Basic Information | |
---|---|
Family ID | F023352 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 210 |
Average Sequence Length | 38 residues |
Representative Sequence | MRPKHPHAAESGVGEHTARESEAPNSVPLGKSAWRTP |
Number of Associated Samples | 178 |
Number of Associated Scaffolds | 210 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 82.38 % |
% of genes near scaffold ends (potentially truncated) | 99.52 % |
% of genes from short scaffolds (< 2000 bps) | 99.52 % |
Associated GOLD sequencing projects | 178 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.14 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.238 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.809 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 210 Family Scaffolds |
---|---|---|
PF02800 | Gp_dh_C | 0.48 |
COG ID | Name | Functional Category | % Frequency in 210 Family Scaffolds |
---|---|---|---|
COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.48 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.71 % |
Unclassified | root | N/A | 34.29 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300006426|Ga0075037_1906963 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 810 | Open in IMG/M |
3300006939|Ga0081244_1539100 | Not Available | 778 | Open in IMG/M |
3300008787|Ga0103640_1003918 | Not Available | 510 | Open in IMG/M |
3300009581|Ga0115600_1043391 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 830 | Open in IMG/M |
3300009581|Ga0115600_1096392 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 823 | Open in IMG/M |
3300009582|Ga0115601_1065698 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
3300009584|Ga0115597_1217404 | Not Available | 688 | Open in IMG/M |
3300009755|Ga0115592_1139130 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
3300010060|Ga0127425_103463 | Not Available | 696 | Open in IMG/M |
3300010061|Ga0127462_175658 | Not Available | 800 | Open in IMG/M |
3300010064|Ga0127433_123503 | Not Available | 544 | Open in IMG/M |
3300010071|Ga0127477_152192 | Not Available | 520 | Open in IMG/M |
3300010074|Ga0127439_108394 | Not Available | 807 | Open in IMG/M |
3300010081|Ga0127457_1075486 | Not Available | 797 | Open in IMG/M |
3300010085|Ga0127445_1068654 | Not Available | 620 | Open in IMG/M |
3300010090|Ga0127471_1069828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 757 | Open in IMG/M |
3300010093|Ga0127490_1021434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 731 | Open in IMG/M |
3300010099|Ga0127450_1005943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 504 | Open in IMG/M |
3300010101|Ga0127481_1000115 | Not Available | 727 | Open in IMG/M |
3300010105|Ga0127470_1094261 | Not Available | 810 | Open in IMG/M |
3300010108|Ga0127474_1009476 | Not Available | 806 | Open in IMG/M |
3300010113|Ga0127444_1117731 | Not Available | 535 | Open in IMG/M |
3300010115|Ga0127495_1109043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 821 | Open in IMG/M |
3300010120|Ga0127451_1000819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 811 | Open in IMG/M |
3300010121|Ga0127438_1041359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 711 | Open in IMG/M |
3300010122|Ga0127488_1089328 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
3300010123|Ga0127479_1097897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 702 | Open in IMG/M |
3300010124|Ga0127498_1154939 | Not Available | 720 | Open in IMG/M |
3300010126|Ga0127482_1015125 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300010126|Ga0127482_1042492 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 783 | Open in IMG/M |
3300010127|Ga0127489_1090331 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300010127|Ga0127489_1107637 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 787 | Open in IMG/M |
3300010128|Ga0127486_1045350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 802 | Open in IMG/M |
3300010131|Ga0115594_1021307 | Not Available | 549 | Open in IMG/M |
3300010133|Ga0127459_1026158 | Not Available | 798 | Open in IMG/M |
3300010137|Ga0126323_1065192 | Not Available | 686 | Open in IMG/M |
3300010142|Ga0127483_1202007 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
3300010143|Ga0126322_1008193 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
3300010146|Ga0126320_1476761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 792 | Open in IMG/M |
3300010147|Ga0126319_1631136 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 547 | Open in IMG/M |
3300010154|Ga0127503_11314083 | Not Available | 686 | Open in IMG/M |
3300010859|Ga0126352_1103122 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 831 | Open in IMG/M |
3300010867|Ga0126347_1577575 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
3300010905|Ga0138112_1064544 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
3300011027|Ga0138580_131109 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
3300011043|Ga0138528_125534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 582 | Open in IMG/M |
3300011060|Ga0138583_1089440 | Not Available | 830 | Open in IMG/M |
3300011071|Ga0138595_1020729 | Not Available | 830 | Open in IMG/M |
3300011085|Ga0138581_1005893 | Not Available | 815 | Open in IMG/M |
3300011305|Ga0138532_1005866 | Not Available | 814 | Open in IMG/M |
3300011332|Ga0126317_10754342 | Not Available | 793 | Open in IMG/M |
3300011333|Ga0127502_10104277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 614 | Open in IMG/M |
3300011333|Ga0127502_10583579 | Not Available | 529 | Open in IMG/M |
3300011333|Ga0127502_11123225 | Not Available | 828 | Open in IMG/M |
3300011340|Ga0151652_13050894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 594 | Open in IMG/M |
3300012224|Ga0134028_1011262 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
3300012364|Ga0134027_1081089 | Not Available | 719 | Open in IMG/M |
3300012364|Ga0134027_1147299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 698 | Open in IMG/M |
3300012371|Ga0134022_1018540 | Not Available | 555 | Open in IMG/M |
3300012371|Ga0134022_1083257 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
3300012373|Ga0134042_1008670 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 792 | Open in IMG/M |
3300012374|Ga0134039_1153009 | Not Available | 690 | Open in IMG/M |
3300012377|Ga0134029_1034236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 808 | Open in IMG/M |
3300012378|Ga0134025_1057535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 803 | Open in IMG/M |
3300012379|Ga0134058_1177605 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
3300012379|Ga0134058_1229450 | Not Available | 537 | Open in IMG/M |
3300012380|Ga0134047_1095062 | Not Available | 690 | Open in IMG/M |
3300012380|Ga0134047_1111567 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
3300012381|Ga0134026_1009395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 755 | Open in IMG/M |
3300012385|Ga0134023_1005175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 793 | Open in IMG/M |
3300012386|Ga0134046_1151005 | Not Available | 743 | Open in IMG/M |
3300012398|Ga0134051_1140995 | Not Available | 596 | Open in IMG/M |
3300012401|Ga0134055_1368379 | Not Available | 689 | Open in IMG/M |
3300012404|Ga0134024_1137077 | Not Available | 543 | Open in IMG/M |
3300012405|Ga0134041_1107773 | Not Available | 678 | Open in IMG/M |
3300012409|Ga0134045_1378489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 642 | Open in IMG/M |
3300012469|Ga0150984_110234231 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 820 | Open in IMG/M |
3300012469|Ga0150984_116518325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 810 | Open in IMG/M |
3300016701|Ga0181509_1176432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 789 | Open in IMG/M |
3300017792|Ga0163161_11480144 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 595 | Open in IMG/M |
3300019160|Ga0184577_107245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 824 | Open in IMG/M |
3300019162|Ga0184597_116852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 797 | Open in IMG/M |
3300019163|Ga0184581_110405 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 732 | Open in IMG/M |
3300019164|Ga0184582_115016 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
3300019165|Ga0184589_106753 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 689 | Open in IMG/M |
3300019165|Ga0184589_108108 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
3300019173|Ga0184575_119877 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
3300019189|Ga0184585_147946 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
3300019212|Ga0180106_1042353 | Not Available | 810 | Open in IMG/M |
3300019212|Ga0180106_1100786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 519 | Open in IMG/M |
3300019212|Ga0180106_1121630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 529 | Open in IMG/M |
3300019229|Ga0180116_1278586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 552 | Open in IMG/M |
3300019230|Ga0181501_1031153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 669 | Open in IMG/M |
3300019232|Ga0180114_1000498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 818 | Open in IMG/M |
3300019244|Ga0180111_1048877 | Not Available | 817 | Open in IMG/M |
3300019244|Ga0180111_1129766 | Not Available | 640 | Open in IMG/M |
3300019249|Ga0184648_1072719 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
3300019249|Ga0184648_1336197 | Not Available | 701 | Open in IMG/M |
3300019251|Ga0187795_1079636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 710 | Open in IMG/M |
3300019254|Ga0184641_1285993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 575 | Open in IMG/M |
3300019255|Ga0184643_1232891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 812 | Open in IMG/M |
3300019259|Ga0184646_1086006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 763 | Open in IMG/M |
3300019263|Ga0184647_1030363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 808 | Open in IMG/M |
3300019263|Ga0184647_1043705 | Not Available | 806 | Open in IMG/M |
3300019263|Ga0184647_1074492 | Not Available | 715 | Open in IMG/M |
3300019263|Ga0184647_1320208 | Not Available | 803 | Open in IMG/M |
3300019265|Ga0187792_1132009 | Not Available | 810 | Open in IMG/M |
3300019265|Ga0187792_1234253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 779 | Open in IMG/M |
3300019265|Ga0187792_1336160 | Not Available | 611 | Open in IMG/M |
3300019265|Ga0187792_1463801 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 821 | Open in IMG/M |
3300019270|Ga0181512_1209043 | All Organisms → cellular organisms → Eukaryota | 2023 | Open in IMG/M |
3300019275|Ga0187798_1501721 | Not Available | 794 | Open in IMG/M |
3300019284|Ga0187797_1664255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 713 | Open in IMG/M |
3300020014|Ga0182044_1287218 | Not Available | 807 | Open in IMG/M |
3300020063|Ga0180118_1298683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 813 | Open in IMG/M |
3300020066|Ga0180108_1230785 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
3300020068|Ga0184649_1273449 | Not Available | 716 | Open in IMG/M |
3300020068|Ga0184649_1595900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 601 | Open in IMG/M |
3300020069|Ga0197907_11134291 | Not Available | 804 | Open in IMG/M |
3300020070|Ga0206356_11582145 | Not Available | 833 | Open in IMG/M |
3300020077|Ga0206351_10431739 | Not Available | 816 | Open in IMG/M |
3300020077|Ga0206351_10795587 | Not Available | 714 | Open in IMG/M |
3300020078|Ga0206352_10296397 | Not Available | 808 | Open in IMG/M |
3300021151|Ga0179584_1244038 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 799 | Open in IMG/M |
3300021855|Ga0213854_1217516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 821 | Open in IMG/M |
3300021857|Ga0213849_1191555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 811 | Open in IMG/M |
3300021951|Ga0222624_1070189 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 588 | Open in IMG/M |
3300021951|Ga0222624_1072378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 820 | Open in IMG/M |
3300022147|Ga0213930_106696 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
3300022467|Ga0224712_10255143 | Not Available | 811 | Open in IMG/M |
3300022501|Ga0242645_1021071 | Not Available | 578 | Open in IMG/M |
3300022505|Ga0242647_1010723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 817 | Open in IMG/M |
3300022506|Ga0242648_1022849 | Not Available | 815 | Open in IMG/M |
3300022511|Ga0242651_1012657 | Not Available | 808 | Open in IMG/M |
3300022512|Ga0242676_1011661 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300022513|Ga0242667_1011794 | Not Available | 810 | Open in IMG/M |
3300022718|Ga0242675_1032032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 804 | Open in IMG/M |
3300022726|Ga0242654_10330071 | Not Available | 569 | Open in IMG/M |
3300023541|Ga0247544_100845 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 726 | Open in IMG/M |
3300023542|Ga0247540_101034 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
3300023547|Ga0247554_101398 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 828 | Open in IMG/M |
3300023551|Ga0247546_101467 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
3300023697|Ga0228706_1020317 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
3300025893|Ga0207682_10371411 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 675 | Open in IMG/M |
3300025937|Ga0207669_10718300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 823 | Open in IMG/M |
3300026392|Ga0213908_118715 | Not Available | 798 | Open in IMG/M |
3300026439|Ga0256361_1057489 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 650 | Open in IMG/M |
3300029652|Ga0206099_106434 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
3300030573|Ga0210272_1268351 | Not Available | 537 | Open in IMG/M |
3300030730|Ga0307482_1088764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 827 | Open in IMG/M |
3300030738|Ga0265462_10607040 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 833 | Open in IMG/M |
3300030805|Ga0265756_104055 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 816 | Open in IMG/M |
3300030812|Ga0265734_106407 | Not Available | 524 | Open in IMG/M |
3300030831|Ga0308152_104045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 774 | Open in IMG/M |
3300030832|Ga0265752_102176 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
3300030881|Ga0265728_100891 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 791 | Open in IMG/M |
3300030884|Ga0265758_102195 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 822 | Open in IMG/M |
3300030902|Ga0308202_1058768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 722 | Open in IMG/M |
3300030903|Ga0308206_1060337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 775 | Open in IMG/M |
3300030937|Ga0138302_1758975 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 825 | Open in IMG/M |
3300030941|Ga0265737_103723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 798 | Open in IMG/M |
3300030970|Ga0075381_10037663 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 840 | Open in IMG/M |
3300030982|Ga0265748_103016 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 729 | Open in IMG/M |
3300030986|Ga0308154_105720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 739 | Open in IMG/M |
3300030987|Ga0308155_1007539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 826 | Open in IMG/M |
3300030987|Ga0308155_1008630 | Not Available | 794 | Open in IMG/M |
3300030988|Ga0308183_1052266 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 824 | Open in IMG/M |
3300030989|Ga0308196_1025759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 715 | Open in IMG/M |
3300030990|Ga0308178_1041848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 826 | Open in IMG/M |
3300030990|Ga0308178_1047513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 792 | Open in IMG/M |
3300030990|Ga0308178_1063525 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 717 | Open in IMG/M |
3300030993|Ga0308190_1049698 | Not Available | 805 | Open in IMG/M |
3300031011|Ga0265774_102141 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 738 | Open in IMG/M |
3300031015|Ga0138298_1565727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 544 | Open in IMG/M |
3300031023|Ga0073998_10029518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 565 | Open in IMG/M |
3300031054|Ga0102746_10002530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 849 | Open in IMG/M |
3300031092|Ga0308204_10094401 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
3300031093|Ga0308197_10172356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 714 | Open in IMG/M |
3300031094|Ga0308199_1047180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 831 | Open in IMG/M |
3300031097|Ga0308188_1010101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 801 | Open in IMG/M |
3300031098|Ga0308191_1010588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 828 | Open in IMG/M |
3300031099|Ga0308181_1051562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 782 | Open in IMG/M |
3300031114|Ga0308187_10168929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 743 | Open in IMG/M |
3300031125|Ga0308182_1007059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 810 | Open in IMG/M |
3300031421|Ga0308194_10307547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 551 | Open in IMG/M |
3300031422|Ga0308186_1010108 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
3300031424|Ga0308179_1004547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 1158 | Open in IMG/M |
3300031424|Ga0308179_1021542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 712 | Open in IMG/M |
3300031481|Ga0314816_1022923 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 779 | Open in IMG/M |
3300031490|Ga0314825_105310 | Not Available | 796 | Open in IMG/M |
3300031503|Ga0314820_107676 | Not Available | 610 | Open in IMG/M |
3300031505|Ga0308150_1013222 | Not Available | 804 | Open in IMG/M |
3300031677|Ga0307480_1008432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 687 | Open in IMG/M |
3300031902|Ga0302322_101457798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 835 | Open in IMG/M |
3300032805|Ga0335078_11461576 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 767 | Open in IMG/M |
3300033529|Ga0316587_1041443 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 832 | Open in IMG/M |
3300034447|Ga0370544_23343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 509 | Open in IMG/M |
3300034643|Ga0370545_049944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 810 | Open in IMG/M |
3300034643|Ga0370545_050168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 809 | Open in IMG/M |
3300034644|Ga0370548_040858 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 797 | Open in IMG/M |
3300034661|Ga0314782_053043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 813 | Open in IMG/M |
3300034661|Ga0314782_055077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 803 | Open in IMG/M |
3300034661|Ga0314782_077568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 715 | Open in IMG/M |
3300034663|Ga0314784_038942 | Not Available | 830 | Open in IMG/M |
3300034667|Ga0314792_071756 | Not Available | 809 | Open in IMG/M |
3300034667|Ga0314792_159156 | Not Available | 609 | Open in IMG/M |
3300034668|Ga0314793_065461 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 697 | Open in IMG/M |
3300034671|Ga0314796_083625 | Not Available | 666 | Open in IMG/M |
3300034677|Ga0314802_024095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 629 | Open in IMG/M |
3300034681|Ga0370546_025591 | Not Available | 810 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 23.33% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 10.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.14% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 5.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.29% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 3.33% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 2.86% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.86% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.43% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.95% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.95% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.95% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.95% |
Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.48% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.48% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.48% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.48% |
Enriched Soil Aggregate | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate | 0.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil | 0.48% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.48% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.48% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.48% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.48% |
Wetland Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil | 0.48% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006939 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300008787 | Microbial communities from wetland soil in Czech Republic - R3_cDNA | Environmental | Open in IMG/M |
3300009581 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009582 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009584 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009755 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010060 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010061 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010064 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010071 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010074 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010081 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010085 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010090 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010093 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010099 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010101 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010105 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010108 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010113 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010115 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010120 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010121 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010123 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010127 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010137 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010143 | Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010905 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011027 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 70 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011043 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 6 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011060 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011071 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011305 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300016701 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300019160 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019162 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019163 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019164 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019165 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019173 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019189 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019212 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019229 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019230 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019244 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019251 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020014 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020066 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021857 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022147 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 2-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023541 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023542 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023551 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023697 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026392 | Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0906-MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026439 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029652 | Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S3_20-13C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030573 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
3300030805 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030812 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030831 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030832 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030881 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030884 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300030941 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030970 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030982 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030986 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031011 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031015 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031023 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031054 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 1C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031097 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031098 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031125 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031422 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031481 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031490 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031503 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031505 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_139 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300034447 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_119 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034677 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0075037_19069632 | 3300006426 | Permafrost Soil | MRPKILHAAGSGVGESTARESEAPNSRPPGKSEWRTPTPKFG |
Ga0081244_15391001 | 3300006939 | Tropical Rainforest Soil | MRPIHPHAAESGVGEHTARESEAPNSVPPGKSAWRTPTP |
Ga0103640_10039181 | 3300008787 | Wetland Soil | MRPRHPHAAESGVGEHTARESEAPNSVPLGKSAWRTPT |
Ga0115600_10433911 | 3300009581 | Wetland | MRPRHPHAADSGVGEHTARESEAPNSVPSGKSAWRTPTPKFGPG |
Ga0115600_10963921 | 3300009581 | Wetland | MRPKHPPAAESGVGEHTARESEAPNSVPSGKSAWRTPTPKFG |
Ga0115601_10656982 | 3300009582 | Wetland | MRPRHPHAADSGVGEHTARESEAPNSVPPGKSAWRTPT |
Ga0115597_12174041 | 3300009584 | Wetland | MRPKHPPAAESGVGEHTARESEAPNSVPSGKSAWRTPTP |
Ga0115592_11391302 | 3300009755 | Wetland | MRPRHPPAAESGVGEHTARESEAPNSVPSGKSAWRTP |
Ga0127425_1034631 | 3300010060 | Grasslands Soil | MRPKHPHAAESGVGKHKARESEAPNNVPSGKSAWRTP |
Ga0127462_1756581 | 3300010061 | Grasslands Soil | MRPRHPHAAENGVGKHTARESEAPNSVPSGKSAWRT |
Ga0127433_1235031 | 3300010064 | Grasslands Soil | MRPKHLHAAESGVGKHKARESEAPNRVPSGKSAWR |
Ga0127477_1521921 | 3300010071 | Grasslands Soil | MRPKPPHAAESGVGKHKARESEAPNNVPSGKSAWRT |
Ga0127439_1083941 | 3300010074 | Grasslands Soil | MRPKPPHAAESGVGKHKARESEAPNNVPSGKSAWRTP |
Ga0127457_10754861 | 3300010081 | Grasslands Soil | MRPKPPHAAESGVGKHKARESEAPNNVPSGKSAWR |
Ga0127445_10686541 | 3300010085 | Grasslands Soil | MRPKHPHAAESGVGEHTARESERAQCVPSGKSAWRTPTP |
Ga0127471_10698282 | 3300010090 | Grasslands Soil | MRPKILHAAESGVGEYAARESEAPNSVPPGKSEWRTP |
Ga0127490_10214341 | 3300010093 | Grasslands Soil | MRPKILHAAGSGVGEYTARESEAPNSVPPGKSEWRT |
Ga0127450_10059431 | 3300010099 | Grasslands Soil | MRPKHPHAAESGVGEHTARESEAPNSVSPGKSAWRT |
Ga0127481_10001151 | 3300010101 | Grasslands Soil | MRSKTSHAAESGVGEYTARESEAPNSVRPGKSAWR |
Ga0127470_10942611 | 3300010105 | Grasslands Soil | MRPEILHAAESGVGVYTARESEAPNSVPPGKSEWRTPTP |
Ga0127474_10094761 | 3300010108 | Grasslands Soil | MRPKHPHAAESGVGERTARESEAPNSVPPGKSAWR |
Ga0127444_11177311 | 3300010113 | Grasslands Soil | MRPKHLHAAESGVGEYTARESEAPNSVPPGKSEWRTPTPKFG |
Ga0127495_11090431 | 3300010115 | Grasslands Soil | MRPKHPHAAESGVGEHKARESEAPNNVPPGKSAWR |
Ga0127451_10008191 | 3300010120 | Grasslands Soil | MRPKILHAAESGVGEYAARESEAPNSVPPGKSEWRTPNPKF |
Ga0127438_10413591 | 3300010121 | Grasslands Soil | MRSRTSHAAESGVGEHTARESEAPNSVRPGKSAWRTPTPKFGPGTE |
Ga0127488_10893282 | 3300010122 | Grasslands Soil | MRPKILHAAGSGVGEYTARESEAPNSVPPGKSEWR |
Ga0127479_10978971 | 3300010123 | Grasslands Soil | MRSRTSHAAESGVGEHTARESEAPNSVRPGKSAWRMPTPKFGP |
Ga0127498_11549391 | 3300010124 | Grasslands Soil | MRPKPPHAAESGVGEHTARESEAPNSVPSGKSAWRA |
Ga0127482_10151251 | 3300010126 | Grasslands Soil | MRPKHPHAAESGVGKHKARESEAPNNVPSGKSAWRT |
Ga0127482_10424922 | 3300010126 | Grasslands Soil | MRPKILHAAGSGVGEYTARESEAPNSVPPGKSEWRTP |
Ga0127489_10903312 | 3300010127 | Grasslands Soil | MRSKTSHAAESGVGEYTARESEAPNSVRPGKSAWRAP |
Ga0127489_11076372 | 3300010127 | Grasslands Soil | MRPKILHAAESGVGEYAARESEAPNSVPPGKSEWR |
Ga0127486_10453502 | 3300010128 | Grasslands Soil | MRPKHLHAAESGVGEYTARESEAPNSVPPGKSEWRT |
Ga0115594_10213071 | 3300010131 | Wetland | MRPRHPHAAESGVGEHTARESEAPNVVPTGKSAWRTPT |
Ga0127459_10261581 | 3300010133 | Grasslands Soil | MRPKHLHAAESGVGKHKARESEAPNNVPSGKSASRTPTPKFGP |
Ga0126323_10651921 | 3300010137 | Soil | MRPRHPHAAENGVGKHTARESEAPNSVPSGKSAWRTPTP |
Ga0127483_12020072 | 3300010142 | Grasslands Soil | MRSKTSHAAESGVGEYTARESEAPNSVPPGKSEWRTP |
Ga0126322_10081931 | 3300010143 | Soil | MRPRHPHAAESGVGEHKARESEAPNSVPPGKSAWRTPTP |
Ga0126320_14767611 | 3300010146 | Soil | MRPKHPHAAESGVGKHKARESEAPNSVPSGKSAWR |
Ga0126319_16311361 | 3300010147 | Soil | MRPKHPHAAESGVGKHTARESEAPNSVPSGKSAWRTPT |
Ga0127503_113140832 | 3300010154 | Soil | MRPKTPHAAGSGVGEHTARESEAPNSVPPGKSAWR |
Ga0126352_11031222 | 3300010859 | Boreal Forest Soil | MRSRTPHAAGSGVGEFTARESESAQRELPGKSAWRTPTPKFGPG |
Ga0126347_15775752 | 3300010867 | Boreal Forest Soil | MRPKILHAAGSGVGESTARESEAPNGRPPGKSEWRTPTP |
Ga0138112_10645441 | 3300010905 | Grasslands Soil | MRPKHPHAAESGVGKHKARESEAPNIVPSGKIAWRTP |
Ga0138580_1311091 | 3300011027 | Peatlands Soil | MRSKSSHAAESGVGEHTARESEAPNGVRMGKSAWRTPTP |
Ga0138528_1255341 | 3300011043 | Peatlands Soil | MRPKHPHAAESGVGEHTARESEAPNGVRMGKSAWR |
Ga0138583_10894401 | 3300011060 | Peatlands Soil | MRSKTSHAAESGVGEHTARESEAPNSVRPGKSAWRTPTPKFGPG |
Ga0138595_10207291 | 3300011071 | Peatlands Soil | MRSKTSHAAESGVGEHTARESEAPNSVRPGKSAWRTPTPKFGP |
Ga0138581_10058931 | 3300011085 | Peatlands Soil | MRSKTSHAAESGVGEHTARESEAPNGVRMGKSAWRTPT |
Ga0138532_10058661 | 3300011305 | Peatlands Soil | MRSKTSHAAESGVGEHTARESEAPNGVRMGKSAWRTPTP |
Ga0126317_107543421 | 3300011332 | Soil | MRPKHPHAAESGVGEHKARESEAPNHVPPGKSEWR |
Ga0127502_101042771 | 3300011333 | Soil | MRPKHPHAAESGVGKHTARESEAPNSVPLGKSAWR |
Ga0127502_105835792 | 3300011333 | Soil | MRPKHPHAAESGVGKYTARESEAPNCVPSGKSAWRT |
Ga0127502_111232251 | 3300011333 | Soil | MRPKHLHAAESGVGKHKARESEAPNRVPSGKSAWRTPTPKFGP |
Ga0151652_130508941 | 3300011340 | Wetland | MRPKHPHAAESGVGEHTARESEAPNSVSPGKSAWRTPT |
Ga0134028_10112621 | 3300012224 | Grasslands Soil | MRPKHPHAAESGVGKHKARESEAPNNVPSGKSAWRTPT |
Ga0134027_10810891 | 3300012364 | Grasslands Soil | MRPKHPHAAESGVGKHKARESEAPNNVPSGKSAWRTPTP |
Ga0134027_11472992 | 3300012364 | Grasslands Soil | MRPKHLHAAESGVGEYTARESEAPNSVPPGKSEWR |
Ga0134022_10185401 | 3300012371 | Grasslands Soil | MRPKILHAAGSGVGEYTARESEAPNSVLPGKSEWR |
Ga0134022_10832572 | 3300012371 | Grasslands Soil | MRPIHPHAAESGVGEHTARESEAPNSMPPGKSEWRTPT |
Ga0134042_10086701 | 3300012373 | Grasslands Soil | MRPKHLHAAESGVGEYTARESEAPNSVPPGKSEWRTPNPKFGPKT |
Ga0134039_11530092 | 3300012374 | Grasslands Soil | MRPKPPHAAESGVGKHKARESEAPNNVPSGKSAWRTPTP |
Ga0134029_10342362 | 3300012377 | Grasslands Soil | MRPKHLHAAESGVGEYTARESEAPNSVPPGKSEWRTPTPK |
Ga0134025_10575352 | 3300012378 | Grasslands Soil | MRPKHLHAAESGVGEYTARESEAPNSVPPGKSEWRTP |
Ga0134058_11776051 | 3300012379 | Grasslands Soil | MRPKPPHAAESGVGEHTARESEAPNSVPSGKSAWRAP |
Ga0134058_12294501 | 3300012379 | Grasslands Soil | MRPKILHAAGSGVGEYTARESEAPNSVPPGKSEWRTPTPKFG |
Ga0134047_10950621 | 3300012380 | Grasslands Soil | MRPKHPHAAESGVGEHTARESERAQCVPSGKSAWRT |
Ga0134047_11115672 | 3300012380 | Grasslands Soil | MRPKHLHAAESGVGEYTARESEAPNSVPPGKSEWRTPN |
Ga0134026_10093952 | 3300012381 | Grasslands Soil | MRPKILHAAESGVGEYAARESEAPNSVPPGKSEWRT |
Ga0134023_10051752 | 3300012385 | Grasslands Soil | MRPKILHAAGSGVGEYTARESEAPNSVPPGKSEWRTPN |
Ga0134046_11510051 | 3300012386 | Grasslands Soil | MRPKHPHAAESGVGEHTARESERAQCVPSGKSAWRTPT |
Ga0134051_11409951 | 3300012398 | Grasslands Soil | MRPKHLHAAESGVGEYTARESEAPNSVPPGKSEWRTPNPKFGPK |
Ga0134055_13683791 | 3300012401 | Grasslands Soil | MRPKPPHAAESGVGEHTARESEAPNSVPSGKSAWRAPTP |
Ga0134024_11370771 | 3300012404 | Grasslands Soil | MRPKILHAAGSGVGEYTARESEAPNSVPPGKSEWRTPNPKFGPR |
Ga0134041_11077731 | 3300012405 | Grasslands Soil | MRSITSHAAESGVGEHTARESEAPNSVRMGKSAWR |
Ga0134045_13784892 | 3300012409 | Grasslands Soil | MRPKILHAAESGVGEYAARESEAPNSVPPGKSEWRTPNPKFG |
Ga0150984_1102342311 | 3300012469 | Avena Fatua Rhizosphere | MRPRHPHAAESGVGEHTAREIERAQCVPKGKSAWRTPTP |
Ga0150984_1165183251 | 3300012469 | Avena Fatua Rhizosphere | MRPKHPHAVDSGFGKHKARESEAPNVVPSGKSAWRTP |
Ga0181509_11764322 | 3300016701 | Peatland | MRSRTSLAAESGVGEHMARESERAQRCAMGKSAWRTPTP |
Ga0163161_114801441 | 3300017792 | Switchgrass Rhizosphere | MRPRHPHAAENGVGKHTARESEAPNSVPSGKSAWRTPTPK |
Ga0184577_1072451 | 3300019160 | Soil | MRSKTSHAAESGVGEHTARESEAPNSVRMGKSAWRTPTPKF |
Ga0184597_1168521 | 3300019162 | Soil | MRSKSSHAAESGVGEHTARESEAPNSVRMGKSAWRTP |
Ga0184581_1104051 | 3300019163 | Soil | MRSKSSHAAESGVGEHTARESEAPNSVRMGKSAWRT |
Ga0184582_1150161 | 3300019164 | Soil | MRSKTSHAAESGVGEHTARESEAPNSVRMGKSAWR |
Ga0184589_1067531 | 3300019165 | Soil | MRSISSHAAESGVGEHTARESEAPNSVRMGKSAWRTPT |
Ga0184589_1081081 | 3300019165 | Soil | MRSKSSHAAESGVGEHTARESEAPNSVRMGKSAWRTPT |
Ga0184575_1198771 | 3300019173 | Soil | MRSKTSHAAESGVGEHTARESEAPNSVRMGKSAWRT |
Ga0184585_1479461 | 3300019189 | Soil | MRSKTSHAAESGVGEHTARESEAPNSVRMGKSAWRTPTP |
Ga0180106_10423531 | 3300019212 | Groundwater Sediment | MRPKHPHAVERGVGKHTARESEAPNCVPSGKSAWRTPT |
Ga0180106_11007861 | 3300019212 | Groundwater Sediment | MRPRHPHAAESGVGEHTARESEAPNSVSPGKSAWRTPTP |
Ga0180106_11216301 | 3300019212 | Groundwater Sediment | MRPKHPHAAESGVGEHTARESEAPNSVSPGKSAWRTPTPKFG |
Ga0180116_12785861 | 3300019229 | Groundwater Sediment | MRPKHPHAAESGVGKYTARESEAPNCVPSGKSAWRTPT |
Ga0181501_10311531 | 3300019230 | Peatland | MRSRTSLAAESGVGEHMARESERAQRCAMGKSAWRTPTPKFGP |
Ga0180114_10004981 | 3300019232 | Groundwater Sediment | MRPKHPHAAESGVGEHKARESEAPNIVPLGKSAWRTPTP |
Ga0180111_10488772 | 3300019244 | Groundwater Sediment | MRPRHPRAAESGVGEHKARESEAPNIVPLGKSAWRTPTP |
Ga0180111_11297661 | 3300019244 | Groundwater Sediment | MRLKHPHAAESGVGEHKARESEAPNIVPLGKSAWRTPTP |
Ga0184648_10727191 | 3300019249 | Groundwater Sediment | MRLKHPHAAESGVGEHKARESEAPNIVPLGKSAWRTPT |
Ga0184648_13361971 | 3300019249 | Groundwater Sediment | MRPKHPHAAESGVGKHKARESEAPNSVPSGKSAWRTPT |
Ga0187795_10796361 | 3300019251 | Peatland | MRSKTSHAAESGVGERTARESEAPNSVRPGKSAWRT |
Ga0184641_12859932 | 3300019254 | Groundwater Sediment | MRPKHPPAAESGVGEHTARESEAPNSVPPGKSEWRTP |
Ga0184643_12328912 | 3300019255 | Groundwater Sediment | MRPKHPHAAESGVGEHKARESEAPNVVPPGKSAWRTP |
Ga0184646_10860061 | 3300019259 | Groundwater Sediment | MRPKPPHAAESGVGKHKARESEAPNIVPSGKSAWRTPT |
Ga0184647_10303631 | 3300019263 | Groundwater Sediment | MRPKHPHAAESGVGEHKARESEAPNIVPLGKSAWRT |
Ga0184647_10437052 | 3300019263 | Groundwater Sediment | MRPKSPHAAESGVGKHTARESEAPNSVPLGKSAWRTP |
Ga0184647_10744921 | 3300019263 | Groundwater Sediment | MRPRHPRAAESGVGEHKARESEAPNIVPLGKSAWRTPTPKFGPG |
Ga0184647_13202082 | 3300019263 | Groundwater Sediment | MRPIHPHAAESGVGKHKARESEAPNSVPSGKSAWRTPTP |
Ga0187792_11320091 | 3300019265 | Peatland | MRPRHPHAAESGVGEHTARESEAPNVVPPGKSAWRTP |
Ga0187792_12342532 | 3300019265 | Peatland | MRPRHPHAAESGVGEHTARESEAPNAVPPGKSAWRTPTP |
Ga0187792_13361601 | 3300019265 | Peatland | MRPKHPHAAESGVGEHKARESEAPNIVPPGKSAWRTP |
Ga0187792_14638012 | 3300019265 | Peatland | MRPKHPHAAESGVGEHAARESEAPNSVPPGKSAWRTPTPK |
Ga0181512_12090431 | 3300019270 | Peatland | MRSKTSHAAESGVGEHTARESEAPNGVRPGKSAWRAPTPKFGPG |
Ga0187798_15017212 | 3300019275 | Peatland | MRSTTSHAAESGVGEHMARESECAQRYAMGKSAWRTPT |
Ga0187797_16642551 | 3300019284 | Peatland | MRSITSHAAESGVGEHMARESEGAQRCAMGKSAWRTPTP |
Ga0182044_12872181 | 3300020014 | Salt Marsh | MRPRHPHAAESGVGEHTARESEAPNSVPPGKSAWRTP |
Ga0180118_12986831 | 3300020063 | Groundwater Sediment | MRPRHPHAAESGVGEHKARESEAPNIVPPGKSAWRTPT |
Ga0180108_12307851 | 3300020066 | Groundwater Sediment | MRPRHPHAAESGVGEHKARESEAPNRVPLGKSAWRT |
Ga0184649_12734491 | 3300020068 | Groundwater Sediment | MRPKHLHAAESGVGKHKARESEAPNNVPSGKSAWRTPTP |
Ga0184649_15959001 | 3300020068 | Groundwater Sediment | MRPKHPHAAESGVGEHTARESEAPNSVSPGKSAWRTP |
Ga0197907_111342912 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSKTSHAAKSGVGEHTARESEAPNSVRPGKSAWRTPT |
Ga0206356_115821452 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHPHAAESGVGEHTARESEAPNSVPLGKSAWRTPTPTAKAN |
Ga0206351_104317391 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHLHAAESGVGKHKARESEAPNNVPSGKSAWRTPT |
Ga0206351_107955871 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHPHAAESGVGEHTARESEAPNSVPLGKSAWRTP |
Ga0206352_102963971 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPRHPHAAENGVGKHTARESEAPNSVPSGKSAWRTPT |
Ga0179584_12440381 | 3300021151 | Vadose Zone Soil | MRPRHPHAAESGVGEHTARESEAPNSVRMGKSAWRTPTP |
Ga0213854_12175161 | 3300021855 | Watersheds | MRPKHPHAAESGVGEHTARESEAPNSVSPGKSAWRTPTP |
Ga0213849_11915551 | 3300021857 | Watersheds | MRSKSSHAAESGVGEHTARESEAPNSVRMGKSAWRTPTP |
Ga0222624_10701891 | 3300021951 | Groundwater Sediment | MRPIHPHAAESGVGEHTARESEAPNSMPPGKSEWRTPTP |
Ga0222624_10723782 | 3300021951 | Groundwater Sediment | MRPKHPHAAESGVGEHKARESEAPNVVPPGKSAWRTPTP |
Ga0213930_1066961 | 3300022147 | Freshwater | MRPKPPHAAESGVGEHTARESEAPNSVPSGKSAWRTP |
Ga0224712_102551431 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKHLHAAESGVGKHKARESEAPNNVPSGKSAWRTP |
Ga0242645_10210711 | 3300022501 | Soil | MRPKILHAAESGVGEYTARESEAPNSVPPGKSEWRTP |
Ga0242647_10107231 | 3300022505 | Soil | MRSKSSHAAESGVGEHTARESEAPNSVRTGKSAWRTPTPKF |
Ga0242648_10228491 | 3300022506 | Soil | MRPRHPHAAESGVGEHKARESEAPNIVPPGKSAWRTP |
Ga0242651_10126571 | 3300022511 | Soil | MRPRHPHAAESGVGEHKARESEAPNIVPPGKSAWR |
Ga0242676_10116611 | 3300022512 | Soil | MRPRAAHAALSGVGEHTARESERAQCVPLGKSAWRTPTP |
Ga0242667_10117941 | 3300022513 | Soil | MRPRHPHAAESGVGEHKARESEAPNIVPPGKSAWRT |
Ga0242675_10320322 | 3300022718 | Soil | MRPKILHAAESGVGEYTARESEAPNSVPPGKSEWRT |
Ga0242654_103300711 | 3300022726 | Soil | MRPKILHAAESGVGEYTARESEAPNSVPPGKSEWRTPT |
Ga0247544_1008451 | 3300023541 | Soil | MRSKSSHAAESGVGEHTARESEAPNSVRMGKSAWRTPTPKFG |
Ga0247540_1010341 | 3300023542 | Soil | MRSKTSHAAESGVGEHTARESEAPNSVRMGKSAWRTPT |
Ga0247554_1013981 | 3300023547 | Soil | MRSKTSHAAESGVGEHTARESEAPNSVRMGKSAWRTPTPKFGP |
Ga0247546_1014671 | 3300023551 | Soil | MRSKTSHAAESGVGEHTARESEAPNSVRMGKSAWRTP |
Ga0228706_10203171 | 3300023697 | Freshwater | MRPKPPHAAESGVGEYTARESEAPNSVPSGKSAWRT |
Ga0207682_103714111 | 3300025893 | Miscanthus Rhizosphere | MRPRASLAAMSSVGKHTARESEAPNCVPSGKSAWRTPTPKFGP |
Ga0207669_107183001 | 3300025937 | Miscanthus Rhizosphere | MRPKHPHAAESGVGKHTARESEAPNCVPSGKSAWRTPT |
Ga0213908_1187151 | 3300026392 | Enriched Soil Aggregate | MRPKHPHAAESGVGKHTARESEAPNGVPSGKSAWR |
Ga0256361_10574891 | 3300026439 | Freshwater | MRPRHPHAAESGVGEHTARESEAPNVVPPGKSARRTP |
Ga0206099_1064341 | 3300029652 | Soil | MRPKHPHAAESGVGEHTARESEGAKRVPTGKSAWRT |
Ga0210272_12683511 | 3300030573 | Soil | MRSRTSHAAKSGVGEHTARESEAHNSVRMGKSAWRTPTP |
Ga0307482_10887642 | 3300030730 | Hardwood Forest Soil | MRPKILHAAESGVGEYTARESEAPNSVPPGKSEWRTPTPKFGPK |
Ga0265462_106070402 | 3300030738 | Soil | MRPKILHAAESGVGESTARESEAPNSRPPGKSEWRTPIPKFDTENIK |
Ga0265756_1040551 | 3300030805 | Soil | MRSKSSHAAESGVGEHTARESEAPNSVRMGKSAWRTPTPK |
Ga0265734_1064071 | 3300030812 | Soil | MRPKHLHAAESGVGEHTARESEAPNSVPTGKSEWRTP |
Ga0308152_1040451 | 3300030831 | Soil | MRPKPPHAAGSGVGKHKARESEAPNIVPSGKSAWRT |
Ga0265752_1021761 | 3300030832 | Soil | MRSKSSHAAESGVGEHTARESEAPNSVRMGKSAWRAP |
Ga0265728_1008911 | 3300030881 | Soil | MRPKHPHAAESGVGKYTARESERAQCVQTGKSEWR |
Ga0265758_1021951 | 3300030884 | Soil | MRSKSSHAAESGVGEHTARESEAPNSVRMGKSAWRTPTPKF |
Ga0308202_10587681 | 3300030902 | Soil | MRPKPPHAAGSGVGKHKARESEAPNIVPSGKSAWRTP |
Ga0308206_10603371 | 3300030903 | Soil | MRPKPPHAAESGVGKHKARESEAPNIVPSGKSAWRT |
Ga0138302_17589751 | 3300030937 | Soil | MRSKSSHAAESGVGEHTARESEAPNSVRMGKSAWRTPTPM |
Ga0265737_1037231 | 3300030941 | Soil | MRPKHPHAAESGVGKYTARESERAQCVQTGKSEWRT |
Ga0075381_100376631 | 3300030970 | Soil | MRSKSSHAAESGVGEHTARESEAPNSVRMGKSAWRTPTPKFGPGVAR |
Ga0265748_1030161 | 3300030982 | Soil | MRSKSSHAAESGVGEHTARESEAPNSVRMGKSAWRTPTPKFGP |
Ga0308154_1057202 | 3300030986 | Soil | MRPKHPHAAESGVGEHKARESEAPNVVPPGKSAWR |
Ga0308155_10075392 | 3300030987 | Soil | MRPKHPHAAESGVGEHKARESEAPNVVPPGKSAWRTPTPNFG |
Ga0308155_10086301 | 3300030987 | Soil | MRPKHLHAAESGVGKHKARESEAPNNVPSGKSAWRTPTPKFGP |
Ga0308183_10522661 | 3300030988 | Soil | MRPKPPHAAGSGVGKHKARESEAPNIVPSGKSAWRTPTPKFG |
Ga0308196_10257592 | 3300030989 | Soil | MRPKHPHAAESGVGEHKARESEAPNVVPPGKSAWRTPTPNFGP |
Ga0308178_10418481 | 3300030990 | Soil | MRPKPPHAAGSGVGKHKARESEAPNIVPSGKSAWRTPTPHCKA |
Ga0308178_10475131 | 3300030990 | Soil | MRPKHPHAAESGVGEHKARESEAPNVVPPGKSAWRTPTPNFGPG |
Ga0308178_10635251 | 3300030990 | Soil | MRPIHPHAAESGVGEHTARESEAPNSVPPGKSAWRTP |
Ga0308190_10496981 | 3300030993 | Soil | MRLKHPHAAESGVGEHKARESEAPNIVPLGKSAWRTP |
Ga0265774_1021411 | 3300031011 | Soil | MRSKSSHAAESGVGEHTARESEAPNSVRMGKSAWRTPTPN |
Ga0138298_15657272 | 3300031015 | Soil | MRPKHPHAAESGVGEHTARESEAPNSVRMGKSAWRTPTPKFDRK |
Ga0073998_100295181 | 3300031023 | Soil | MRSKSSHAAESGVGEHTARESEAPNSVRMGKSAWR |
Ga0102746_100025301 | 3300031054 | Soil | MRPKHLHAAESGVGEYTARESEAPNSVPPGKSEWRTPTPKGREGEK |
Ga0308204_100944011 | 3300031092 | Soil | MRPKPPHAAGSGVGKHKARESEAPNIVPSGKSAWRTPT |
Ga0308197_101723561 | 3300031093 | Soil | MRPKPPHAAESGVGKHKARESEAPNIVPSGKSAWRTPTPKFG |
Ga0308199_10471801 | 3300031094 | Soil | MRPKPPHAAGSGVGKHKARESEAPNIVPSGKSAWRTPTPKFGPG |
Ga0308188_10101011 | 3300031097 | Soil | MRPKPPHAAGSGVGKHKARESEAPNIVPSGKSAWR |
Ga0308191_10105881 | 3300031098 | Soil | MRPKPPHAAGSGVGKHKARESEAPNIVPSGKSAWRTPTPKFGP |
Ga0308181_10515622 | 3300031099 | Soil | MRPKHPHAAESGVGEHKARESEAPNVVPPGKSAWRT |
Ga0308187_101689291 | 3300031114 | Soil | MRPKHPHAAESGVGEHKARESEAPNVVPPGKSAWRTPTPN |
Ga0308182_10070591 | 3300031125 | Soil | MRPKPPHAAGSGVGKHKARESEAPNNVPSGKSAWRTP |
Ga0308194_103075471 | 3300031421 | Soil | MRPIHPHAAESGVGEHTARESEAPNSMPPGKSEWRTP |
Ga0308186_10101081 | 3300031422 | Soil | MRPIHPHAAESGVGEHTARESEAPNSMPPGKSEWR |
Ga0308179_10045471 | 3300031424 | Soil | MRPKHPHAAESGVGEHKARESEAPNVVPPGKSAWRTPTPNF |
Ga0308179_10215421 | 3300031424 | Soil | MRPKPPHAAGSGVGKHKARESEAPNIVPSGKSAWRTPTPSLQK |
Ga0314816_10229231 | 3300031481 | Soil | MRPKHPLAAESGVGKHTARESEAPNSVPSGKSAWR |
Ga0314825_1053101 | 3300031490 | Soil | MRPKHPLAAESGVGKHTARESEAPNCVPSGKSAWRTP |
Ga0314820_1076761 | 3300031503 | Soil | MRPKHPLAAESGVGKHTARESEAPNSVPSGNSAWR |
Ga0308150_10132221 | 3300031505 | Soil | MRPKHLHAAESGVGKHKARESEAPNNVPSGKSAWRT |
Ga0307480_10084321 | 3300031677 | Hardwood Forest Soil | MRSKSSHAAESGVGEHTARESEAPNSVPPGKSAWRTPTPKFG |
Ga0302322_1014577981 | 3300031902 | Fen | MRPKHPHAAESGVGEHKARESEAPNIVPLGKSAWRTPTPKFGPGTAR |
Ga0335078_114615761 | 3300032805 | Soil | MRSKTSHAAESGVGEHTARESEAPNSVRPGKSAWRTPTPKFGPGTAR |
Ga0316587_10414431 | 3300033529 | Rhizosphere | MRPRHPHAAESGVGEHTARESEAPNSVPPGKSAWRTPTPQNRKK |
Ga0370544_23343_394_507 | 3300034447 | Soil | MRPKPPHAAESGVGKHKARESEAPNNVPSGKSAWRTPT |
Ga0370545_049944_698_808 | 3300034643 | Soil | MRPKPPHAAESGVGKHKARESEAPNIVPSGKSAWRTP |
Ga0370545_050168_698_808 | 3300034643 | Soil | MRPRHPHAAESGVGEHKARESEAPNTVPPGKSAWRAP |
Ga0370548_040858_1_108 | 3300034644 | Soil | MRPIASHAAMSGVGKHTARESEAPNNVPSGKSAWRT |
Ga0314782_053043_702_812 | 3300034661 | Soil | MRPKHPHAAESGVGEHTARESERAQCVPSGKSAWRTP |
Ga0314782_055077_694_801 | 3300034661 | Soil | MRPIHPHAAESGVGEHTARESEAPNSMPPGKSEWRT |
Ga0314782_077568_603_713 | 3300034661 | Soil | MRPKHPHAAESGVGKHTARESEAPNCVPSGKSAWRTP |
Ga0314784_038942_699_830 | 3300034663 | Soil | MRPKHLHAAESGVGKHKARESEAPNNVPSGKSAWRTPTPKFGPG |
Ga0314792_071756_699_809 | 3300034667 | Soil | MRPKHPHAAESGVGKHKARESEAPNNVPSGKIEWRTT |
Ga0314792_159156_496_609 | 3300034667 | Soil | MRPNQLHAAESGVGKHKARESEAPNNVPSGKSAWRTPT |
Ga0314793_065461_2_112 | 3300034668 | Soil | MRPRHPHAAENGVGKHTARESEAPNSVPSGKSAWRTP |
Ga0314796_083625_560_664 | 3300034671 | Soil | MRPKHLHAAESGVGKHKARESEAPNNVPSGKSAWR |
Ga0314802_024095_517_627 | 3300034677 | Soil | MRPKHPHAAESGVGKYTARESEAPNCVPSGKSAWRTP |
Ga0370546_025591_697_810 | 3300034681 | Soil | MRLKTSHAAESGVGEHTARESEAPNSMPPGKSEWRTPT |
⦗Top⦘ |