Basic Information | |
---|---|
Family ID | F029499 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 188 |
Average Sequence Length | 40 residues |
Representative Sequence | MRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW |
Number of Associated Samples | 148 |
Number of Associated Scaffolds | 188 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 75.53 % |
% of genes near scaffold ends (potentially truncated) | 22.34 % |
% of genes from short scaffolds (< 2000 bps) | 93.62 % |
Associated GOLD sequencing projects | 141 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (66.489 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.170 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.489 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 188 Family Scaffolds |
---|---|---|
PF00027 | cNMP_binding | 1.60 |
PF00486 | Trans_reg_C | 1.06 |
PF05099 | TerB | 1.06 |
PF00501 | AMP-binding | 0.53 |
PF02245 | Pur_DNA_glyco | 0.53 |
PF00581 | Rhodanese | 0.53 |
PF00155 | Aminotran_1_2 | 0.53 |
PF16576 | HlyD_D23 | 0.53 |
PF00359 | PTS_EIIA_2 | 0.53 |
PF01431 | Peptidase_M13 | 0.53 |
PF09361 | Phasin_2 | 0.53 |
PF13406 | SLT_2 | 0.53 |
PF03092 | BT1 | 0.53 |
PF00285 | Citrate_synt | 0.53 |
PF01757 | Acyl_transf_3 | 0.53 |
PF14023 | DUF4239 | 0.53 |
PF01965 | DJ-1_PfpI | 0.53 |
PF13751 | DDE_Tnp_1_6 | 0.53 |
PF01799 | Fer2_2 | 0.53 |
PF02738 | MoCoBD_1 | 0.53 |
PF07721 | TPR_4 | 0.53 |
PF00083 | Sugar_tr | 0.53 |
PF17200 | sCache_2 | 0.53 |
COG ID | Name | Functional Category | % Frequency in 188 Family Scaffolds |
---|---|---|---|
COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 1.06 |
COG0372 | Citrate synthase | Energy production and conversion [C] | 0.53 |
COG2094 | 3-methyladenine DNA glycosylase Mpg | Replication, recombination and repair [L] | 0.53 |
COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 66.49 % |
All Organisms | root | All Organisms | 33.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2035918004|FACENC_F56XM5W01A48ZY | Not Available | 547 | Open in IMG/M |
2189573003|GZIR7W402GNRJA | Not Available | 508 | Open in IMG/M |
2209111006|2214564396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1202 | Open in IMG/M |
3300004058|Ga0055498_10068993 | Not Available | 662 | Open in IMG/M |
3300004157|Ga0062590_102826052 | Not Available | 519 | Open in IMG/M |
3300004480|Ga0062592_101801320 | Not Available | 599 | Open in IMG/M |
3300005093|Ga0062594_100840464 | Not Available | 856 | Open in IMG/M |
3300005093|Ga0062594_102448562 | Not Available | 572 | Open in IMG/M |
3300005093|Ga0062594_102699296 | Not Available | 550 | Open in IMG/M |
3300005105|Ga0066812_1002083 | Not Available | 1022 | Open in IMG/M |
3300005158|Ga0066816_1008886 | Not Available | 715 | Open in IMG/M |
3300005169|Ga0066810_10007019 | Not Available | 1545 | Open in IMG/M |
3300005276|Ga0065717_1016783 | Not Available | 506 | Open in IMG/M |
3300005294|Ga0065705_10552162 | Not Available | 738 | Open in IMG/M |
3300005328|Ga0070676_10907435 | Not Available | 657 | Open in IMG/M |
3300005328|Ga0070676_11566062 | Not Available | 509 | Open in IMG/M |
3300005332|Ga0066388_100468119 | Not Available | 1900 | Open in IMG/M |
3300005332|Ga0066388_101194676 | Not Available | 1299 | Open in IMG/M |
3300005332|Ga0066388_104609462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 701 | Open in IMG/M |
3300005332|Ga0066388_105339414 | Not Available | 652 | Open in IMG/M |
3300005332|Ga0066388_106242007 | Not Available | 601 | Open in IMG/M |
3300005347|Ga0070668_100493876 | Not Available | 1058 | Open in IMG/M |
3300005365|Ga0070688_101034261 | Not Available | 654 | Open in IMG/M |
3300005367|Ga0070667_100597488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1016 | Open in IMG/M |
3300005406|Ga0070703_10240554 | Not Available | 730 | Open in IMG/M |
3300005439|Ga0070711_100643060 | Not Available | 888 | Open in IMG/M |
3300005455|Ga0070663_101180838 | Not Available | 672 | Open in IMG/M |
3300005459|Ga0068867_101821792 | Not Available | 573 | Open in IMG/M |
3300005539|Ga0068853_101005949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 802 | Open in IMG/M |
3300005547|Ga0070693_101452678 | Not Available | 535 | Open in IMG/M |
3300005564|Ga0070664_101492604 | Not Available | 640 | Open in IMG/M |
3300005614|Ga0068856_101902231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 606 | Open in IMG/M |
3300005713|Ga0066905_100023360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 3348 | Open in IMG/M |
3300005713|Ga0066905_100604800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 928 | Open in IMG/M |
3300005713|Ga0066905_101796185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 565 | Open in IMG/M |
3300005713|Ga0066905_102144499 | Not Available | 520 | Open in IMG/M |
3300005713|Ga0066905_102188509 | Not Available | 515 | Open in IMG/M |
3300005719|Ga0068861_102250683 | Not Available | 546 | Open in IMG/M |
3300005764|Ga0066903_101294258 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
3300005764|Ga0066903_105401461 | Not Available | 674 | Open in IMG/M |
3300005841|Ga0068863_102453489 | Not Available | 531 | Open in IMG/M |
3300005843|Ga0068860_100568998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1136 | Open in IMG/M |
3300005983|Ga0081540_1238127 | Not Available | 639 | Open in IMG/M |
3300006175|Ga0070712_100593765 | Not Available | 937 | Open in IMG/M |
3300006175|Ga0070712_100993872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 726 | Open in IMG/M |
3300006196|Ga0075422_10291549 | Not Available | 697 | Open in IMG/M |
3300006358|Ga0068871_102233797 | Not Available | 521 | Open in IMG/M |
3300006573|Ga0074055_11266528 | Not Available | 548 | Open in IMG/M |
3300006845|Ga0075421_100278101 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
3300006845|Ga0075421_100959844 | Not Available | 971 | Open in IMG/M |
3300006845|Ga0075421_102518258 | Not Available | 536 | Open in IMG/M |
3300006847|Ga0075431_100887577 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300006852|Ga0075433_10104179 | Not Available | 2514 | Open in IMG/M |
3300006854|Ga0075425_101794602 | Not Available | 689 | Open in IMG/M |
3300006904|Ga0075424_102054356 | Not Available | 603 | Open in IMG/M |
3300009092|Ga0105250_10203688 | Not Available | 835 | Open in IMG/M |
3300009093|Ga0105240_11846529 | Not Available | 629 | Open in IMG/M |
3300009094|Ga0111539_11970215 | Not Available | 677 | Open in IMG/M |
3300009146|Ga0105091_10026017 | All Organisms → cellular organisms → Bacteria | 2531 | Open in IMG/M |
3300009147|Ga0114129_11286189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 907 | Open in IMG/M |
3300009147|Ga0114129_12416237 | Not Available | 629 | Open in IMG/M |
3300009156|Ga0111538_10305615 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
3300009156|Ga0111538_12145551 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300009167|Ga0113563_13009384 | Not Available | 571 | Open in IMG/M |
3300009304|Ga0116588_1070987 | Not Available | 800 | Open in IMG/M |
3300009545|Ga0105237_11319534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 728 | Open in IMG/M |
3300009545|Ga0105237_11932305 | Not Available | 598 | Open in IMG/M |
3300009551|Ga0105238_10792729 | Not Available | 963 | Open in IMG/M |
3300009553|Ga0105249_12638920 | Not Available | 575 | Open in IMG/M |
3300009810|Ga0105088_1076382 | Not Available | 596 | Open in IMG/M |
3300010043|Ga0126380_10356665 | Not Available | 1067 | Open in IMG/M |
3300010046|Ga0126384_11554377 | Not Available | 621 | Open in IMG/M |
3300010154|Ga0127503_10026071 | Not Available | 610 | Open in IMG/M |
3300010154|Ga0127503_10347064 | Not Available | 765 | Open in IMG/M |
3300010358|Ga0126370_10573344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. ATCC 49242 | 969 | Open in IMG/M |
3300010359|Ga0126376_10060162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 2731 | Open in IMG/M |
3300010359|Ga0126376_10894346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 877 | Open in IMG/M |
3300010360|Ga0126372_11594109 | Not Available | 691 | Open in IMG/M |
3300010362|Ga0126377_12962579 | Not Available | 548 | Open in IMG/M |
3300010371|Ga0134125_10767490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1062 | Open in IMG/M |
3300010371|Ga0134125_11095090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 872 | Open in IMG/M |
3300010373|Ga0134128_11228694 | Not Available | 826 | Open in IMG/M |
3300010375|Ga0105239_11465822 | Not Available | 788 | Open in IMG/M |
3300010396|Ga0134126_10659874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1192 | Open in IMG/M |
3300010398|Ga0126383_10697965 | Not Available | 1093 | Open in IMG/M |
3300011119|Ga0105246_11218363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 694 | Open in IMG/M |
3300012508|Ga0157315_1004194 | Not Available | 1017 | Open in IMG/M |
3300012510|Ga0157316_1005940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 983 | Open in IMG/M |
3300012908|Ga0157286_10310454 | Not Available | 581 | Open in IMG/M |
3300012938|Ga0162651_100038732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 723 | Open in IMG/M |
3300012948|Ga0126375_10993765 | Not Available | 682 | Open in IMG/M |
3300012951|Ga0164300_10054167 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
3300012951|Ga0164300_10554724 | Not Available | 669 | Open in IMG/M |
3300012951|Ga0164300_10897748 | Not Available | 560 | Open in IMG/M |
3300012955|Ga0164298_10103021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1515 | Open in IMG/M |
3300012955|Ga0164298_10656312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 729 | Open in IMG/M |
3300012957|Ga0164303_10059342 | Not Available | 1736 | Open in IMG/M |
3300012957|Ga0164303_10339368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 903 | Open in IMG/M |
3300012958|Ga0164299_10006543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4035 | Open in IMG/M |
3300012958|Ga0164299_10344391 | Not Available | 935 | Open in IMG/M |
3300012960|Ga0164301_10410146 | Not Available | 951 | Open in IMG/M |
3300012960|Ga0164301_11783281 | Not Available | 517 | Open in IMG/M |
3300012961|Ga0164302_10313806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1030 | Open in IMG/M |
3300012987|Ga0164307_10685801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 801 | Open in IMG/M |
3300012988|Ga0164306_10296592 | Not Available | 1178 | Open in IMG/M |
3300013297|Ga0157378_11493996 | Not Available | 720 | Open in IMG/M |
3300013306|Ga0163162_10789605 | Not Available | 1067 | Open in IMG/M |
3300013306|Ga0163162_12104269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 647 | Open in IMG/M |
3300013308|Ga0157375_11690822 | Not Available | 749 | Open in IMG/M |
3300014326|Ga0157380_10774764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 973 | Open in IMG/M |
3300014745|Ga0157377_10983125 | Not Available | 638 | Open in IMG/M |
3300015371|Ga0132258_10957009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2163 | Open in IMG/M |
3300015371|Ga0132258_12352443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1335 | Open in IMG/M |
3300015371|Ga0132258_12403598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1320 | Open in IMG/M |
3300015372|Ga0132256_100960521 | Not Available | 970 | Open in IMG/M |
3300015373|Ga0132257_102338665 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300015373|Ga0132257_103604644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 563 | Open in IMG/M |
3300015374|Ga0132255_101715960 | Not Available | 953 | Open in IMG/M |
3300017792|Ga0163161_10160549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1714 | Open in IMG/M |
3300017947|Ga0187785_10216285 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300017997|Ga0184610_1291811 | Not Available | 538 | Open in IMG/M |
3300018028|Ga0184608_10373988 | Not Available | 622 | Open in IMG/M |
3300018054|Ga0184621_10074917 | Not Available | 1169 | Open in IMG/M |
3300018072|Ga0184635_10377133 | Not Available | 540 | Open in IMG/M |
3300018078|Ga0184612_10414160 | Not Available | 675 | Open in IMG/M |
3300018081|Ga0184625_10102781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1477 | Open in IMG/M |
3300018465|Ga0190269_10301749 | Not Available | 934 | Open in IMG/M |
3300018469|Ga0190270_11125690 | Not Available | 819 | Open in IMG/M |
3300019356|Ga0173481_10190791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 880 | Open in IMG/M |
3300019362|Ga0173479_10608864 | Not Available | 573 | Open in IMG/M |
3300019458|Ga0187892_10000791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 79355 | Open in IMG/M |
3300019767|Ga0190267_11448017 | Not Available | 525 | Open in IMG/M |
3300021080|Ga0210382_10553869 | Not Available | 510 | Open in IMG/M |
3300021081|Ga0210379_10456091 | Not Available | 567 | Open in IMG/M |
3300022726|Ga0242654_10291599 | Not Available | 597 | Open in IMG/M |
3300025904|Ga0207647_10098043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella silvestris | 1742 | Open in IMG/M |
3300025913|Ga0207695_11537242 | Not Available | 546 | Open in IMG/M |
3300025918|Ga0207662_10386440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 946 | Open in IMG/M |
3300025926|Ga0207659_11112513 | Not Available | 680 | Open in IMG/M |
3300025931|Ga0207644_11209645 | Not Available | 635 | Open in IMG/M |
3300025936|Ga0207670_11244942 | Not Available | 630 | Open in IMG/M |
3300025938|Ga0207704_11546090 | Not Available | 570 | Open in IMG/M |
3300025949|Ga0207667_11884944 | Not Available | 560 | Open in IMG/M |
3300025960|Ga0207651_10910016 | Not Available | 784 | Open in IMG/M |
3300026075|Ga0207708_10079470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 2519 | Open in IMG/M |
3300026075|Ga0207708_11563932 | Not Available | 579 | Open in IMG/M |
3300026118|Ga0207675_102330705 | Not Available | 549 | Open in IMG/M |
3300027332|Ga0209861_1068610 | Not Available | 521 | Open in IMG/M |
3300027401|Ga0208637_1008304 | Not Available | 1018 | Open in IMG/M |
3300027523|Ga0208890_1004638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4 | 1619 | Open in IMG/M |
3300027665|Ga0209983_1068338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 790 | Open in IMG/M |
3300027743|Ga0209593_10216665 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300027821|Ga0209811_10444092 | Not Available | 503 | Open in IMG/M |
3300027876|Ga0209974_10067351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1218 | Open in IMG/M |
3300027915|Ga0209069_10445378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 719 | Open in IMG/M |
3300028380|Ga0268265_10914692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 862 | Open in IMG/M |
3300028592|Ga0247822_10178612 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
3300028597|Ga0247820_11028935 | Not Available | 589 | Open in IMG/M |
3300028608|Ga0247819_10972858 | Not Available | 535 | Open in IMG/M |
3300028889|Ga0247827_10926926 | Not Available | 587 | Open in IMG/M |
3300031170|Ga0307498_10001121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3901 | Open in IMG/M |
3300031547|Ga0310887_10121873 | Not Available | 1327 | Open in IMG/M |
3300031562|Ga0310886_10992042 | Not Available | 538 | Open in IMG/M |
3300031677|Ga0307480_1021996 | Not Available | 520 | Open in IMG/M |
3300031720|Ga0307469_11513669 | Not Available | 643 | Open in IMG/M |
3300031720|Ga0307469_11575465 | Not Available | 631 | Open in IMG/M |
3300031740|Ga0307468_101637235 | Not Available | 603 | Open in IMG/M |
3300031820|Ga0307473_11148196 | Not Available | 575 | Open in IMG/M |
3300031847|Ga0310907_10860337 | Not Available | 511 | Open in IMG/M |
3300031854|Ga0310904_10538739 | Not Available | 788 | Open in IMG/M |
3300031858|Ga0310892_10189378 | Not Available | 1228 | Open in IMG/M |
3300031943|Ga0310885_10592458 | Not Available | 614 | Open in IMG/M |
3300031944|Ga0310884_10392267 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300031944|Ga0310884_10929738 | Not Available | 538 | Open in IMG/M |
3300032013|Ga0310906_10002210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6102 | Open in IMG/M |
3300032180|Ga0307471_102170088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 699 | Open in IMG/M |
3300032205|Ga0307472_101257275 | Not Available | 710 | Open in IMG/M |
3300032205|Ga0307472_101545423 | Not Available | 650 | Open in IMG/M |
3300032205|Ga0307472_101716667 | Not Available | 621 | Open in IMG/M |
3300032205|Ga0307472_102631463 | Not Available | 513 | Open in IMG/M |
3300032211|Ga0310896_10793100 | Not Available | 542 | Open in IMG/M |
3300033551|Ga0247830_10525325 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300033551|Ga0247830_10535504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 923 | Open in IMG/M |
3300033551|Ga0247830_10916417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
3300033551|Ga0247830_11412069 | Not Available | 556 | Open in IMG/M |
3300034414|Ga0373905_088243 | Not Available | 515 | Open in IMG/M |
3300034661|Ga0314782_155735 | Not Available | 564 | Open in IMG/M |
3300034817|Ga0373948_0205001 | Not Available | 516 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 10.11% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.91% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.38% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.32% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.72% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.72% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.19% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.66% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.13% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.13% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.13% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.60% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.06% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.06% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.06% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.06% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.06% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.06% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.06% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.06% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.06% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.53% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.53% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.53% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.53% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.53% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.53% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.53% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.53% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.53% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.53% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.53% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.53% |
Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.53% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
2189573003 | Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005105 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPC | Environmental | Open in IMG/M |
3300005158 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAA | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009304 | Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_2 SPAdes | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034414 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A4.3 | Engineered | Open in IMG/M |
3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACENCA_5243010 | 2035918004 | Soil | MRKSTTDRMNDYDVVVIGVLEPILVLSVMAVIAFLVRLFW |
FE2_02423870 | 2189573003 | Grass Soil | REMRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIGFLVRLSW |
2213609365 | 2209111006 | Arabidopsis Rhizosphere | MRKSTTVRMNDYDAVVMGVLEPILVLSVMAVIAFLVW |
Ga0055498_100689931 | 3300004058 | Natural And Restored Wetlands | MLKSPTDRMNDYDAVVMGVLEPILVLSVMALIPFLVWLFW* |
Ga0062590_1028260522 | 3300004157 | Soil | MRKSTTDRMNDYDAVVMGVLEPILVLSVMADIAFLARLFW* |
Ga0062592_1018013201 | 3300004480 | Soil | MRKSTTDRMDDYDAVVIGVLEPILVLSVMAVVAYLVRIFW* |
Ga0062594_1008404642 | 3300005093 | Soil | MRKSTTDGMNDDNAVVMGVLEPILVLSVMAVIAFLVRLFW* |
Ga0062594_1024485621 | 3300005093 | Soil | KREMRKSTTDRMDDYDAVVIGVLEPILVLSVMAVVAYLVRIFW* |
Ga0062594_1026992961 | 3300005093 | Soil | MRKSTTDSMNDYDAVVMGVLEPILVLSVMAVSAFLVRPFW* |
Ga0066812_10020832 | 3300005105 | Soil | MLKYTTDRMNDHDAVLMGVLEPILVLSVMAVVAFLVRLFW* |
Ga0066816_10088862 | 3300005158 | Soil | MLKSPTDRMNDYDAVVMGVLEPILVLSVMAVIGFLVRLSW* |
Ga0066810_100070192 | 3300005169 | Soil | MRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLSW* |
Ga0065717_10167831 | 3300005276 | Arabidopsis Rhizosphere | MWKSTTDRMNDYDAVLMGVLEPILVLSLMAVTTFLVRLFW* |
Ga0065705_105521621 | 3300005294 | Switchgrass Rhizosphere | MLKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW* |
Ga0070676_109074353 | 3300005328 | Miscanthus Rhizosphere | MRKSTTDRMNDYDAVMMGVLEPIFVLSVMAVIGALLGLL* |
Ga0070676_115660621 | 3300005328 | Miscanthus Rhizosphere | MRKSPTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVPLSW* |
Ga0066388_1004681192 | 3300005332 | Tropical Forest Soil | MLKSTIDRTNDSHALVMGVLEPFLVLSVMAGSAFLVQLFL* |
Ga0066388_1011946763 | 3300005332 | Tropical Forest Soil | MLKSPTDRMNEYVTVVMGVLEPILVLSVMAVIAFLMRIF* |
Ga0066388_1046094621 | 3300005332 | Tropical Forest Soil | LEMWKSTTHRMNDYDAVVMGVLEPILVLSVMAVSVFLAQLFW* |
Ga0066388_1053394142 | 3300005332 | Tropical Forest Soil | MLKSPTDRMNDFVAVVMGVLEPILVLSVMADIAFLVRLFW* |
Ga0066388_1062420072 | 3300005332 | Tropical Forest Soil | MRTSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW* |
Ga0070668_1004938761 | 3300005347 | Switchgrass Rhizosphere | MRKSTTDRMNDYDVVVIGVLEPILVLSVMAVIAFLVRLSW* |
Ga0070688_1010342611 | 3300005365 | Switchgrass Rhizosphere | MRKPTTERMNDYNAVVMGVLEPILVLSVMAVIAFLVPLSW* |
Ga0070667_1005974883 | 3300005367 | Switchgrass Rhizosphere | MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVPLSW* |
Ga0070703_102405541 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVMAFLVPLSW* |
Ga0070711_1006430601 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKSTTDRMNDYYAVVMGVLEPILVLSVMAVIAFLVRVF* |
Ga0070663_1011808382 | 3300005455 | Corn Rhizosphere | MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW* |
Ga0068867_1018217921 | 3300005459 | Miscanthus Rhizosphere | MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVPLPW* |
Ga0068853_1010059491 | 3300005539 | Corn Rhizosphere | MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW* |
Ga0070693_1014526782 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVPLPW* |
Ga0070664_1014926042 | 3300005564 | Corn Rhizosphere | MRKSTTDRMDDYDAVVIGVLEPILVLSVMAVITFLVRLPW* |
Ga0068856_1019022312 | 3300005614 | Corn Rhizosphere | MRNSTTDRMNENDAVVMGVLEPIVVLSVMAVIALMVRPFW* |
Ga0066905_1000233602 | 3300005713 | Tropical Forest Soil | MRTSTTDRMNDYDAVVMGVLEPILVLSVMAVIASLVRLFW* |
Ga0066905_1006048001 | 3300005713 | Tropical Forest Soil | MWKSTTHRMNDDDAVVMGVLEPILVLSVMAVSAFLVQLFC* |
Ga0066905_1017961851 | 3300005713 | Tropical Forest Soil | MWKSTTDRMNDYDVMVMGVLEPILVLSVMAVIAFLVRLFW* |
Ga0066905_1021444992 | 3300005713 | Tropical Forest Soil | MWKSTTDRMNDYDAVVMGVLEPILVLSVMAVSAFLVQLF |
Ga0066905_1021885092 | 3300005713 | Tropical Forest Soil | MRKSTTDRMNDYDAVVMGVLEPILVLSVMADIASLVRIFW* |
Ga0068861_1022506832 | 3300005719 | Switchgrass Rhizosphere | MRKSTTDTMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW* |
Ga0066903_1012942583 | 3300005764 | Tropical Forest Soil | MQKYTTDRMNDYVTVVMGVLEPILVLSVMAVIAFLMRIF* |
Ga0066903_1054014612 | 3300005764 | Tropical Forest Soil | MWKSTTDRMNDYDAVVMGVLEPILVLSLMAVITFLVRLFW* |
Ga0068863_1024534892 | 3300005841 | Switchgrass Rhizosphere | MRKSAIDRMNDYDAVMMGVLEPILVLSVMAVIAFLVPLSW* |
Ga0068860_1005689983 | 3300005843 | Switchgrass Rhizosphere | MRKSAIDRMNDDDAVMMGVLEPILVLSVMAVIAFLVPLSW* |
Ga0081540_12381271 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MWKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLLW* |
Ga0070712_1005937653 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MWKSATVRMNDYDAVVMGVLEPILVLSVMAVIGALLGLL* |
Ga0070712_1009938722 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKSTTDRMNDYDAVVMGVLEPILVPSMLAVIAFLVRLFW* |
Ga0075422_102915492 | 3300006196 | Populus Rhizosphere | MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMRLFW* |
Ga0068871_1022337971 | 3300006358 | Miscanthus Rhizosphere | MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIGALLGLL* |
Ga0074055_112665282 | 3300006573 | Soil | MRKSTTDRMDDYDAVVMGVSEPILVLSVMADIAFLVRLFW* |
Ga0075421_1002781013 | 3300006845 | Populus Rhizosphere | MRKSTTDRMNDYDAVVMGVLEPILPLLCIALIGAVLGLL* |
Ga0075421_1009598441 | 3300006845 | Populus Rhizosphere | MRQSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFPMRLFW* |
Ga0075421_1025182581 | 3300006845 | Populus Rhizosphere | LVLKPEMRKSTTDRTMNDYDAVVMGVLEPILVLSVMAVIAFLVRLSW* |
Ga0075431_1008875771 | 3300006847 | Populus Rhizosphere | QRKREMRKSTTDRMNDYDAVVMGVLEPILPLLCIALIGAVLGLL* |
Ga0075433_101041793 | 3300006852 | Populus Rhizosphere | MRKSTTDTMNDYDVVVMGVLEPILVLSVMAVIAFLVRLSW* |
Ga0075425_1017946021 | 3300006854 | Populus Rhizosphere | MRKSTTDRTMNDYDAVVMGVLEPILVLSVMAVIAFLVRLSW* |
Ga0075424_1020543561 | 3300006904 | Populus Rhizosphere | MRKSTTDTMNDYDVVVMGVLEPILVLSVMAVIAFLVRLFW* |
Ga0105250_102036881 | 3300009092 | Switchgrass Rhizosphere | MNDYDAYDTIVMGVLEPILVLSVMAVIAFLVPLSW* |
Ga0105240_118465291 | 3300009093 | Corn Rhizosphere | MNDYDAYDAVVMGILEPILVLSVMAVIAFLVRLSW* |
Ga0111539_119702151 | 3300009094 | Populus Rhizosphere | MRKSMTDTMNDYDVYDAVVMGVLEPILVLSVMAVIAALLRLL* |
Ga0105091_100260171 | 3300009146 | Freshwater Sediment | TDRMNDYDAVVMGVLEPILPLLCIALIGAVLGLL* |
Ga0114129_112861891 | 3300009147 | Populus Rhizosphere | LVLKPEMRKSTTDRTMNDYDAVVMGVLEPILVLSVMAVI |
Ga0114129_124162371 | 3300009147 | Populus Rhizosphere | MRKSTTDTMNDYDVYDAVVMGVLEPILVLSVMAVIAALLRLL* |
Ga0111538_103056151 | 3300009156 | Populus Rhizosphere | STTDRMNDYDAVVMGVLEPILVLSVMAVIAFPMRLFW* |
Ga0111538_121455511 | 3300009156 | Populus Rhizosphere | MRKSTTDSTNDYDAVMMGVLEPIFVLSVMAVIGALLGLL* |
Ga0113563_130093842 | 3300009167 | Freshwater Wetlands | MNDYDAYDAVVMGVLEPILVLSVMAVIAFLVRLFW* |
Ga0116588_10709872 | 3300009304 | Sediment | MNDYDAVVMGVLEPILVLSVMAVIAFLVRNNLCC* |
Ga0105237_113195341 | 3300009545 | Corn Rhizosphere | MNDYDAYDAVVMGVLEPILVLSVMAVIAFLVRLTW* |
Ga0105237_119323052 | 3300009545 | Corn Rhizosphere | MRKSTTDTMNDYDVVVMGVLEPILVLSVMAVMAFLVPLSW* |
Ga0105238_107927291 | 3300009551 | Corn Rhizosphere | KQRKREMWKSTTDRMNNYDVVVMGVLEPILVLSVMAVIAFLVPLSW* |
Ga0105249_126389201 | 3300009553 | Switchgrass Rhizosphere | KSPTDRMNDCDAVVMAVLEPIVVLSVMAVIAFLVRLSW* |
Ga0105088_10763821 | 3300009810 | Groundwater Sand | MRKSTTDRMNDYDVVVMGVLEPILVLSIAVIGALLGLL* |
Ga0126380_103566652 | 3300010043 | Tropical Forest Soil | LKGITEMLKSTIDRTNDSHALVMGVLEPFLVLSVMAGSAFLVQLFL* |
Ga0126384_115543772 | 3300010046 | Tropical Forest Soil | MNDYDAVVMGVLEPFLVLSVMAVIVFLARLFWTA* |
Ga0127503_100260712 | 3300010154 | Soil | MRKSTTDRMNDYDAYDAVVMGVLEPILVLSMAVIGALLGLL* |
Ga0127503_103470642 | 3300010154 | Soil | MRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFGWLS* |
Ga0126370_105733443 | 3300010358 | Tropical Forest Soil | MQKYTTDRMNDYVTVVMGVLEPLLVLSVMAVIAFLMQIF* |
Ga0126376_100601625 | 3300010359 | Tropical Forest Soil | MWKSTTDRMNNYDTVVMGVLEPILVLSVMAVIASLVRLFW* |
Ga0126376_108943463 | 3300010359 | Tropical Forest Soil | MNDYDAVVMGVLEPFLVLSVMAAIVFLLRLFWTA* |
Ga0126372_115941091 | 3300010360 | Tropical Forest Soil | MQKYTTDRMNDYFTVVMGVLEPILVLSVMAVIAFLMRIF* |
Ga0126377_129625791 | 3300010362 | Tropical Forest Soil | TIDRMNDDDGVMMGVLEPILVLSVMAVIAFLVRLFW* |
Ga0134125_107674903 | 3300010371 | Terrestrial Soil | MWTAKTDRMNDYDAVVMGILEPILVLSVMAVIASMVRLFW* |
Ga0134125_110950902 | 3300010371 | Terrestrial Soil | KSTTDRMNDYDVVVMGVLEPILVLSVMAVISFLVRLPW* |
Ga0134128_112286941 | 3300010373 | Terrestrial Soil | MRKSTTDRMNDYYAVVMGVLEPILVLSVMAVITFLVPLSW* |
Ga0105239_114658221 | 3300010375 | Corn Rhizosphere | KSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMRLFW* |
Ga0134126_106598743 | 3300010396 | Terrestrial Soil | MNDYDAYDAVVMGILEPILVLSVMAVIASMVRLFW* |
Ga0126383_106979653 | 3300010398 | Tropical Forest Soil | MLKSPTDRMNDYDTVVMGVLEPILVMSVMAVIASLVRLFW* |
Ga0105246_112183631 | 3300011119 | Miscanthus Rhizosphere | MRKSTTDRMNDYDAYDAVVMGVLEPILVLSVMAVIGALLGLL* |
Ga0157315_10041942 | 3300012508 | Arabidopsis Rhizosphere | MLKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVW* |
Ga0157316_10059402 | 3300012510 | Arabidopsis Rhizosphere | MRKPTTERMNDYDAVVMGVLEPILVLSVMAVIAFLVW* |
Ga0157286_103104541 | 3300012908 | Soil | MRKSTTDTMNDYDVVVMGVLEPILVLSVMAVIAALLRLL* |
Ga0162651_1000387323 | 3300012938 | Soil | MLKSTTDRMNDHDAVLMGVLEHILVLSVMAVIAFLVRLFW* |
Ga0126375_109937651 | 3300012948 | Tropical Forest Soil | MRKSTTDRMNDYYAVVMGVLEPIFVLSVMAVIAFLMRIF* |
Ga0164300_100541671 | 3300012951 | Soil | MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMPLSW* |
Ga0164300_105547242 | 3300012951 | Soil | MRKSTTDRMNDYYAVVMGVLEPILVLSVMAVIAFLVRVSW* |
Ga0164300_108977481 | 3300012951 | Soil | MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVPLSW* |
Ga0164298_101030211 | 3300012955 | Soil | MLKSPTDRMNDFVAVVMGVLEPILVLSVMAVIAFLMRTLW* |
Ga0164298_106563123 | 3300012955 | Soil | MRNSTTDRMNDYDAVVMGVLEPILVLSVMAVIAALLRLL* |
Ga0164303_100593421 | 3300012957 | Soil | KSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW* |
Ga0164303_103393682 | 3300012957 | Soil | MWTAKTDRMNDYDAVVMGILEPMLVLSMMAVIGFLMRLFW* |
Ga0164299_100065433 | 3300012958 | Soil | MLKSPTDRMNDFVAVVMGVLEPILVLSVMADIAFLVRILW* |
Ga0164299_103443911 | 3300012958 | Soil | KQRKREMWKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMPLSW* |
Ga0164301_104101461 | 3300012960 | Soil | KSATDRMDEYDAVMMGVLEPILVLSVMAVIAFLVPLSW* |
Ga0164301_117832811 | 3300012960 | Soil | MRKSTTDSMNDYDAVVRGVLEPILVLSVMAVIAFLVW* |
Ga0164302_103138061 | 3300012961 | Soil | EMRKSTTDRMNDYYAVVMGVLEPILVLSIAVIGALLALL* |
Ga0164307_106858012 | 3300012987 | Soil | MRESTTDRMNDYDAYDAVVMGVLEPILVLSVMAVIAFLVRLFW* |
Ga0164306_102965923 | 3300012988 | Soil | MRKSTTDRMNDYYAVVMGVLEPILVLSVMAVIAFLVLDL* |
Ga0157378_114939962 | 3300013297 | Miscanthus Rhizosphere | MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVMAFLVPLSW* |
Ga0163162_107896051 | 3300013306 | Switchgrass Rhizosphere | TDRMNDYDAVVMGVLEPILVLSVMAVIGFLVRLSW* |
Ga0163162_121042691 | 3300013306 | Switchgrass Rhizosphere | EMRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVPLSW* |
Ga0157375_116908221 | 3300013308 | Miscanthus Rhizosphere | MLKSTTDRTNDYDAVVMGVLEPMLVLSVMAVIAFLVPLSW* |
Ga0157380_107747641 | 3300014326 | Switchgrass Rhizosphere | RKREMRKSTTDRMKDYDAVMMGVLEPSFVLSVMAVIGALLGLL* |
Ga0157377_109831252 | 3300014745 | Miscanthus Rhizosphere | MLKSTTDRTNDYDAVVMGVLEPMLVLSVMAVIAFLVRLFW* |
Ga0132258_109570091 | 3300015371 | Arabidopsis Rhizosphere | MRKSTIDRMNDYDAYDAVVMGALEPILVLSVMAVIAALLRLL* |
Ga0132258_123524431 | 3300015371 | Arabidopsis Rhizosphere | MDPEMWNSTTDRMNDYNAVVMGVLEPILVLSVMAVIASLVRLFW* |
Ga0132258_124035982 | 3300015371 | Arabidopsis Rhizosphere | MWKSTTDRVNDYDAVVMGVLEPILVLSLMAVIAFLVRLSW* |
Ga0132256_1009605211 | 3300015372 | Arabidopsis Rhizosphere | RKSTTDRMNDYDVVVIGVLEPILVLSVMAVIAFLVPLSW* |
Ga0132257_1023386651 | 3300015373 | Arabidopsis Rhizosphere | MRKSTTDRMNDYDAVVMGVLEPILVLSLMAVIAFLVRLSW* |
Ga0132257_1036046441 | 3300015373 | Arabidopsis Rhizosphere | SSREVMDPEMWNSTTDRMNDYNAVVMGVLEPILVLSVMAVIASLVRLFW* |
Ga0132255_1017159603 | 3300015374 | Arabidopsis Rhizosphere | MRKSMTYRMNDYDNVVMGVLEPILVLSVMAVIASLVRLFW* |
Ga0163161_101605492 | 3300017792 | Switchgrass Rhizosphere | MRKSTTDRMNDYDVVMIGVLEPILVLSVMAVIAFLVPLSW |
Ga0187785_102162852 | 3300017947 | Tropical Peatland | EMRKSTTDRMNDYVPVVMGVLEPILVLSVMAVIAFLMRIF |
Ga0184610_12918112 | 3300017997 | Groundwater Sediment | MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW |
Ga0184608_103739881 | 3300018028 | Groundwater Sediment | MLKSTTDRINDYDAVAMGVLEPILVLSVMAVSAFLLRLFW |
Ga0184621_100749172 | 3300018054 | Groundwater Sediment | MRKSATDRMNGYDAVMMGVLEPILVLSVMAVIAFLVRLFW |
Ga0184635_103771331 | 3300018072 | Groundwater Sediment | MRKSTTDRMNDYDAVVMAVLEPILVLSVMAVIAFLVRLSW |
Ga0184612_104141601 | 3300018078 | Groundwater Sediment | MLKSTTDRMNDHDAVLMGVLEPILVLSVMAVIAFLVRLSW |
Ga0184625_101027812 | 3300018081 | Groundwater Sediment | MLKSTTDRMNDHDAVLMGVLEPILVLSVMAVIAFLVRLFW |
Ga0190269_103017491 | 3300018465 | Soil | MRKSTTDRMNDYDAYDAVVMGVLEPILVLSVMAVIAFVRRILW |
Ga0190270_111256902 | 3300018469 | Soil | MRKSTTDRMDDYDAVVMGVLEPILVLSIVVIGALLGLL |
Ga0173481_101907913 | 3300019356 | Soil | MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMRILW |
Ga0173479_106088641 | 3300019362 | Soil | MRKSTTDRMDDYDAVVIGVLEPILVLSVMAVVAYLVRIFW |
Ga0187892_1000079171 | 3300019458 | Bio-Ooze | MWKSTTHRMNDYDAVVMGVLEPILVLSVMAMSVFLAQLFW |
Ga0190267_114480171 | 3300019767 | Soil | MRKSTTDRMNDYDAVVMGVLEPILVLSIAVIGAALLGLL |
Ga0210382_105538691 | 3300021080 | Groundwater Sediment | MRKSTIHRMNDYDAVVMGVLEPILVLSVMAVSAFLVRLFW |
Ga0210379_104560911 | 3300021081 | Groundwater Sediment | MLKSTTDRTNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW |
Ga0242654_102915991 | 3300022726 | Soil | EMLKSPTDRMNDFVAVVMRVLEPILVLSVMAVIAFLMRTLW |
Ga0207647_100980432 | 3300025904 | Corn Rhizosphere | MRKSATDRMNDYDAVMMGVLEPIFVLSVMAVIGALLGLL |
Ga0207695_115372421 | 3300025913 | Corn Rhizosphere | MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVRLFW |
Ga0207662_103864403 | 3300025918 | Switchgrass Rhizosphere | MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVPLSW |
Ga0207659_111125132 | 3300025926 | Miscanthus Rhizosphere | MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVMAFLVPLSW |
Ga0207644_112096452 | 3300025931 | Switchgrass Rhizosphere | MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVMAFLVPLSW |
Ga0207670_112449421 | 3300025936 | Switchgrass Rhizosphere | MRKSAIDRMNDYDAVMMGVLEPILVLSVMAVIAFLVPLSW |
Ga0207704_115460901 | 3300025938 | Miscanthus Rhizosphere | MRKSTTDRMNDYDAYDAVVMGVLEPILVLSVMAVIAFLVRLSW |
Ga0207667_118849441 | 3300025949 | Corn Rhizosphere | MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVRLSW |
Ga0207651_109100161 | 3300025960 | Switchgrass Rhizosphere | MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVVAYLVRIFW |
Ga0207708_100794703 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVITFLVPLLR |
Ga0207708_115639321 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MWTAKTDRMNDYDAVVMGILEPILVLSVMAVIASMVRLFW |
Ga0207675_1023307052 | 3300026118 | Switchgrass Rhizosphere | LKSTTDRMNDHDAVLMGILEPILVLSVMAVIAFLVRLFW |
Ga0209861_10686102 | 3300027332 | Groundwater Sand | MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLLRLFW |
Ga0208637_10083041 | 3300027401 | Soil | MRKSATDRMNDYDAVMMGVLEPILVLSVMAVIAFLVRLFW |
Ga0208890_10046382 | 3300027523 | Soil | MRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW |
Ga0209983_10683383 | 3300027665 | Arabidopsis Thaliana Rhizosphere | MRKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMRLFW |
Ga0209593_102166652 | 3300027743 | Freshwater Sediment | MRKSTTDRMNDYDAVVMGVLEPILPLLYIALIGAVLGLL |
Ga0209811_104440922 | 3300027821 | Surface Soil | MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLVPLSW |
Ga0209974_100673513 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MRKSTTDRTMNDYDAVVMGVLEPILVLSVMAVIAW |
Ga0209069_104453782 | 3300027915 | Watersheds | MRKSTTDRMNDYDAVVMGVLEPILVLSIAVIGALLG |
Ga0268265_109146921 | 3300028380 | Switchgrass Rhizosphere | MRKSTTDRMNDYDVYDAVVMGVLEPILVLSVMAVIGALLGLL |
Ga0247822_101786121 | 3300028592 | Soil | MLKSTTDRMNDHDAVLMGILEPILVLSVMAVIAFLVRLFW |
Ga0247820_110289351 | 3300028597 | Soil | MRKSTTDRMNDYDAVVMGVLEPIFVLSVMAVVAYLVRIFW |
Ga0247819_109728581 | 3300028608 | Soil | MLKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW |
Ga0247827_109269261 | 3300028889 | Soil | MLKSPTDRMNDYDAVVMAVLEPIVVLSVMAVIAFLVRLFW |
Ga0307498_100011211 | 3300031170 | Soil | MRKSATDRMNDYDAVMMGVLEPILVLSVMAVIAFLVPLSW |
Ga0310887_101218733 | 3300031547 | Soil | MWKSTTDRMNDYDVVVMGVLEPILVLSVMAVIAFLMPLSW |
Ga0310886_109920422 | 3300031562 | Soil | MRKSTTDRMDDYDAVVMAVLEPILVLSVMAVIAFLV |
Ga0307480_10219962 | 3300031677 | Hardwood Forest Soil | MRKSTTDRMNDYDAVMMGVLEPFFLLSVMATSAFLLRLFW |
Ga0307469_115136692 | 3300031720 | Hardwood Forest Soil | MRKSTTDTMNDYDVVVMGVLEPILVLSVMAVITFLVRLPW |
Ga0307469_115754651 | 3300031720 | Hardwood Forest Soil | MRKSTTVRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLFW |
Ga0307468_1016372352 | 3300031740 | Hardwood Forest Soil | MRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLSW |
Ga0307473_111481961 | 3300031820 | Hardwood Forest Soil | THLKQRKREMWKSATVRMNDYDAVVMGVLEPILVLSVMAVIGALLGLL |
Ga0310907_108603372 | 3300031847 | Soil | MRKSTTVRMNDYDAVVMGVLEPILVLSVMAVIAFLVRLSW |
Ga0310904_105387391 | 3300031854 | Soil | MRKPMTDRMDDYDVVVMGVLEPILVLSVMAVIAFLVQRFAM |
Ga0310892_101893782 | 3300031858 | Soil | MRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIAFLVPLSW |
Ga0310885_105924581 | 3300031943 | Soil | MRKSTTDRMDDYDAVMMGVLEPIFVLSVMAVIGALLGLL |
Ga0310884_103922672 | 3300031944 | Soil | STTVRMNDYEAVVMGVLEPILVLSVMAVIAFLVRLSW |
Ga0310884_109297381 | 3300031944 | Soil | MRKSTIDRMNDYDAYDAVVMGILEPILVLSVMAVIAFLVRLSW |
Ga0310906_100022109 | 3300032013 | Soil | EMRKSTTDRMDDYDGVVIGVLEPILVLSVMAVVAYLVRIFW |
Ga0307471_1021700883 | 3300032180 | Hardwood Forest Soil | MRKSATVRMNDYDAVVMGVLEPILVLSVMAVIGALLGLL |
Ga0307472_1012572751 | 3300032205 | Hardwood Forest Soil | MRKSTTDRMNDYDAVVMGVLEPILVLSVMAVIGFLVRLSW |
Ga0307472_1015454231 | 3300032205 | Hardwood Forest Soil | STTDTMNDYDAVVMGVLEPILVLSVMAVIAFLVPLSW |
Ga0307472_1017166672 | 3300032205 | Hardwood Forest Soil | MRKSTTDTMNDYDVVVMGVLEPILVLSVMAVITFLVRLSW |
Ga0307472_1026314632 | 3300032205 | Hardwood Forest Soil | MPEMRKSTTSMNNYDAVVMGVLEPILVLSVMAVIAFLVRLSW |
Ga0310896_107931002 | 3300032211 | Soil | MRKSTTDRMNDYDAVMMGVLEPIFVLSVMAVIGALLGLL |
Ga0247830_105253252 | 3300033551 | Soil | SLIALLAALAVQRKREMRKSTTDRMNDYDAVMMGVLEPIFVLSVMAVIGALLGLL |
Ga0247830_105355041 | 3300033551 | Soil | STTDRMDDYDAVVIGVLEPILVLSVMAVVAYLVRIFW |
Ga0247830_109164172 | 3300033551 | Soil | MRKSTTDRMNDYDDYDAVVMGVLEPVLVLSVMAVIAFLVR |
Ga0247830_114120691 | 3300033551 | Soil | MLKSPTDRMNDCDAVVMAVLEPIVVLSVMAVIAFLVRLFW |
Ga0373905_088243_396_503 | 3300034414 | Sediment Slurry | MNDYDAYDAVVMGVLEPILVLSVMAVIAFLVRLSW |
Ga0314782_155735_267_395 | 3300034661 | Soil | MRKSTTDRMNDYDAYDAVVMGVLEPILVLSVMAVIGALLGLL |
Ga0373948_0205001_396_515 | 3300034817 | Rhizosphere Soil | MQKSTTDRMNDYDAVVMGVLEPILVLSVMADIAFLVGLFW |
⦗Top⦘ |