in IMG/M
3300005713|Ga0066905_100604800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium928Open in IMG/M
3300005713|Ga0066905_101796185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium565Open in IMG/M
3300005713|Ga0066905_102144499Not Available520Open in IMG/M
3300005713|Ga0066905_102188509Not Available515Open in IMG/M
3300005719|Ga0068861_102250683Not Available546Open in IMG/M
3300005764|Ga0066903_101294258All Organisms → cellular organisms → Bacteria1361Open in IMG/M
3300005764|Ga0066903_105401461Not Available674Open in IMG/M
3300005841|Ga0068863_102453489Not Available531Open in IMG/M
3300005843|Ga0068860_100568998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1136Open in IMG/M
3300005983|Ga0081540_1238127Not Available639Open in IMG/M
3300006175|Ga0070712_100593765Not Available937Open in IMG/M
3300006175|Ga0070712_100993872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium726Open in IMG/M
3300006196|Ga0075422_10291549Not Available697Open in IMG/M
3300006358|Ga0068871_102233797Not Available521Open in IMG/M
3300006573|Ga0074055_11266528Not Available548Open in IMG/M
3300006845|Ga0075421_100278101All Organisms → cellular organisms → Bacteria2043Open in IMG/M
3300006845|Ga0075421_100959844Not Available971Open in IMG/M
3300006845|Ga0075421_102518258Not Available536Open in IMG/M
3300006847|Ga0075431_100887577All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300006852|Ga0075433_10104179Not Available2514Open in IMG/M
3300006854|Ga0075425_101794602Not Available689Open in IMG/M
3300006904|Ga0075424_102054356Not Available603Open in IMG/M
3300009092|Ga0105250_10203688Not Available835Open in IMG/M
3300009093|Ga0105240_11846529Not Available629Open in IMG/M
3300009094|Ga0111539_11970215Not Available677Open in IMG/M
3300009146|Ga0105091_10026017All Organisms → cellular organisms → Bacteria2531Open in IMG/M
3300009147|Ga0114129_11286189All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium907Open in IMG/M
3300009147|Ga0114129_12416237Not Available629Open in IMG/M
3300009156|Ga0111538_10305615All Organisms → cellular organisms → Bacteria2013Open in IMG/M
3300009156|Ga0111538_12145551All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300009167|Ga0113563_13009384Not Available571Open in IMG/M
3300009304|Ga0116588_1070987Not Available800Open in IMG/M
3300009545|Ga0105237_11319534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria728Open in IMG/M
3300009545|Ga0105237_11932305Not Available598Open in IMG/M
3300009551|Ga0105238_10792729Not Available963Open in IMG/M
3300009553|Ga0105249_12638920Not Available575Open in IMG/M
3300009810|Ga0105088_1076382Not Available596Open in IMG/M
3300010043|Ga0126380_10356665Not Available1067Open in IMG/M
3300010046|Ga0126384_11554377Not Available621Open in IMG/M
3300010154|Ga0127503_10026071Not Available610Open in IMG/M
3300010154|Ga0127503_10347064Not Available765Open in IMG/M
3300010358|Ga0126370_10573344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. ATCC 49242969Open in IMG/M
3300010359|Ga0126376_10060162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium2731Open in IMG/M
3300010359|Ga0126376_10894346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium877Open in IMG/M
3300010360|Ga0126372_11594109Not Available691Open in IMG/M
3300010362|Ga0126377_12962579Not Available548Open in IMG/M
3300010371|Ga0134125_10767490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium1062Open in IMG/M
3300010371|Ga0134125_11095090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria872Open in IMG/M
3300010373|Ga0134128_11228694Not Available826Open in IMG/M
3300010375|Ga0105239_11465822Not Available788Open in IMG/M
3300010396|Ga0134126_10659874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1192Open in IMG/M
3300010398|Ga0126383_10697965Not Available1093Open in IMG/M
3300011119|Ga0105246_11218363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium694Open in IMG/M
3300012508|Ga0157315_1004194Not Available1017Open in IMG/M
3300012510|Ga0157316_1005940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium983Open in IMG/M
3300012908|Ga0157286_10310454Not Available581Open in IMG/M
3300012938|Ga0162651_100038732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium723Open in IMG/M
3300012948|Ga0126375_10993765Not Available682Open in IMG/M
3300012951|Ga0164300_10054167All Organisms → cellular organisms → Bacteria1598Open in IMG/M
3300012951|Ga0164300_10554724Not Available669Open in IMG/M
3300012951|Ga0164300_10897748Not Available560Open in IMG/M
3300012955|Ga0164298_10103021All Organisms → cellular organisms → Bacteria → Proteobacteria1515Open in IMG/M
3300012955|Ga0164298_10656312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium729Open in IMG/M
3300012957|Ga0164303_10059342Not Available1736Open in IMG/M
3300012957|Ga0164303_10339368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium903Open in IMG/M
3300012958|Ga0164299_10006543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4035Open in IMG/M
3300012958|Ga0164299_10344391Not Available935Open in IMG/M
3300012960|Ga0164301_10410146Not Available951Open in IMG/M
3300012960|Ga0164301_11783281Not Available517Open in IMG/M
3300012961|Ga0164302_10313806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1030Open in IMG/M
3300012987|Ga0164307_10685801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium801Open in IMG/M
3300012988|Ga0164306_10296592Not Available1178Open in IMG/M
3300013297|Ga0157378_11493996Not Available720Open in IMG/M
3300013306|Ga0163162_10789605Not Available1067Open in IMG/M
3300013306|Ga0163162_12104269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium647Open in IMG/M
3300013308|Ga0157375_11690822Not Available749Open in IMG/M
3300014326|Ga0157380_10774764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales973Open in IMG/M
3300014745|Ga0157377_10983125Not Available638Open in IMG/M
3300015371|Ga0132258_10957009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium2163Open in IMG/M
3300015371|Ga0132258_12352443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium1335Open in IMG/M
3300015371|Ga0132258_12403598All Organisms → cellular organisms → Bacteria → Proteobacteria1320Open in IMG/M
3300015372|Ga0132256_100960521Not Available970Open in IMG/M
3300015373|Ga0132257_102338665All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300015373|Ga0132257_103604644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium563Open in IMG/M
3300015374|Ga0132255_101715960Not Available953Open in IMG/M
3300017792|Ga0163161_10160549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1714Open in IMG/M
3300017947|Ga0187785_10216285All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300017997|Ga0184610_1291811Not Available538Open in IMG/M
3300018028|Ga0184608_10373988Not Available622Open in IMG/M
3300018054|Ga0184621_10074917Not Available1169Open in IMG/M
3300018072|Ga0184635_10377133Not Available540Open in IMG/M
3300018078|Ga0184612_10414160Not Available675Open in IMG/M
3300018081|Ga0184625_10102781All Organisms → cellular organisms → Bacteria → Proteobacteria1477Open in IMG/M
3300018465|Ga0190269_10301749Not Available934Open in IMG/M
3300018469|Ga0190270_11125690Not Available819Open in IMG/M
3300019356|Ga0173481_10190791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium880Open in IMG/M
3300019362|Ga0173479_10608864Not Available573Open in IMG/M
3300019458|Ga0187892_10000791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi79355Open in IMG/M
3300019767|Ga0190267_11448017Not Available525Open in IMG/M
3300021080|Ga0210382_10553869Not Available510Open in IMG/M
3300021081|Ga0210379_10456091Not Available567Open in IMG/M
3300022726|Ga0242654_10291599Not Available597Open in IMG/M
3300025904|Ga0207647_10098043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella silvestris1742Open in IMG/M
3300025913|Ga0207695_11537242Not Available546Open in IMG/M
3300025918|Ga0207662_10386440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium946Open in IMG/M
3300025926|Ga0207659_11112513Not Available680Open in IMG/M
3300025931|Ga0207644_11209645Not Available635Open in IMG/M
3300025936|Ga0207670_11244942Not Available630Open in IMG/M
3300025938|Ga0207704_11546090Not Available570Open in IMG/M
3300025949|Ga0207667_11884944Not Available560Open in IMG/M
3300025960|Ga0207651_10910016Not Available784Open in IMG/M
3300026075|Ga0207708_10079470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium2519Open in IMG/M
3300026075|Ga0207708_11563932Not Available579Open in IMG/M
3300026118|Ga0207675_102330705Not Available549Open in IMG/M
3300027332|Ga0209861_1068610Not Available521Open in IMG/M
3300027401|Ga0208637_1008304Not Available1018Open in IMG/M
3300027523|Ga0208890_1004638All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-41619Open in IMG/M
3300027665|Ga0209983_1068338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium790Open in IMG/M
3300027743|Ga0209593_10216665All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300027821|Ga0209811_10444092Not Available503Open in IMG/M
3300027876|Ga0209974_10067351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1218Open in IMG/M
3300027915|Ga0209069_10445378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium719Open in IMG/M
3300028380|Ga0268265_10914692All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium862Open in IMG/M
3300028592|Ga0247822_10178612All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300028597|Ga0247820_11028935Not Available589Open in IMG/M
3300028608|Ga0247819_10972858Not Available535Open in IMG/M
3300028889|Ga0247827_10926926Not Available587Open in IMG/M
3300031170|Ga0307498_10001121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3901Open in IMG/M
3300031547|Ga0310887_10121873Not Available1327Open in IMG/M
3300031562|Ga0310886_10992042Not Available538Open in IMG/M
3300031677|Ga0307480_1021996Not Available520Open in IMG/M
3300031720|Ga0307469_11513669Not Available643Open in IMG/M
3300031720|Ga0307469_11575465Not Available631Open in IMG/M
3300031740|Ga0307468_101637235Not Available603Open in IMG/M
3300031820|Ga0307473_11148196Not Available575Open in IMG/M
3300031847|Ga0310907_10860337Not Available511Open in IMG/M
3300031854|Ga0310904_10538739Not Available788Open in IMG/M
3300031858|Ga0310892_10189378Not Available1228Open in IMG/M
3300031943|Ga0310885_10592458Not Available614Open in IMG/M
3300031944|Ga0310884_10392267All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300031944|Ga0310884_10929738Not Available538Open in IMG/M
3300032013|Ga0310906_10002210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6102Open in IMG/M
3300032180|Ga0307471_102170088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales699Open in IMG/M
3300032205|Ga0307472_101257275Not Available710Open in IMG/M
3300032205|Ga0307472_101545423Not Available650Open in IMG/M
3300032205|Ga0307472_101716667Not Available621Open in IMG/M
3300032205|Ga0307472_102631463Not Available513Open in IMG/M
3300032211|Ga0310896_10793100Not Available542Open in IMG/M
3300033551|Ga0247830_10525325All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300033551|Ga0247830_10535504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria923Open in IMG/M
3300033551|Ga0247830_10916417All Organisms → cellular organisms → Bacteria → Proteobacteria698Open in IMG/M
3300033551|Ga0247830_11412069Not Available556Open in IMG/M
3300034414|Ga0373905_088243Not Available515Open in IMG/M
3300034661|Ga0314782_155735Not Available564Open in IMG/M
3300034817|Ga0373948_0205001Not Available516Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil10.11%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.38%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.32%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.19%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.66%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.13%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.13%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.13%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.60%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.06%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.06%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.06%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.06%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.06%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.06%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.06%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.06%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.06%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.53%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.53%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.53%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.53%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.53%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.53%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.53%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.53%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.53%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.53%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.53%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.53%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.53%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.53%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.53%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.53%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2035918004Soil microbial communities from sample at FACE Site 2 North Carolina CO2-EnvironmentalOpen in IMG/M
2189573003Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
2209111006Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0Host-AssociatedOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005105Soil and rhizosphere microbial communities from Laval, Canada - mgHPCEnvironmentalOpen in IMG/M
3300005158Soil and rhizosphere microbial communities from Laval, Canada - mgHAAEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005276Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009304Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_2 SPAdesEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012508Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510Host-AssociatedOpen in IMG/M
3300012510Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610Host-AssociatedOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027332Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027401Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031677Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034414Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A4.3EngineeredOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCA_52430102035918004SoilMRKSTTDRMNDYDVVVIGVLEPILVLSVMAVIAFLVRLFW
FE2_024238702189573003Grass SoilREMRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIGFLVRLSW
22136093652209111006Arabidopsis RhizosphereMRKSTTVRMNDYDAVVMGVLEPILVLSVMAVIAFLVW
Ga0055498_1006899313300004058Natural And Restored WetlandsMLKSPTDRMNDYDAVVMGVLEPILVLSVMALIPFLVWLFW*
Ga0062590_10282605223300004157SoilMRKSTTDRMNDYDAVVMGVLEPILVLSVMADIAFLARLFW*
Ga0062592_10180132013300004480SoilMRKSTTDRMDDYDAVVIGVLEPILVLSVMAVVAYLVRIFW*
Ga0062594_10084046423300005093SoilMRKSTTDGMNDDNAVVMGVLEPILVLSVMAVIAFLVRLFW*
Ga0062594_10244856213300005093SoilKREMRKSTTDRMDDYDAVVIGVLEPILVLSVMAVVAYLVRIFW*
Ga0062594_10269929613300005093SoilMRKSTTDSMNDYDAVVMGVLEPILVLSVMAVSAFLVRPFW*
Ga0066812_100208323300005105SoilMLKYTTDRMNDHDAVLMGVLEPILVLSVMAVVAFLVRLFW*
Ga0066816_100888623300005158SoilMLKSPTDRMNDYDAVVMGVLEPILVLSVMAVIGFLVRLSW*
Ga0066810_1000701923300005169SoilMRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLSW*
Ga0065717_101678313300005276Arabidopsis RhizosphereMWKSTTDRMNDYDAVLMGVLEPILVLSLMAVTTFLVRLFW*
Ga0065705_1055216213300005294Switchgrass RhizosphereMLKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW*
Ga0070676_1090743533300005328Miscanthus RhizosphereMRKSTTDRMNDYDAVMMGVLEPIFVLSVMAVIGALLGLL*
Ga0070676_1156606213300005328Miscanthus RhizosphereMRKSPTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVPLSW*
Ga0066388_10046811923300005332Tropical Forest SoilMLKSTIDRTNDSHALVMGVLEPFLVLSVMAGSAFLVQLFL*
Ga0066388_10119467633300005332Tropical Forest SoilMLKSPTDRMNEYVTVVMGVLEPILVLSVMAVIAFLMRIF*
Ga0066388_10460946213300005332Tropical Forest SoilLEMWKSTTHRMNDYDAVVMGVLEPILVLSVMAVSVFLAQLFW*
Ga0066388_10533941423300005332Tropical Forest SoilMLKSPTDRMNDFVAVVMGVLEPILVLSVMADIAFLVRLFW*
Ga0066388_10624200723300005332Tropical Forest SoilMRTSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW*
Ga0070668_10049387613300005347Switchgrass RhizosphereMRKSTTDRMNDYDVVVIGVLEPILVLSVMAVIAFLVRLSW*
Ga0070688_10103426113300005365Switchgrass RhizosphereMRKPTTERMNDYNAVVMGVLEPILVLSVMAVIAFLVPLSW*
Ga0070667_10059748833300005367Switchgrass RhizosphereMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVPLSW*
Ga0070703_1024055413300005406Corn, Switchgrass And Miscanthus RhizosphereMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVMAFLVPLSW*
Ga0070711_10064306013300005439Corn, Switchgrass And Miscanthus RhizosphereMRKSTTDRMNDYYAVVMGVLEPILVLSVMAVIAFLVRVF*
Ga0070663_10118083823300005455Corn RhizosphereMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW*
Ga0068867_10182179213300005459Miscanthus RhizosphereMWKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVPLPW*
Ga0068853_10100594913300005539Corn RhizosphereMWKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW*
Ga0070693_10145267823300005547Corn, Switchgrass And Miscanthus RhizosphereMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVPLPW*
Ga0070664_10149260423300005564Corn RhizosphereMRKSTTDRMDDYDAVVIGVLEPILVLSVMAVITFLVRLPW*
Ga0068856_10190223123300005614Corn RhizosphereMRNSTTDRMNENDAVVMGVLEPIVVLSVMAVIALMVRPFW*
Ga0066905_10002336023300005713Tropical Forest SoilMRTSTTDRMNDYDAVVMGVLEPILVLSVMAVIASLVRLFW*
Ga0066905_10060480013300005713Tropical Forest SoilMWKSTTHRMNDDDAVVMGVLEPILVLSVMAVSAFLVQLFC*
Ga0066905_10179618513300005713Tropical Forest SoilMWKSTTDRMNDYDVMVMGVLEPILVLSVMAVIAFLVRLFW*
Ga0066905_10214449923300005713Tropical Forest SoilMWKSTTDRMNDYDAVVMGVLEPILVLSVMAVSAFLVQLF
Ga0066905_10218850923300005713Tropical Forest SoilMRKSTTDRMNDYDAVVMGVLEPILVLSVMADIASLVRIFW*
Ga0068861_10225068323300005719Switchgrass RhizosphereMRKSTTDTMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW*
Ga0066903_10129425833300005764Tropical Forest SoilMQKYTTDRMNDYVTVVMGVLEPILVLSVMAVIAFLMRIF*
Ga0066903_10540146123300005764Tropical Forest SoilMWKSTTDRMNDYDAVVMGVLEPILVLSLMAVITFLVRLFW*
Ga0068863_10245348923300005841Switchgrass RhizosphereMRKSAIDRMNDYDAVMMGVLEPILVLSVMAVIAFLVPLSW*
Ga0068860_10056899833300005843Switchgrass RhizosphereMRKSAIDRMNDDDAVMMGVLEPILVLSVMAVIAFLVPLSW*
Ga0081540_123812713300005983Tabebuia Heterophylla RhizosphereMWKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLLW*
Ga0070712_10059376533300006175Corn, Switchgrass And Miscanthus RhizosphereMWKSATVRMNDYDAVVMGVLEPILVLSVMAVIGALLGLL*
Ga0070712_10099387223300006175Corn, Switchgrass And Miscanthus RhizosphereMLKSTTDRMNDYDAVVMGVLEPILVPSMLAVIAFLVRLFW*
Ga0075422_1029154923300006196Populus RhizosphereMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMRLFW*
Ga0068871_10223379713300006358Miscanthus RhizosphereMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIGALLGLL*
Ga0074055_1126652823300006573SoilMRKSTTDRMDDYDAVVMGVSEPILVLSVMADIAFLVRLFW*
Ga0075421_10027810133300006845Populus RhizosphereMRKSTTDRMNDYDAVVMGVLEPILPLLCIALIGAVLGLL*
Ga0075421_10095984413300006845Populus RhizosphereMRQSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFPMRLFW*
Ga0075421_10251825813300006845Populus RhizosphereLVLKPEMRKSTTDRTMNDYDAVVMGVLEPILVLSVMAVIAFLVRLSW*
Ga0075431_10088757713300006847Populus RhizosphereQRKREMRKSTTDRMNDYDAVVMGVLEPILPLLCIALIGAVLGLL*
Ga0075433_1010417933300006852Populus RhizosphereMRKSTTDTMNDYDVVVMGVLEPILVLSVMAVIAFLVRLSW*
Ga0075425_10179460213300006854Populus RhizosphereMRKSTTDRTMNDYDAVVMGVLEPILVLSVMAVIAFLVRLSW*
Ga0075424_10205435613300006904Populus RhizosphereMRKSTTDTMNDYDVVVMGVLEPILVLSVMAVIAFLVRLFW*
Ga0105250_1020368813300009092Switchgrass RhizosphereMNDYDAYDTIVMGVLEPILVLSVMAVIAFLVPLSW*
Ga0105240_1184652913300009093Corn RhizosphereMNDYDAYDAVVMGILEPILVLSVMAVIAFLVRLSW*
Ga0111539_1197021513300009094Populus RhizosphereMRKSMTDTMNDYDVYDAVVMGVLEPILVLSVMAVIAALLRLL*
Ga0105091_1002601713300009146Freshwater SedimentTDRMNDYDAVVMGVLEPILPLLCIALIGAVLGLL*
Ga0114129_1128618913300009147Populus RhizosphereLVLKPEMRKSTTDRTMNDYDAVVMGVLEPILVLSVMAVI
Ga0114129_1241623713300009147Populus RhizosphereMRKSTTDTMNDYDVYDAVVMGVLEPILVLSVMAVIAALLRLL*
Ga0111538_1030561513300009156Populus RhizosphereSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFPMRLFW*
Ga0111538_1214555113300009156Populus RhizosphereMRKSTTDSTNDYDAVMMGVLEPIFVLSVMAVIGALLGLL*
Ga0113563_1300938423300009167Freshwater WetlandsMNDYDAYDAVVMGVLEPILVLSVMAVIAFLVRLFW*
Ga0116588_107098723300009304SedimentMNDYDAVVMGVLEPILVLSVMAVIAFLVRNNLCC*
Ga0105237_1131953413300009545Corn RhizosphereMNDYDAYDAVVMGVLEPILVLSVMAVIAFLVRLTW*
Ga0105237_1193230523300009545Corn RhizosphereMRKSTTDTMNDYDVVVMGVLEPILVLSVMAVMAFLVPLSW*
Ga0105238_1079272913300009551Corn RhizosphereKQRKREMWKSTTDRMNNYDVVVMGVLEPILVLSVMAVIAFLVPLSW*
Ga0105249_1263892013300009553Switchgrass RhizosphereKSPTDRMNDCDAVVMAVLEPIVVLSVMAVIAFLVRLSW*
Ga0105088_107638213300009810Groundwater SandMRKSTTDRMNDYDVVVMGVLEPILVLSIAVIGALLGLL*
Ga0126380_1035666523300010043Tropical Forest SoilLKGITEMLKSTIDRTNDSHALVMGVLEPFLVLSVMAGSAFLVQLFL*
Ga0126384_1155437723300010046Tropical Forest SoilMNDYDAVVMGVLEPFLVLSVMAVIVFLARLFWTA*
Ga0127503_1002607123300010154SoilMRKSTTDRMNDYDAYDAVVMGVLEPILVLSMAVIGALLGLL*
Ga0127503_1034706423300010154SoilMRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFGWLS*
Ga0126370_1057334433300010358Tropical Forest SoilMQKYTTDRMNDYVTVVMGVLEPLLVLSVMAVIAFLMQIF*
Ga0126376_1006016253300010359Tropical Forest SoilMWKSTTDRMNNYDTVVMGVLEPILVLSVMAVIASLVRLFW*
Ga0126376_1089434633300010359Tropical Forest SoilMNDYDAVVMGVLEPFLVLSVMAAIVFLLRLFWTA*
Ga0126372_1159410913300010360Tropical Forest SoilMQKYTTDRMNDYFTVVMGVLEPILVLSVMAVIAFLMRIF*
Ga0126377_1296257913300010362Tropical Forest SoilTIDRMNDDDGVMMGVLEPILVLSVMAVIAFLVRLFW*
Ga0134125_1076749033300010371Terrestrial SoilMWTAKTDRMNDYDAVVMGILEPILVLSVMAVIASMVRLFW*
Ga0134125_1109509023300010371Terrestrial SoilKSTTDRMNDYDVVVMGVLEPILVLSVMAVISFLVRLPW*
Ga0134128_1122869413300010373Terrestrial SoilMRKSTTDRMNDYYAVVMGVLEPILVLSVMAVITFLVPLSW*
Ga0105239_1146582213300010375Corn RhizosphereKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMRLFW*
Ga0134126_1065987433300010396Terrestrial SoilMNDYDAYDAVVMGILEPILVLSVMAVIASMVRLFW*
Ga0126383_1069796533300010398Tropical Forest SoilMLKSPTDRMNDYDTVVMGVLEPILVMSVMAVIASLVRLFW*
Ga0105246_1121836313300011119Miscanthus RhizosphereMRKSTTDRMNDYDAYDAVVMGVLEPILVLSVMAVIGALLGLL*
Ga0157315_100419423300012508Arabidopsis RhizosphereMLKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVW*
Ga0157316_100594023300012510Arabidopsis RhizosphereMRKPTTERMNDYDAVVMGVLEPILVLSVMAVIAFLVW*
Ga0157286_1031045413300012908SoilMRKSTTDTMNDYDVVVMGVLEPILVLSVMAVIAALLRLL*
Ga0162651_10003873233300012938SoilMLKSTTDRMNDHDAVLMGVLEHILVLSVMAVIAFLVRLFW*
Ga0126375_1099376513300012948Tropical Forest SoilMRKSTTDRMNDYYAVVMGVLEPIFVLSVMAVIAFLMRIF*
Ga0164300_1005416713300012951SoilMWKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMPLSW*
Ga0164300_1055472423300012951SoilMRKSTTDRMNDYYAVVMGVLEPILVLSVMAVIAFLVRVSW*
Ga0164300_1089774813300012951SoilMWKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVPLSW*
Ga0164298_1010302113300012955SoilMLKSPTDRMNDFVAVVMGVLEPILVLSVMAVIAFLMRTLW*
Ga0164298_1065631233300012955SoilMRNSTTDRMNDYDAVVMGVLEPILVLSVMAVIAALLRLL*
Ga0164303_1005934213300012957SoilKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW*
Ga0164303_1033936823300012957SoilMWTAKTDRMNDYDAVVMGILEPMLVLSMMAVIGFLMRLFW*
Ga0164299_1000654333300012958SoilMLKSPTDRMNDFVAVVMGVLEPILVLSVMADIAFLVRILW*
Ga0164299_1034439113300012958SoilKQRKREMWKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMPLSW*
Ga0164301_1041014613300012960SoilKSATDRMDEYDAVMMGVLEPILVLSVMAVIAFLVPLSW*
Ga0164301_1178328113300012960SoilMRKSTTDSMNDYDAVVRGVLEPILVLSVMAVIAFLVW*
Ga0164302_1031380613300012961SoilEMRKSTTDRMNDYYAVVMGVLEPILVLSIAVIGALLALL*
Ga0164307_1068580123300012987SoilMRESTTDRMNDYDAYDAVVMGVLEPILVLSVMAVIAFLVRLFW*
Ga0164306_1029659233300012988SoilMRKSTTDRMNDYYAVVMGVLEPILVLSVMAVIAFLVLDL*
Ga0157378_1149399623300013297Miscanthus RhizosphereMWKSTTDRMNDYDVVVMGVLEPILVLSVMAVMAFLVPLSW*
Ga0163162_1078960513300013306Switchgrass RhizosphereTDRMNDYDAVVMGVLEPILVLSVMAVIGFLVRLSW*
Ga0163162_1210426913300013306Switchgrass RhizosphereEMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVPLSW*
Ga0157375_1169082213300013308Miscanthus RhizosphereMLKSTTDRTNDYDAVVMGVLEPMLVLSVMAVIAFLVPLSW*
Ga0157380_1077476413300014326Switchgrass RhizosphereRKREMRKSTTDRMKDYDAVMMGVLEPSFVLSVMAVIGALLGLL*
Ga0157377_1098312523300014745Miscanthus RhizosphereMLKSTTDRTNDYDAVVMGVLEPMLVLSVMAVIAFLVRLFW*
Ga0132258_1095700913300015371Arabidopsis RhizosphereMRKSTIDRMNDYDAYDAVVMGALEPILVLSVMAVIAALLRLL*
Ga0132258_1235244313300015371Arabidopsis RhizosphereMDPEMWNSTTDRMNDYNAVVMGVLEPILVLSVMAVIASLVRLFW*
Ga0132258_1240359823300015371Arabidopsis RhizosphereMWKSTTDRVNDYDAVVMGVLEPILVLSLMAVIAFLVRLSW*
Ga0132256_10096052113300015372Arabidopsis RhizosphereRKSTTDRMNDYDVVVIGVLEPILVLSVMAVIAFLVPLSW*
Ga0132257_10233866513300015373Arabidopsis RhizosphereMRKSTTDRMNDYDAVVMGVLEPILVLSLMAVIAFLVRLSW*
Ga0132257_10360464413300015373Arabidopsis RhizosphereSSREVMDPEMWNSTTDRMNDYNAVVMGVLEPILVLSVMAVIASLVRLFW*
Ga0132255_10171596033300015374Arabidopsis RhizosphereMRKSMTYRMNDYDNVVMGVLEPILVLSVMAVIASLVRLFW*
Ga0163161_1016054923300017792Switchgrass RhizosphereMRKSTTDRMNDYDVVMIGVLEPILVLSVMAVIAFLVPLSW
Ga0187785_1021628523300017947Tropical PeatlandEMRKSTTDRMNDYVPVVMGVLEPILVLSVMAVIAFLMRIF
Ga0184610_129181123300017997Groundwater SedimentMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW
Ga0184608_1037398813300018028Groundwater SedimentMLKSTTDRINDYDAVAMGVLEPILVLSVMAVSAFLLRLFW
Ga0184621_1007491723300018054Groundwater SedimentMRKSATDRMNGYDAVMMGVLEPILVLSVMAVIAFLVRLFW
Ga0184635_1037713313300018072Groundwater SedimentMRKSTTDRMNDYDAVVMAVLEPILVLSVMAVIAFLVRLSW
Ga0184612_1041416013300018078Groundwater SedimentMLKSTTDRMNDHDAVLMGVLEPILVLSVMAVIAFLVRLSW
Ga0184625_1010278123300018081Groundwater SedimentMLKSTTDRMNDHDAVLMGVLEPILVLSVMAVIAFLVRLFW
Ga0190269_1030174913300018465SoilMRKSTTDRMNDYDAYDAVVMGVLEPILVLSVMAVIAFVRRILW
Ga0190270_1112569023300018469SoilMRKSTTDRMDDYDAVVMGVLEPILVLSIVVIGALLGLL
Ga0173481_1019079133300019356SoilMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMRILW
Ga0173479_1060886413300019362SoilMRKSTTDRMDDYDAVVIGVLEPILVLSVMAVVAYLVRIFW
Ga0187892_10000791713300019458Bio-OozeMWKSTTHRMNDYDAVVMGVLEPILVLSVMAMSVFLAQLFW
Ga0190267_1144801713300019767SoilMRKSTTDRMNDYDAVVMGVLEPILVLSIAVIGAALLGLL
Ga0210382_1055386913300021080Groundwater SedimentMRKSTIHRMNDYDAVVMGVLEPILVLSVMAVSAFLVRLFW
Ga0210379_1045609113300021081Groundwater SedimentMLKSTTDRTNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW
Ga0242654_1029159913300022726SoilEMLKSPTDRMNDFVAVVMRVLEPILVLSVMAVIAFLMRTLW
Ga0207647_1009804323300025904Corn RhizosphereMRKSATDRMNDYDAVMMGVLEPIFVLSVMAVIGALLGLL
Ga0207695_1153724213300025913Corn RhizosphereMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVRLFW
Ga0207662_1038644033300025918Switchgrass RhizosphereMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVPLSW
Ga0207659_1111251323300025926Miscanthus RhizosphereMWKSTTDRMNDYDVVVMGVLEPILVLSVMAVMAFLVPLSW
Ga0207644_1120964523300025931Switchgrass RhizosphereMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVMAFLVPLSW
Ga0207670_1124494213300025936Switchgrass RhizosphereMRKSAIDRMNDYDAVMMGVLEPILVLSVMAVIAFLVPLSW
Ga0207704_1154609013300025938Miscanthus RhizosphereMRKSTTDRMNDYDAYDAVVMGVLEPILVLSVMAVIAFLVRLSW
Ga0207667_1188494413300025949Corn RhizosphereMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVRLSW
Ga0207651_1091001613300025960Switchgrass RhizosphereMWKSTTDRMNDYDVVVMGVLEPILVLSVMAVVAYLVRIFW
Ga0207708_1007947033300026075Corn, Switchgrass And Miscanthus RhizosphereMWKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVPLLR
Ga0207708_1156393213300026075Corn, Switchgrass And Miscanthus RhizosphereMWTAKTDRMNDYDAVVMGILEPILVLSVMAVIASMVRLFW
Ga0207675_10233070523300026118Switchgrass RhizosphereLKSTTDRMNDHDAVLMGILEPILVLSVMAVIAFLVRLFW
Ga0209861_106861023300027332Groundwater SandMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLLRLFW
Ga0208637_100830413300027401SoilMRKSATDRMNDYDAVMMGVLEPILVLSVMAVIAFLVRLFW
Ga0208890_100463823300027523SoilMRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW
Ga0209983_106833833300027665Arabidopsis Thaliana RhizosphereMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMRLFW
Ga0209593_1021666523300027743Freshwater SedimentMRKSTTDRMNDYDAVVMGVLEPILPLLYIALIGAVLGLL
Ga0209811_1044409223300027821Surface SoilMWKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVPLSW
Ga0209974_1006735133300027876Arabidopsis Thaliana RhizosphereMRKSTTDRTMNDYDAVVMGVLEPILVLSVMAVIAW
Ga0209069_1044537823300027915WatershedsMRKSTTDRMNDYDAVVMGVLEPILVLSIAVIGALLG
Ga0268265_1091469213300028380Switchgrass RhizosphereMRKSTTDRMNDYDVYDAVVMGVLEPILVLSVMAVIGALLGLL
Ga0247822_1017861213300028592SoilMLKSTTDRMNDHDAVLMGILEPILVLSVMAVIAFLVRLFW
Ga0247820_1102893513300028597SoilMRKSTTDRMNDYDAVVMGVLEPIFVLSVMAVVAYLVRIFW
Ga0247819_1097285813300028608SoilMLKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW
Ga0247827_1092692613300028889SoilMLKSPTDRMNDYDAVVMAVLEPIVVLSVMAVIAFLVRLFW
Ga0307498_1000112113300031170SoilMRKSATDRMNDYDAVMMGVLEPILVLSVMAVIAFLVPLSW
Ga0310887_1012187333300031547SoilMWKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMPLSW
Ga0310886_1099204223300031562SoilMRKSTTDRMDDYDAVVMAVLEPILVLSVMAVIAFLV
Ga0307480_102199623300031677Hardwood Forest SoilMRKSTTDRMNDYDAVMMGVLEPFFLLSVMATSAFLLRLFW
Ga0307469_1151366923300031720Hardwood Forest SoilMRKSTTDTMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW
Ga0307469_1157546513300031720Hardwood Forest SoilMRKSTTVRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW
Ga0307468_10163723523300031740Hardwood Forest SoilMRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLSW
Ga0307473_1114819613300031820Hardwood Forest SoilTHLKQRKREMWKSATVRMNDYDAVVMGVLEPILVLSVMAVIGALLGLL
Ga0310907_1086033723300031847SoilMRKSTTVRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLSW
Ga0310904_1053873913300031854SoilMRKPMTDRMDDYDVVVMGVLEPILVLSVMAVIAFLVQRFAM
Ga0310892_1018937823300031858SoilMRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVPLSW
Ga0310885_1059245813300031943SoilMRKSTTDRMDDYDAVMMGVLEPIFVLSVMAVIGALLGLL
Ga0310884_1039226723300031944SoilSTTVRMNDYEAVVMGVLEPILVLSVMAVIAFLVRLSW
Ga0310884_1092973813300031944SoilMRKSTIDRMNDYDAYDAVVMGILEPILVLSVMAVIAFLVRLSW
Ga0310906_1000221093300032013SoilEMRKSTTDRMDDYDGVVIGVLEPILVLSVMAVVAYLVRIFW
Ga0307471_10217008833300032180Hardwood Forest SoilMRKSATVRMNDYDAVVMGVLEPILVLSVMAVIGALLGLL
Ga0307472_10125727513300032205Hardwood Forest SoilMRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIGFLVRLSW
Ga0307472_10154542313300032205Hardwood Forest SoilSTTDTMNDYDAVVMGVLEPILVLSVMAVIAFLVPLSW
Ga0307472_10171666723300032205Hardwood Forest SoilMRKSTTDTMNDYDVVVMGVLEPILVLSVMAVITFLVRLSW
Ga0307472_10263146323300032205Hardwood Forest SoilMPEMRKSTTSMNNYDAVVMGVLEPILVLSVMAVIAFLVRLSW
Ga0310896_1079310023300032211SoilMRKSTTDRMNDYDAVMMGVLEPIFVLSVMAVIGALLGLL
Ga0247830_1052532523300033551SoilSLIALLAALAVQRKREMRKSTTDRMNDYDAVMMGVLEPIFVLSVMAVIGALLGLL
Ga0247830_1053550413300033551SoilSTTDRMDDYDAVVIGVLEPILVLSVMAVVAYLVRIFW
Ga0247830_1091641723300033551SoilMRKSTTDRMNDYDDYDAVVMGVLEPVLVLSVMAVIAFLVR
Ga0247830_1141206913300033551SoilMLKSPTDRMNDCDAVVMAVLEPIVVLSVMAVIAFLVRLFW
Ga0373905_088243_396_5033300034414Sediment SlurryMNDYDAYDAVVMGVLEPILVLSVMAVIAFLVRLSW
Ga0314782_155735_267_3953300034661SoilMRKSTTDRMNDYDAYDAVVMGVLEPILVLSVMAVIGALLGLL
Ga0373948_0205001_396_5153300034817Rhizosphere SoilMQKSTTDRMNDYDAVVMGVLEPILVLSVMADIAFLVGLFW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.