NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F020535

Metagenome / Metatranscriptome Family F020535

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020535
Family Type Metagenome / Metatranscriptome
Number of Sequences 223
Average Sequence Length 131 residues
Representative Sequence MAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Number of Associated Samples 144
Number of Associated Scaffolds 223

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.72 %
% of genes near scaffold ends (potentially truncated) 31.39 %
% of genes from short scaffolds (< 2000 bps) 76.23 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.202 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(39.910 % of family members)
Environment Ontology (ENVO) Unclassified
(43.049 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(55.605 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 52.94%    Coil/Unstructured: 47.06%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 223 Family Scaffolds
PF06791TMP_2 7.17
PF10124Mu-like_gpT 2.69
PF11316Rhamno_transf 0.45
PF05136Phage_portal_2 0.45
PF09956DUF2190 0.45

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 223 Family Scaffolds
COG5281Phage-related minor tail proteinMobilome: prophages, transposons [X] 7.17
COG5511Phage capsid proteinMobilome: prophages, transposons [X] 0.45


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002476|metazooDRAFT_10906282All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1488Open in IMG/M
3300003860|Ga0031658_1009134All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1690Open in IMG/M
3300003860|Ga0031658_1018748All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1164Open in IMG/M
3300005528|Ga0068872_10419396All Organisms → cellular organisms → Bacteria → Proteobacteria726Open in IMG/M
3300005581|Ga0049081_10012376All Organisms → Viruses → Predicted Viral3220Open in IMG/M
3300005662|Ga0078894_10255031All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1590Open in IMG/M
3300005662|Ga0078894_10526299All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1059Open in IMG/M
3300005758|Ga0078117_1085865All Organisms → Viruses → Predicted Viral1427Open in IMG/M
3300005805|Ga0079957_1068069All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2072Open in IMG/M
3300006025|Ga0075474_10265049All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium514Open in IMG/M
3300006026|Ga0075478_10010820All Organisms → Viruses → Predicted Viral3106Open in IMG/M
3300006026|Ga0075478_10045361All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1447Open in IMG/M
3300006027|Ga0075462_10057540All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1230Open in IMG/M
3300006027|Ga0075462_10170789All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium660Open in IMG/M
3300006027|Ga0075462_10246834All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium529Open in IMG/M
3300006030|Ga0075470_10033699All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1584Open in IMG/M
3300006637|Ga0075461_10059411All Organisms → Viruses → Predicted Viral1232Open in IMG/M
3300006637|Ga0075461_10063545All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1185Open in IMG/M
3300006637|Ga0075461_10240586All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium533Open in IMG/M
3300006641|Ga0075471_10110872All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1468Open in IMG/M
3300006790|Ga0098074_1017687All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2190Open in IMG/M
3300006802|Ga0070749_10011323All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium5755Open in IMG/M
3300006802|Ga0070749_10023945All Organisms → cellular organisms → Bacteria3848Open in IMG/M
3300006802|Ga0070749_10115074All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1582Open in IMG/M
3300006802|Ga0070749_10163097All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1291Open in IMG/M
3300006802|Ga0070749_10208156All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1119Open in IMG/M
3300006802|Ga0070749_10326750All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium856Open in IMG/M
3300006802|Ga0070749_10384025All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium777Open in IMG/M
3300006802|Ga0070749_10471710All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium686Open in IMG/M
3300006805|Ga0075464_10318681All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium937Open in IMG/M
3300006805|Ga0075464_10800794All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium586Open in IMG/M
3300006805|Ga0075464_10949417All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium538Open in IMG/M
3300006810|Ga0070754_10446537All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium561Open in IMG/M
3300006810|Ga0070754_10461583All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium550Open in IMG/M
3300006863|Ga0075459_1014007All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1316Open in IMG/M
3300006867|Ga0075476_10086121All Organisms → Viruses → Predicted Viral1221Open in IMG/M
3300006867|Ga0075476_10250595All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium631Open in IMG/M
3300006874|Ga0075475_10080475All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1493Open in IMG/M
3300006874|Ga0075475_10243555All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium756Open in IMG/M
3300006916|Ga0070750_10321184All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium658Open in IMG/M
3300006916|Ga0070750_10451355All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium531Open in IMG/M
3300006919|Ga0070746_10409221All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium607Open in IMG/M
3300007094|Ga0102532_1130909All Organisms → Viruses → Predicted Viral1941Open in IMG/M
3300007177|Ga0102978_1130616All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1004Open in IMG/M
3300007177|Ga0102978_1141610All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2635Open in IMG/M
3300007234|Ga0075460_10050679All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1560Open in IMG/M
3300007234|Ga0075460_10101384All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1035Open in IMG/M
3300007236|Ga0075463_10049270All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1365Open in IMG/M
3300007344|Ga0070745_1013872All Organisms → Viruses → Predicted Viral3728Open in IMG/M
3300007344|Ga0070745_1080928All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1290Open in IMG/M
3300007344|Ga0070745_1337287All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium531Open in IMG/M
3300007345|Ga0070752_1276685All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium645Open in IMG/M
3300007346|Ga0070753_1004678All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium6950Open in IMG/M
3300007363|Ga0075458_10030458All Organisms → Viruses → Predicted Viral1709Open in IMG/M
3300007363|Ga0075458_10046166All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1373Open in IMG/M
3300007363|Ga0075458_10133955All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium768Open in IMG/M
3300007538|Ga0099851_1004009All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium6187Open in IMG/M
3300007538|Ga0099851_1080013All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1258Open in IMG/M
3300007538|Ga0099851_1099158All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1111Open in IMG/M
3300007541|Ga0099848_1009449All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium4331Open in IMG/M
3300007541|Ga0099848_1029333All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2299Open in IMG/M
3300007542|Ga0099846_1058769All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1450Open in IMG/M
3300007544|Ga0102861_1018646All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1713Open in IMG/M
3300007640|Ga0070751_1342643All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium549Open in IMG/M
3300007670|Ga0102862_1009791All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2114Open in IMG/M
3300007735|Ga0104988_10293All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium13036Open in IMG/M
3300007735|Ga0104988_10878All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium35655Open in IMG/M
3300007960|Ga0099850_1077936All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1385Open in IMG/M
3300007973|Ga0105746_1310113All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium548Open in IMG/M
3300007974|Ga0105747_1017024All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1958Open in IMG/M
3300007974|Ga0105747_1083007All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium984Open in IMG/M
3300008055|Ga0108970_11428766All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium5996Open in IMG/M
3300008117|Ga0114351_1036478All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium7086Open in IMG/M
3300008117|Ga0114351_1080892All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1941Open in IMG/M
3300008266|Ga0114363_1010536All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium8377Open in IMG/M
3300008266|Ga0114363_1060685All Organisms → Viruses → Predicted Viral1470Open in IMG/M
3300008266|Ga0114363_1088862All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1134Open in IMG/M
3300008450|Ga0114880_1049337All Organisms → Viruses → Predicted Viral1786Open in IMG/M
3300008450|Ga0114880_1050383All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1763Open in IMG/M
3300008450|Ga0114880_1061231All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1555Open in IMG/M
3300008450|Ga0114880_1210557All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium642Open in IMG/M
3300009056|Ga0102860_1008326All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2524Open in IMG/M
3300009081|Ga0105098_10001467All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium8425Open in IMG/M
3300009081|Ga0105098_10049964All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1703Open in IMG/M
3300009081|Ga0105098_10072476All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1442Open in IMG/M
3300009085|Ga0105103_10472868All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium701Open in IMG/M
3300009163|Ga0114970_10022868All Organisms → cellular organisms → Bacteria4216Open in IMG/M
3300009169|Ga0105097_10237816All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1003Open in IMG/M
3300009169|Ga0105097_10322295All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium855Open in IMG/M
3300009169|Ga0105097_10481764All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium693Open in IMG/M
3300010297|Ga0129345_1079202All Organisms → Viruses → Predicted Viral1232Open in IMG/M
3300010354|Ga0129333_10008753All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium9574Open in IMG/M
3300010354|Ga0129333_10041827All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium4309Open in IMG/M
3300010354|Ga0129333_10638532All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium921Open in IMG/M
3300010368|Ga0129324_10113900All Organisms → Viruses → Predicted Viral1155Open in IMG/M
3300010370|Ga0129336_10496867All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium658Open in IMG/M
3300012013|Ga0153805_1000783All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium6663Open in IMG/M
3300012666|Ga0157498_1007782All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1736Open in IMG/M
(restricted) 3300013122|Ga0172374_1048785All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1743Open in IMG/M
(restricted) 3300013122|Ga0172374_1364017All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium509Open in IMG/M
(restricted) 3300013127|Ga0172365_10100065All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1851Open in IMG/M
(restricted) 3300013127|Ga0172365_10336651All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium892Open in IMG/M
(restricted) 3300013128|Ga0172366_10494511All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium734Open in IMG/M
(restricted) 3300013129|Ga0172364_10121812All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1800Open in IMG/M
(restricted) 3300013132|Ga0172372_10180612All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1624Open in IMG/M
(restricted) 3300013132|Ga0172372_10365738All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium999Open in IMG/M
3300013372|Ga0177922_10175652All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1235Open in IMG/M
3300013372|Ga0177922_10232157All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium686Open in IMG/M
3300013372|Ga0177922_10565460All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium924Open in IMG/M
3300017707|Ga0181363_1021683All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1255Open in IMG/M
3300017747|Ga0181352_1001672All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium8493Open in IMG/M
3300017754|Ga0181344_1002256All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium6862Open in IMG/M
3300017766|Ga0181343_1006101All Organisms → Viruses → Predicted Viral4103Open in IMG/M
3300017785|Ga0181355_1137322All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium992Open in IMG/M
3300017788|Ga0169931_10191705All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1758Open in IMG/M
3300017951|Ga0181577_10164424All Organisms → Viruses → Predicted Viral1502Open in IMG/M
3300017951|Ga0181577_10258208All Organisms → Viruses → Predicted Viral1143Open in IMG/M
3300017951|Ga0181577_10413411All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium856Open in IMG/M
3300017951|Ga0181577_10897110All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium529Open in IMG/M
3300018420|Ga0181563_10100781All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1891Open in IMG/M
3300018420|Ga0181563_10239554All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1086Open in IMG/M
3300018421|Ga0181592_10064338All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2903Open in IMG/M
3300018424|Ga0181591_10625870All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium767Open in IMG/M
3300018428|Ga0181568_11061157All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium614Open in IMG/M
3300018428|Ga0181568_11099819All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium601Open in IMG/M
3300019708|Ga0194016_1027878All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium653Open in IMG/M
3300019721|Ga0194011_1001308All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1660Open in IMG/M
3300019745|Ga0194002_1059401All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium614Open in IMG/M
3300019749|Ga0193983_1004138All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1389Open in IMG/M
3300019750|Ga0194000_1004597All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1419Open in IMG/M
3300019753|Ga0194010_1021621All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium914Open in IMG/M
3300019756|Ga0194023_1004532All Organisms → Viruses → Predicted Viral2791Open in IMG/M
3300019937|Ga0194022_1043713All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium588Open in IMG/M
3300020048|Ga0207193_1089695All Organisms → Viruses → Predicted Viral2869Open in IMG/M
3300020054|Ga0181594_10254138All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium833Open in IMG/M
3300020074|Ga0194113_10235863All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1433Open in IMG/M
3300021356|Ga0213858_10310408All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium752Open in IMG/M
3300021368|Ga0213860_10260533All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium760Open in IMG/M
3300021958|Ga0222718_10005461All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium10306Open in IMG/M
3300021958|Ga0222718_10027511All Organisms → Viruses → Predicted Viral3849Open in IMG/M
3300021958|Ga0222718_10446528All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium636Open in IMG/M
3300021960|Ga0222715_10261468All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1002Open in IMG/M
3300021961|Ga0222714_10009668All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium8442Open in IMG/M
3300021962|Ga0222713_10132797All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1741Open in IMG/M
3300021963|Ga0222712_10519104All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium701Open in IMG/M
3300021963|Ga0222712_10769235All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium534Open in IMG/M
3300021964|Ga0222719_10770048All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium533Open in IMG/M
3300022065|Ga0212024_1000471All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium3261Open in IMG/M
3300022071|Ga0212028_1012041All Organisms → Viruses → Predicted Viral1410Open in IMG/M
3300022168|Ga0212027_1017203All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium992Open in IMG/M
3300022183|Ga0196891_1072799All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium612Open in IMG/M
3300022187|Ga0196899_1160211All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium620Open in IMG/M
3300022198|Ga0196905_1007865All Organisms → Viruses → Predicted Viral3625Open in IMG/M
3300022198|Ga0196905_1084534All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium861Open in IMG/M
3300022198|Ga0196905_1115210All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium708Open in IMG/M
3300022200|Ga0196901_1141962All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium806Open in IMG/M
3300022200|Ga0196901_1269556All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium522Open in IMG/M
3300022217|Ga0224514_10023138All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2014Open in IMG/M
3300022934|Ga0255781_10023219All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium3950Open in IMG/M
3300022934|Ga0255781_10107278All Organisms → Viruses → Predicted Viral1513Open in IMG/M
3300023179|Ga0214923_10431127All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium667Open in IMG/M
3300024554|Ga0255242_1004748All Organisms → Viruses → Predicted Viral3166Open in IMG/M
3300024554|Ga0255242_1009491All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2299Open in IMG/M
3300025585|Ga0208546_1001274All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium7938Open in IMG/M
3300025610|Ga0208149_1047863All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1113Open in IMG/M
3300025630|Ga0208004_1007147All Organisms → Viruses → Predicted Viral3880Open in IMG/M
3300025635|Ga0208147_1041212All Organisms → Viruses → Predicted Viral1197Open in IMG/M
3300025646|Ga0208161_1047951All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1385Open in IMG/M
3300025646|Ga0208161_1058958All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1189Open in IMG/M
3300025647|Ga0208160_1096820All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium770Open in IMG/M
3300025655|Ga0208795_1155469All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium567Open in IMG/M
3300025671|Ga0208898_1025228All Organisms → Viruses → Predicted Viral2529Open in IMG/M
3300025687|Ga0208019_1048875All Organisms → Viruses → Predicted Viral1472Open in IMG/M
3300025746|Ga0255241_1026868All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium839Open in IMG/M
3300025771|Ga0208427_1278874All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium506Open in IMG/M
3300025803|Ga0208425_1003405All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium4869Open in IMG/M
3300025803|Ga0208425_1053705All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium999Open in IMG/M
3300025810|Ga0208543_1075032All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium818Open in IMG/M
3300025818|Ga0208542_1027259All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1885Open in IMG/M
3300025818|Ga0208542_1028224All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1845Open in IMG/M
3300025840|Ga0208917_1222795All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium618Open in IMG/M
3300025889|Ga0208644_1183287All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium926Open in IMG/M
3300025889|Ga0208644_1276098All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium680Open in IMG/M
3300025889|Ga0208644_1342398All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium574Open in IMG/M
3300025896|Ga0208916_10033430All Organisms → Viruses → Predicted Viral2074Open in IMG/M
3300025896|Ga0208916_10219766All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium824Open in IMG/M
3300025896|Ga0208916_10336240All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium658Open in IMG/M
3300027205|Ga0208926_1052774All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium601Open in IMG/M
3300027210|Ga0208802_1043871All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium609Open in IMG/M
3300027302|Ga0255096_1091445All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium593Open in IMG/M
3300027659|Ga0208975_1188563All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium557Open in IMG/M
3300027721|Ga0209492_1022275All Organisms → Viruses → Predicted Viral2180Open in IMG/M
3300027769|Ga0209770_10044756All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1893Open in IMG/M
3300027805|Ga0209229_10058173All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1727Open in IMG/M
3300027816|Ga0209990_10448915All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium553Open in IMG/M
3300027899|Ga0209668_10055982All Organisms → Viruses → Predicted Viral2145Open in IMG/M
3300027899|Ga0209668_10159846All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1374Open in IMG/M
3300027899|Ga0209668_10211243All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1213Open in IMG/M
3300027899|Ga0209668_10540401All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium776Open in IMG/M
3300027956|Ga0209820_1010918All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2242Open in IMG/M
3300031758|Ga0315907_10017975All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium6633Open in IMG/M
3300031758|Ga0315907_10025350All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium5423Open in IMG/M
3300031758|Ga0315907_10823126All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium690Open in IMG/M
3300031787|Ga0315900_10024290All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium6920Open in IMG/M
3300031787|Ga0315900_10310596All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1300Open in IMG/M
3300031857|Ga0315909_10312729All Organisms → Viruses → Predicted Viral1168Open in IMG/M
3300031951|Ga0315904_10027758All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium6658Open in IMG/M
3300031951|Ga0315904_10719180All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium836Open in IMG/M
3300031951|Ga0315904_10887995All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium721Open in IMG/M
3300032050|Ga0315906_10026260All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium6373Open in IMG/M
3300032050|Ga0315906_11087595All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium592Open in IMG/M
3300032116|Ga0315903_10486543All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium979Open in IMG/M
3300033993|Ga0334994_0584853All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium504Open in IMG/M
3300034012|Ga0334986_0058994All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium2407Open in IMG/M
3300034062|Ga0334995_0579153All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium657Open in IMG/M
3300034096|Ga0335025_0151212All Organisms → Viruses → Predicted Viral1355Open in IMG/M
3300034121|Ga0335058_0140032All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1417Open in IMG/M
3300034355|Ga0335039_0363856All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium750Open in IMG/M
3300034374|Ga0348335_053411All Organisms → Viruses → Predicted Viral1538Open in IMG/M
3300034374|Ga0348335_084722All Organisms → Viruses → Predicted Viral1055Open in IMG/M
3300034375|Ga0348336_054022All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1628Open in IMG/M
3300034375|Ga0348336_133324All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium770Open in IMG/M
3300034418|Ga0348337_056536All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1529Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous39.91%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh5.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.38%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.38%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake4.48%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.04%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water4.04%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.59%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment2.69%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment2.69%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.69%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.24%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.24%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.24%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.79%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.79%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.35%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.90%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.90%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.90%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake0.45%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.45%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.45%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.45%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.45%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice0.45%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.45%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice0.45%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.45%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.45%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.45%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002476Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012EnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006863Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNAEnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007094Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A)EnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007670Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3EnvironmentalOpen in IMG/M
3300007735Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014OctEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300013122 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3mEnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300013129 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cmEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019708Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MGEnvironmentalOpen in IMG/M
3300019721Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_7-8_MGEnvironmentalOpen in IMG/M
3300019745Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_8-9_MGEnvironmentalOpen in IMG/M
3300019749Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_4-5_MGEnvironmentalOpen in IMG/M
3300019750Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States - FLT_6-7_MGEnvironmentalOpen in IMG/M
3300019753Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_6-7_MGEnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300019937Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MGEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020054Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022217Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300024554Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025746Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027205Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027210Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027302Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8dEnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
metazooDRAFT_1090628223300002476LakeMAAGTPFTGKSMTFKSGATPAAQDHVGKWELTIGGASGKYATNSTGGWRKTTVGVGEWSGSVTIMLHDGGGMPYARGDEVAAQFHADSDDYISGTIIITEVGAITFDADSGDPVAIDYKFDGQGVPSKSGSAFKVV*
Ga0031658_100913433300003860Freshwater Lake SedimentMPAGNVFSGKDMSFKTGATPTVEVHTGKWELTITGNPGKFATNSTGGWRKSVKGVKEWSGTVTVMLHDGEAMPFVVDDEMAAQFLVDATNYISGTILITEVGSITVDADSGDPIAIDYKFDGQGAPSSSGTAMDVV*
Ga0031658_101874823300003860Freshwater Lake SedimentMAAGNVFSGKDMTFKSGATPTVEPHTGKWEITITGNVGKFASNSTGGWRKSVKGPKEWSGTVTVMLHDGEAMPFVVDDEIACQFHVDATNYISGTILVTEVGAITVDADSGDPIAIDYKFDGQGVPATSGTAMDIV*
Ga0068872_1041939623300005528Freshwater LakeMAAGTPFTGKSMTFKTGSPAAEVDHTGKWELTIGGASAKYATNSTGAWRKSTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIIITEVGPITFDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA*
Ga0049081_1001237663300005581Freshwater LenticMAAGTPFTGKSMTFKTGGTPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTIMLHAGGAQPLARGDEVAAQFHADSDDYISGTIIITEVGPITFDADSGDPVAIDYAFDGQGLPAKSGTAFDIIA*
Ga0078894_1025503113300005662Freshwater LakeMAAGTVFSGKDMTFKTGSPVAEEVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEIAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV*
Ga0078894_1052629933300005662Freshwater LakeMAAGTVFSGKDMTFKTGSPVAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPA
Ga0078117_108586523300005758Lake WaterMPAGTPFTGKSMTFKTGASPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITFDADSGDPVAIDYAFDGQGLPAKSGTAFDIIA*
Ga0079957_106806933300005805LakeMAAGTVFSGKDMTFKTGSPAAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEVAAQFHADSGDPVAVDYKFSGQGAPAASGTAFDVV*
Ga0075474_1026504913300006025AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITQVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0075478_1001082023300006026AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGAQGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADSGEPVAIDYAFDGQGTPATSGTAFSLV*
Ga0075478_1004536133300006026AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRVNVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0075462_1005754023300006027AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADSGEPVAIDYAFDGQGTPATSGTAFSLV*
Ga0075462_1017078923300006027AqueousTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0075462_1024683413300006027AqueousMTAGTVFTGKDMTFKFGDPVTEAVQTGKWRIGLGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGAAMPLKRGDEVAAQFHADADDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0075470_1003369913300006030AqueousMAAGTVFSGKDMTFKTGSPAAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFVLNDEVAAQFHADSDDYISGSILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFGVV*
Ga0075461_1005941123300006637AqueousMAAGNVFTGKDMTFKTGGTPAEEVHTGKWELTIGGASGKFASNSTGGWRKTTLGAGEWSGSVTVMLHDGEGQPLKRGDEVAAQFHADADDYISGTIVITNVGPITFDADSGDPVAIDYAFDGQGVPASSGTAFSIV*
Ga0075461_1006354533300006637AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHANSDDYISGTIIITDVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0075461_1024058623300006637AqueousMAAGTVFSGKDMTFKTGSPAAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFVLNDEVAAQFHADSDDYI
Ga0075471_1011087213300006641AqueousMAAGTVFSGKDMTFKTGSPAAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFVLNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFGVV*
Ga0098074_101768723300006790MarineMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0070749_1001132353300006802AqueousMAAGNVYSGKDMTFKTGSPVAEEVHTGKWELTIGGASGKFASNSTGGWRKTTLGAGEWSGSVTVMLHDGEGQPLKRGDEVAAQFHADADDYISGTIIITNVGPITFDADSGDPVAIDYAFDGQGVPASSGTAFSIV*
Ga0070749_1002394563300006802AqueousMAAGTPFTGKSMTFKTGGTPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTIMLHAGGAQPLARGDEVAAQFHAASDDYISGTIIITEVGPITFDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA*
Ga0070749_1011507423300006802AqueousMAAGTVFTGKDMTFKTGSPAAEEVHTGKWELTVTGSSGKYASNSTGGFRKTVVGAKEWSGSVTVMLHDGEAQPLKVGDEVAAQFHADADDYISGTIIVTSVGPITLDADSGDPVAIDYAFDGQGAPSQSGTAFSIV*
Ga0070749_1016309713300006802AqueousSPAAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFVLNDEVAAQFHADSDDYISGSILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFGVV*
Ga0070749_1020815623300006802AqueousMAAGTVFTGKSMTFKFGDPIAEAVQTGKWRISVGGASGKYASNSTGGFRKTTVGASEWSGTVTIMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITGVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0070749_1032675023300006802AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTVIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0070749_1038402523300006802AqueousMAAGAVYTGKNMTFKTGSPATEEVHTGKWEVTIGGASGKFASNSTGGWRKTTIGAGEWSGSVTVMLHDGEGQPLKRGDEVVAQFHADTDDYISGTVIITNVGPITMDADSGDPVAIDYAFDGQGVPASSGTAFSIV*
Ga0070749_1047171023300006802AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0075464_1031868123300006805AqueousMAAGTVFSGKDMTFKTGSPAAEKVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGEAMPFVLNDEVAAQFHADSDDYISGSILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV*
Ga0075464_1080079413300006805AqueousMAAGTVFSGKDMTFKTGSPAAEKVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFVLNDEAAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV*
Ga0075464_1094941713300006805AqueousTFKTGSPAAEKVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFVLNDEAAAQFHADSDDYISGSILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV*
Ga0070754_1044653723300006810AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRISVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0070754_1046158323300006810AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITDVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0075459_101400743300006863AqueousMAAGTVFSGKDMTFKIGSPVVEEPHSGRWEITLTSNGGKYASNSTSGWRKTVKGVREWSGTVRIMLHDGESMPFVLNDEVASQFHVDSDDYISG
Ga0075476_1008612133300006867AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITQVGDIALEADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0075476_1025059523300006867AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADS
Ga0075475_1008047523300006874AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRISVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0075475_1024355513300006874AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATS
Ga0070750_1032118413300006916AqueousVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0070750_1045135523300006916AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITQVGDIELDADSGDPV
Ga0070746_1040922123300006919AqueousVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTVIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0102532_113090913300007094Freshwater LakeMAAGTPFTGKSMTFKTGASPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIIITEVGPITFDADSGDPVAIDYAFDGQGLPAKSGTAFDIIA*
Ga0102978_113061623300007177Freshwater LakeMAAGTPFTGKSMTFKTGASPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITFDADSGDPVAIDYAFDGQGLPAKSGTAFDIIA*
Ga0102978_114161043300007177Freshwater LakePTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITFDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA*
Ga0075460_1005067943300007234AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHANSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATYGTAFSLV*
Ga0075460_1010138423300007234AqueousMAAGTVFSGKDMTFKTGSPAAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRVMLHDGESMPFVLNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV*
Ga0075463_1004927033300007236AqueousMTAGTVFTGKDMTFKFGDPVTEAVQTGKWRIGLGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGAAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV*
Ga0070745_101387223300007344AqueousMAAGNVFTGKDMTFKTGGTPAEEVHTGKWELTIGGASGKFASNSTGGWRKTTIGAGEWSGSVTVMLHDGEGQPLKRGDEVVAQFHADTDDYISGTVIITNVGPITMDADSGDPVAIDYAFDGQGVPASSGTAFSIV*
Ga0070745_108092813300007344AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRISVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSL
Ga0070745_133728723300007344AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITQVGDIELDADSGDPVAIDYAFDGQGTPA
Ga0070752_127668523300007345AqueousMTAGTVFTGKDMTFKFGDPVTEAVQTGKWRISLGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGAAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADSGDPVAIDYAFDGQG
Ga0070753_1004678103300007346AqueousMAAGNVFTGKDMTFKTGGTPAEEVHTGKWELTIGGASGKFASNSTGGWRKTTLGAGEWSGSVTVMLHDGEGQPLKRGDEVAAQFHADADDYISGTIIITNVGPITFDADSGDPVAIDYAFDGQGVPASSGTAFSIV*
Ga0075458_1003045843300007363AqueousMAAGTVFSGKDMTFKIGSPVVEEPHSGRWEITLTSNGGKYASNSTSGWRKTVKGVREWSGTVRIMLHDGESMPFVLNDEVASQFHVDSDDYISGTIMITEVGPITVDADSGDPVAIDYKFAGQGAPSASGTAFDVV*
Ga0075458_1004616623300007363AqueousMAAGTPFTGKSMTFKTGASPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGSVTIMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITFDADSGDPVAIDYAFDGQGLPAKSGTAFDIIS*
Ga0075458_1013395513300007363AqueousHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTIMLHAGGAQPLARGDEVAAQFHADSDDYISGTIIITEVGPITFDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA*
Ga0099851_100400963300007538AqueousMAAGNVFTGKDMTFKTGGTPAEEVHTGKWELTIGGASGKFASNSTGGWRKTTLGAGEWSGSVTVMLHDGEGQPLKRGDEVAAQFHAGAGDYISGTIIITNVGPITFDADSGDPVAIDYAFDGQGVPASSGTAFSIV*
Ga0099851_108001333300007538AqueousMAAGTVFSGKDMTFKTGSPVAEEVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRVMLHDGESMPFVLNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKF
Ga0099851_109915813300007538AqueousTGKWEVTIGGASGKFASNSTGGWRKTTIGAGEWSGSVTVMLHDGEGQPLKRGDEVVAQFHADTDDYISGTVIITNVGPITMDADSGDPVAIDYAFDGQGVPASSGTAFSIV*
Ga0099848_100944973300007541AqueousMAAGTVFSGKDMTFKTGSPVAEEVHTGRWEITLTSDGGKYASNSTSGWRKTVKGVREWSGTVRIMLHDGESMPFVLHDETAAQFHVDSDDYISGTILITEVGPITVDADSGDPIAIDYKFDGQGAPATSGTAFDVV*
Ga0099848_102933353300007541AqueousMAAGTVFSGKDMTFKTGSPVAEEVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRVMLHDGESMPFVLNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPATSGTGFDVV*
Ga0099846_105876933300007542AqueousMAAGTVFSGKDMTFKTGSPAAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRVMLHDGESMPFVLNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFAGQGAPATSGTAFDVV*
Ga0102861_101864623300007544EstuarineMAAGTVFSGKDMTFKTGSPVAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV*
Ga0070751_134264323300007640AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAF
Ga0102862_100979133300007670EstuarineMAAGTVFSGKDMTFKTGSPVAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRVMLHDGEAMPFVLNDEIAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPASSGTAFDVV*
Ga0104988_1029373300007735FreshwaterMAAGTPFTGKSMTFKTGGTPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITFDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA*
Ga0104988_10878153300007735FreshwaterMAAGTPFTGKSMTFKTGASPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIIITEVGPITFDADSGDPVAIDYAFNGQGAPSKSGTAFDIIA*
Ga0099850_107793633300007960AqueousMAAGTVFSGKDMTFKTGSPVAEEVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRVMLHDGESMPFVLNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPATSGTAFDVV*
Ga0105746_131011323300007973Estuary WaterMPAGTPFTGKSMTFKTGASPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTIMLHAGGAQPVAGGDEVAALFHADSDDYISGTIFITEVGPITFDADSGDPVA
Ga0105747_101702443300007974Estuary WaterMAAGTVFSGKDMTFKTGSPVAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPASSGTAFDVV*
Ga0105747_108300733300007974Estuary WaterMAAGTVFSGKDMTFKIGSPVVEEPHTGRWEITLTANSGKYASNSTSGWRKSVKGTKEWSGTVRVMLHDGEAMPFVLNDEIAAQFHADSDDYISGTILITEVGPITLD
Ga0108970_1142876683300008055EstuaryMPAGTPFTGKSMTFKTGASPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTIMLHAGGAHPLARGDEVAAQFHADSDDYISGTIVITEVGPITFDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA*
Ga0114351_103647883300008117Freshwater, PlanktonMAAGTPFTGKSMTFKTGASPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITLDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA*
Ga0114351_108089233300008117Freshwater, PlanktonMAAGTPFTGKSMTFKTGGTPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTIMLHAGGAQPLARGGEVAAQFHADSDDYISGTIIITEVGPITFDADSGDPVAIDYAFDGQGLPAKSGTAFDIIA*
Ga0114363_101053673300008266Freshwater, PlanktonMTLKTGSPAAALDHVGSWELTIGGATGKYATNSTGGWRKTTVGVGEWSGKMTIMLHGGGAQPLARGDEVAAQFHADDDDYISGTIVITEVGPITLDADSGDPVAIDYSFDGQGAPSKSGTAFDIIA*
Ga0114363_106068543300008266Freshwater, PlanktonKTGGTPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVSEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITFDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA*
Ga0114363_108886223300008266Freshwater, PlanktonMAAGTVFSGKDMTFKIGSPLVEEPHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV*
Ga0114880_104933723300008450Freshwater LakeMAAGTPFTGKSMTFKTGGTPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVSEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITFDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA*
Ga0114880_105038353300008450Freshwater LakeMAAGTVFSGKDMTFKTGSPAAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTREWSGTVRVMLHDGESMPFVLNDEIAAQFHADSDDYISGTILITEVGPI
Ga0114880_106123113300008450Freshwater LakeMAAGTVFSGKDMTFKTGSPAAEEVHSGRWEITLPSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV*
Ga0114880_121055723300008450Freshwater LakeMPAGKAFTGKDMTLKTGSPAAVVDHCGSWELTIGGASGKYASNSTAGWRKTTIGVSEWSGKMTIMLHDGGGQPLARGDEVAAQFHADSDDYVSGTIVITEVGPITLDADSGDPVAIDYAFDGQGAPSKSGNAFDIIA*
Ga0102860_100832643300009056EstuarineMAAGTVFSGKDMTFKTGSPVAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEIAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV*
Ga0105098_1000146773300009081Freshwater SedimentMAAGAVFSGKDMTFKTGSPVAEEVHTGRWEITLTSDGGKYASNSTSGWRKTVKGVREWSGTVRIMLHDGESMPFILNDEVASQFHVDSDDYISGTIMITEVGPITVDADSGDPIAIDYKFAGQGAPAASGTAFDVV*
Ga0105098_1004996413300009081Freshwater SedimentMPAGNVFSGKDMSFKTGSTPTVEVHTGKWELTITGNVGKYASNSTGGWRKSVKGVKEWSGSVTVMLHDGEAMPFVVDDEIAAQFLVDSSNYISGTILITEVGSITVDADSGDPIAIDYKFDGQGAPSSSGTAMDVV*
Ga0105098_1007247613300009081Freshwater SedimentMPAGNVFSGKDMSFKTGSTPTVEVHTGKWELTITGNAGKYASNSTGGWRKSVKGVKEWSGTVTVMLHDGEAMPFVVDDEIAAQFLVDSSNYISGTILITEVGSITVDADSGDPIAIDYKFDGQGAPASSGTAMDVV*
Ga0105103_1047286823300009085Freshwater SedimentMPAGNVFSGKDMSFKTGSTPTAEVHTGKWELTITGNAGKYASNSTGGWRKSVKGVKEWSGSVTVMLHDGEAMPFVVDDEIAAQFLVDSSNYISGTILITEVGSITVDADSGDPIAIDYKFDGQGAPASSGTAMDVV*
Ga0114970_1002286883300009163Freshwater LakeMTAGNVFSGKDMSFKTGSTPTVEVHTGKWELTITGNAGKYASNSTGGWRKSVKGVKEWSGTVTVMLHDGEAMPFVVDDEAAAQFLVDATNYISGTILITEVGSITVDADSGDPIAIDYKFDGQGAPSSSGTAMDVV*
Ga0105097_1023781613300009169Freshwater SedimentMPAGNVFSGKDISFKTGSTPTVEVHTGKWELTITGNAGKYASNSTGGWRKSVKGVKEWSGSVTVMLHDGEAMPFVVDDEMAAQFLVDASNYISGTILITEVG
Ga0105097_1032229513300009169Freshwater SedimentMAAGAVFSGKDMTFKTGSPVAEEVHTGRWEITLTSDGGKYASNSTSGWRKTVKGVREWSGTVRIMLHDGESMPFILNDEVASQFHVDSDDYISGTIMITEVGPITVDADSGDPI
Ga0105097_1048176423300009169Freshwater SedimentMPAGNVFSGKDMSFKTGSTPTAEVHTGKWELTITGNAGKYASNSTGGWRKSVKGVKEWSGTVTVLLHDGEAMPFVVDDEIAAQFLVDANNYISGTILITEVGSITVDADSGDPIAIDYKFDGQGAPASSGTAMDVV*
Ga0129345_107920233300010297Freshwater To Marine Saline GradientMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITQVGDIALEADSGDPIAIDYAFDGQGTPATSGTAFSLV*
Ga0129333_1000875363300010354Freshwater To Marine Saline GradientMTLKTGSPAAALDHVGSWELTIGGASGKYASNSTAGWRKTTIGVGEWSGKMTIMLHDGGGQPLARGDEVAAQFHADSDDYISGTIVITEVGPITLDADSGDPVAIDYAFDGQGAPSKSGNAFDIIA*
Ga0129333_1004182723300010354Freshwater To Marine Saline GradientMAAGTVFSGKDMTFKIGSPLVEEPHSGRWEITLTSNSGKYASNSTSGWRKSVKGTREWSGTVRIMLHDGEAMPFVLNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV*
Ga0129333_1063853223300010354Freshwater To Marine Saline GradientMAAGTPFTGKSMTFKTGSPAAEVDHTGEWALTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTIMLHAGGAQPLARGDEVAAQFHADSDDYISGTIIITEVGPITFDADSGDPVAIDYAFDGQGAPSKSGTTFDIIA*
Ga0129324_1011390013300010368Freshwater To Marine Saline GradientAMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTACSLV*
Ga0129336_1049686713300010370Freshwater To Marine Saline GradientMAAGTVFSGKDMTFKTGSPAAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTREWSGTVRVMLHDGESMPFVLNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV*
Ga0153805_100078343300012013Surface IceMAAGTVFSGKDMTFKTGSPVAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTREWSGTVRIMLHDGESMPFILNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV*
Ga0157498_100778253300012666Freshwater, Surface IceMAAGTVFSGKDMTFKTGSPVAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTREWSGTVRIMLHDGEAMPFVLNDEIAAQFHADSDDYISGTILI
(restricted) Ga0172374_104878523300013122FreshwaterMAAGTPFTGKSMTFKSGATPAAQDHVGKWELTIGGASGKFATNSTGGFRKTTIGVGEYSGSVTILLHDGGGMPYARGDEVAAQFHADSDDYISGTIIFTEVGPITLDADSGDPVAIDYKFDGQGAPSKSGNAFKVV*
(restricted) Ga0172374_136401713300013122FreshwaterMTFKSGATPAAQDHVGKWELTIGGASGKFATNSTGGFRKTTVGVGEWSGSVTIMLHDGGGMPYARGDEVAAQFHADADDYISGTIIFTEVGPITLDADSGDPVAIDYKFDGQGAPSKSGNAFKVV*
(restricted) Ga0172365_1010006533300013127SedimentGTPFTGKSMTFKSGATPAAQDHVGKWELTIGGASGKFATNSTGGFRKTTIGVGEYSGSVTILLHDGGGMPYARGDEVAAQFHADSDDYISGTIIFTEVGPITLDADSGDPVAIDYKFDGQGAPSKSGNAFKVV*
(restricted) Ga0172365_1033665123300013127SedimentMAAGTPFTGKSMTFKSGATPAVQDHVGKWELTIGGASGKFATNSTGGFRKTTIGVGEYSGSVTILLHDGGGMPYARGDEVSAQFHADSDDYISGTIIYTEVGPITLDADSG
(restricted) Ga0172366_1049451113300013128SedimentMAAGTPFTGKSMTFKSGATPAAQDHVGKWELTIGGASGKFATNSTGGFRKTTIGVGEYSGSVTILLHDGGGMPYARGDEVAAQFHADSDDYISGTIIFTEVGPITLDADSGDPVAIDYKFDGQGAPSKS
(restricted) Ga0172364_1012181223300013129SedimentMAAGTPFTGKSMTFKSGATPAVQDHVGKWELTIGGASGKFATNSTGGFRKTTIGVGEYSGSVTILLHDGGGMPYARGDEVAAQFHADSDDYISGTIIFTEVGPITLDADSGDPVAIDYKFDGQGAPSKSGNAFKVV*
(restricted) Ga0172372_1018061233300013132FreshwaterMPAGTPFTGKSMTFKTGSPAAEVVHTGSWELTIGGASEKYATNSTGGWRKTTVGVGEWSGKVTVMLHDGEGQPLARGDSVAAQFHADADDYISGTITITEVGPITFDADSGAAVAIDYQFDGQGAPSKSGNAFDIL*
(restricted) Ga0172372_1036573813300013132FreshwaterMAAGTPFTGKSMTFKSGATPAAQDHVGKWELTIGGASGKFATNSTGGFRKTTIGVGEYSGSVTILLHDGGGMPYARGDEVAAQFHADADDYISGTIIITEVGPITLDADSGDPVAIDYKFDGQGAPSKSGNAFKVV*
Ga0177922_1017565213300013372FreshwaterMAAGTVFSGKDMTFKIGSPLVEEPHSGRWEITLTSNSGKYASNSTSGWRKSVKGTREWSGTVRIMLHDGESMPFVLNDEIAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFAGQGAPAASGTAFDVV*
Ga0177922_1023215723300013372FreshwaterMAAGTAFSGKDMTFKTGSPVAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEVAAQFHADSDDYISGTILITEVGPITMDADSGDPVAIDYKFSGQGAPAASGTAFDVV*
Ga0177922_1056546023300013372FreshwaterMAAGTVFSGKDMTFKTGSPVAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTREWSGTVRIMLHDGEAMPFVLNDEIAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV*
Ga0181363_102168343300017707Freshwater LakeMAAGTVFSGKDMTFKTGSPVAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPASSGTAFDVV
Ga0181352_100167283300017747Freshwater LakeMAAGTVFSGKDMTFKTGSPVAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEIAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPASSGTAFDVV
Ga0181344_100225613300017754Freshwater LakeMPAGNVFSGKDMSFKTGSTPTVEVHTGKWELTITGNAGKFASNSTGGWRKSVKGVKEWSGTVTVMLHDGEAMPFVVDDEVAAQFLVDATNYISGTILITEVGSITVDADSGDPIAIDYKFDGQGAPSSSGT
Ga0181343_100610133300017766Freshwater LakeMPAGNVFSGKDMSFKTGSTPTVEVHTGKWELTITGNAGKFASNSTGGWRKSVKGVKEWSGTVTVMLHDGEAMPFVVDDEVAAQFLVDATNYISGTILITEVGSITVDADSGDPIAIDYKFDGQGAPSSSGTAMDVV
Ga0181355_113732213300017785Freshwater LakeMAAGTVFSGKDMTFKTGSPVAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKF
Ga0169931_1019170533300017788FreshwaterMAAGTPFTGKSMTFKSGATPAVQDHVGKWELTIGGASGKFATNSTGGFRKTTVGVGEWSGSVTIMLHDGGGMPYARGDEVAAQFHADADDYISGTIIITEVGAITLDADSGDPVAIDYKFDGQGAPSKSGNAFKVV
Ga0181577_1016442423300017951Salt MarshMAAGNVFTGKDMTFKTGCTPAEEVHTGKWELTIGGASGKFASNSTGGWRKTTLGAGEWSGSVTVMLHDGEGQPLKRGDEVAAQFHADADDYISGTIIITNVGPITLDADSGDPVAIDYAFDGQGVPASSGTAFSIV
Ga0181577_1025820823300017951Salt MarshMAAGNVYSGKDMTFKTGSPVAEEVHTGKWELTIGGASGKFASNSTGGWRKTTLGAGEWSGSVTVMLHDGEGQPLKRGDEVAAQFHADADDYISGTIIITNVGPITFDADSGDPVAIDYAFDGQGVPASSGTAFSIV
Ga0181577_1041341123300017951Salt MarshMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRSSVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0181577_1089711013300017951Salt MarshMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITQVGDIELDADSGEPVAIDYAFDGQGTPATSGTAFSLV
Ga0181563_1010078113300018420Salt MarshKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITQVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0181563_1023955423300018420Salt MarshMAAGTVFSGKDMTFKTGSPAAEKVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFVLNDEAAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV
Ga0181592_1006433853300018421Salt MarshMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVEAQFHADADDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0181591_1062587023300018424Salt MarshMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITQVGDIELDADSGDPVAIDYGFDGQGTPATSGTAFSLV
Ga0181568_1106115723300018428Salt MarshVAEAVQTGKWRISVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0181568_1109981923300018428Salt MarshMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRISVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDG
Ga0194016_102787813300019708SedimentMAAGTVITGRDMTFKTGGTPAEEVHTGKWEVTVTGSRGKYASNSTGGFRKTVIGAKEWSGSVTVMLHDGEGQPLKVGDEVAAQFHADADDYISGTIIVTDVGPITLDADSGDPVAIDYAFDGQGTPSQSGTMFSIV
Ga0194011_100130813300019721SedimentMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTVIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0194002_105940113300019745SedimentMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGKFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITEVGDIELDADSGEPVAIDYAFDGQGSPSTS
Ga0193983_100413833300019749SedimentMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTVIITEVGAIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0194000_100459733300019750SedimentMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0194010_102162133300019753SedimentMTAGTVFTGKDMTFKFGDPVTEAVQTGKWRIGLGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGAAMPLKRGDEVAAQFHADADDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPA
Ga0194023_100453243300019756FreshwaterMAAGTVFTGKDMTFKTGATPTEEVHTGKWEVTIGGASGKFASNSTGGWRKTTLGAGEWSGSVTVMLHDGEGQPLKRGDEIDAQFHADADDYISGTIIITNVGPITMDADSGDPVAIDYAFDGQGVPASSGTAFSIV
Ga0194022_104371323300019937FreshwaterEVHTGKWELTIGGASGKFASNSTGGWRKTTLGAGEWSGSVTVMLHDGEGQPLKRGDEVAAQFHADADDYISGTIIITSVGPITMDADSGDPVAIDYAFDGQGVPASSGTAFSIV
Ga0207193_108969533300020048Freshwater Lake SedimentMPAGNVFSGKDMSFKTGSTPTVEVHTGKWELTITGNVGKYASNSTGGWRKSVKGVKEWSGSVTVMLHDGEAMPFVVDDEIAAQFLVDSSNYISGTILITEVGSITVDADSGDPIAIDYKFDGQGAPSSSGTAMDVV
Ga0181594_1025413823300020054Salt MarshMAAGTVFSGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0194113_1023586323300020074Freshwater LakeMAAGTPFTGKSMTFKSGATPAAQDHVGKWELTIGGASGKFATNSTGGFRKTTIGVGEYSGSVTILLHDGGGMPYARGDEVAAQFHADADDYISGTIIITEVGPITLDADSGDPVAIDYKFDGQGAPSKSGNAFKVV
Ga0213858_1031040823300021356SeawaterMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGAQGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADSGDPVAID
Ga0213860_1026053313300021368SeawaterKFGDPVAEAVQTGKWRVNVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0222718_1000546173300021958Estuarine WaterMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGAQGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0222718_1002751133300021958Estuarine WaterMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRVNVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0222718_1044652813300021958Estuarine WaterMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0222715_1026146823300021960Estuarine WaterMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRVNVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0222714_10009668103300021961Estuarine WaterMAAGTPFTGKSMTFKTGGTPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTIMLHAGGAQPLARGDEVAAQFHADSDDYISGTIIITEVGPITFDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA
Ga0222713_1013279733300021962Estuarine WaterMAAGTVFSGKDMTFKTGSPAAEKVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFVLNDEAAAQFHADSDDYISGSILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV
Ga0222712_1051910423300021963Estuarine WaterEEVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV
Ga0222712_1076923523300021963Estuarine WaterMAAGTVFSGKDMTFKTGSPAAEKVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFVLNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPSASGTAFDVV
Ga0222719_1077004823300021964Estuarine WaterMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADS
Ga0212024_100047133300022065AqueousMTAGTVFTGKDMTFKFGDPVTEAVQTGKWRIGLGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGAAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0212028_101204123300022071AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGAQGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADSGEPVAIDYAFDGQGTPATSGTAFSLV
Ga0212027_101720333300022168AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGAQGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADSGEPVAID
Ga0196891_107279923300022183AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITQVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0196899_116021123300022187AqueousFKFGDPVAEAVQTGKWRINVGGAQGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADSGEPVAIDYAFDGQGTPATSGTAFSLV
Ga0196905_100786533300022198AqueousMAAGNVFTGKDMTFKTGGTPAEEVHTGKWELTIGGASGKFASNSTGGWRKTTLGAGEWSGSVTVMLHDGEGQPLKRGDEVAAQFHAGAGDYISGTIIITNVGPITFDADSGDPVAIDYAFDGQGVPASSGTAFSIV
Ga0196905_108453423300022198AqueousMAAGTVFSGKDMTFKTGSPVAEEVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRVMLHDGESMPFVLNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPATSGTAFDVV
Ga0196905_111521023300022198AqueousFTGKDMTFKTGSPAAEEVHTGKWELTVTGSSGKYASNSTGGFRKTVVGAKEWSGSVTVMLHDGEAQPLKVGDEVAAQFHADADDYISGTIIVTSVGPITLDADSGDPVAIDYAFDGQGAPSQSGTAFSIV
Ga0196901_114196213300022200AqueousAVYTGKNMTFKTGSPATEEVHTGKWEVTIGGASGKFASNSTGGWRKTTIGAGEWSGSVTVMLHDGEGQPLKRGDEVVAQFHADTDDYISGTVIITNVGPITMDADSGDPVAIDYAFDGQGVPASSGTAFSIV
Ga0196901_126955623300022200AqueousMAAGTVFSGKDMTFKTGSPVAEEVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRVMLHDGESMPFVLNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFAGQGAPATSGTAFDVV
Ga0224514_1002313833300022217SedimentMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRISVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0255781_1002321943300022934Salt MarshMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRISVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTVIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0255781_1010727823300022934Salt MarshMAAGNVFTGKDMTFKTGGTPAEEVHTGKWELTIGGASGKFASNSTGGWRKTTLGAGEWSGSVTVMLHDGEGQPLKRGDEVAAQFHADADDYISGTIIITNVGPITLDADSGDPVAIDYAFDGQGVPASSGTAFSIV
Ga0214923_1043112723300023179FreshwaterMAAGTVFSGKDMTFKTGSPAAEKVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFVLNDEAAAQFHADSNDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV
Ga0255242_100474863300024554FreshwaterMAAGTVFSGKDMTFKTGSPVAEEVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV
Ga0255242_100949143300024554FreshwaterMPAGTPFTGKSMTFKTGGTPAEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITFDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA
Ga0208546_100127443300025585AqueousMAAGTVFSGKDMTFKTGSPAAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFVLNDEVAAQFHADSDDYISGSILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFGVV
Ga0208149_104786323300025610AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRVNVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0208004_100714723300025630AqueousMAAGNVFTGKDMTFKTGGTPAEEVHTGKWELTIGGASGKFASNSTGGWRKTTLGAGEWSGSVTVMLHDGEGQPLKRGDEVAAQFHADADDYISGTIVITNVGPITFDADSGDPVAIDYAFDGQGVPASSGTAFSIV
Ga0208147_104121233300025635AqueousMAAGTVFSGKDMTFKIGSPVVEEPHSGRWEITLTSNGGKYASNSTSGWRKTVKGVREWSGTVRIMLHDGESMPFVLNDEVASQFHVDSDDYISGTIMITEVGPITVDADSGDPVAIDYKFAGQGAPSASGTAFDVV
Ga0208161_104795133300025646AqueousMAAGAVYTGKNMTFKTGSPATEEVHTGKWEVTIGGASGKFASNSTGGWRKTTIGAGEWSGSVTVMLHDGEGQPLKRGDEVVAQFHADTDDYISGTVIITNVGPITMDADSGDPVAIDYAFDGQGVPASSGTAFSIV
Ga0208161_105895813300025646AqueousMAAGTVFSGKDMTFKTGSPVAEEVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRVMLHDGESMPFVLNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVA
Ga0208160_109682023300025647AqueousMAAGNVFTGKDMTFKTGGTPAEEVHTGKWEVTIGGASGKFASNSTGGWRKTTLGAGEWSGSVTVMLHDGEGQPLKRGDEVAAQFHAGAGDYISGTIIITNVGPITFDADSGDPVAIDYAFDGQGVPASSGTAFSIV
Ga0208795_115546923300025655AqueousMAAGTVFSGKDMTFKTGSPVAEEVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRVMLHDGESMPFVLNDEVAAQFHADSDDYISGTIIITEVGDIELDADSG
Ga0208898_102522813300025671AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITQVGDIELDADSGDPVAIDYAFDGQGTPAT
Ga0208019_104887533300025687AqueousTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0255241_102686823300025746FreshwaterMPAGTPFTGKSMTFNTGGTPAEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITFDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA
Ga0208427_127887413300025771AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITDVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0208425_100340563300025803AqueousMTAGTVFTGKDMTFKFGDPVTEAVQTGKWRIGLGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGAAMPLKRGDEVAAQFHADADDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0208425_105370513300025803AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADSGEPVAIDYAFDGQGTPATSGTAFSLV
Ga0208543_107503213300025810AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITQVGDIELDADSGDPVAIDYAF
Ga0208542_102725953300025818AqueousMAAGTVFSGKDMTFKTGSPVAEEVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRVMLHDGESMPFVLNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFAGQGAPATSG
Ga0208542_102822423300025818AqueousMAAGTVFTGKSMTFKFGDPIAEAVQTGKWRISVGGASGKYASNSTGGFRKTTVGASEWSGTVTIMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITGVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0208917_122279523300025840AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRISVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADADDYISGTIIITQVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0208644_118328723300025889AqueousMAAGTVFTGKDMTFKTGSPAAEEVHTGKWELTVTGSSGKYASNSTGGFRKTVVGAKEWSGSVTVMLHDGEAQPLKVGDEVAAQFHADADDYISGTIIVTSVGPITLDADSGDPVAIDYAFDGQGAPSQSGTAFSIV
Ga0208644_127609813300025889AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHANSDDYISGTIIITEVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0208644_134239813300025889AqueousMAAGTVFSGKDMTFKTGSPAAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTREWSGTVRVMLHDGESMPFILNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFAGQGAPSA
Ga0208916_1003343043300025896AqueousTFKTGSPAAEKVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFVLNDEAAAQFHADSDDYISGSILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV
Ga0208916_1021976613300025896AqueousMAAGTVFSGKDMTFKTGSPAAEKVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFVLNDEAAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTA
Ga0208916_1033624013300025896AqueousMAAGTVFSGKDMTFKTGSPAAEKVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGEAMPFVLNDEVAAQFHADSDDYISGSILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV
Ga0208926_105277423300027205EstuarineMAAGTVFSGKDMTFKTGSPVAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPASSGTAFD
Ga0208802_104387113300027210EstuarineMAAGTVFSGKDMTFKTGSPVAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRVMLHDGEAMPFVLNDEIAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPASSGTAFDVV
Ga0255096_109144523300027302FreshwaterANTMPAGTPFTGKSMTFKTGGTPAEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITFDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA
Ga0208975_118856313300027659Freshwater LenticKTGGTPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTIMLHAGGAQPLARGDEVAAQFHADSDDYISGTIIITEVGPITFDADSGDPVAIDYAFDGQGLPAKSGTAFDIIA
Ga0209492_102227543300027721Freshwater SedimentMPAGNVFSGKDISFKTGSTPTVEVHTGKWELTITGNAGKYASNSTGGWRKSVKGVKEWSGTVTVMLHDGEAMPFVVDDEIAAQFLVDANNYISGTILITEVGSITVDADSGDPIAIDYKFDGQGAPASSGTAMDVV
Ga0209770_1004475643300027769Freshwater LakeMAAGTVFSGKDMTFKTGSPVAEEVHTGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEIAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV
Ga0209229_1005817313300027805Freshwater And SedimentGKSMTFKTGSPAAEVDHTGKWELTIGGASAKYATNSTGAWRKSTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIIITEVGPITFDADSGDPVAIDYAFDGQGLPAKSGTAFDIIA
Ga0209990_1044891513300027816Freshwater LakeFKTGASPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITLDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA
Ga0209668_1005598233300027899Freshwater Lake SedimentMAAGNVFSGKDMTFKSGATPTVEPHTGKWEITITGNVGKFASNSTGGWRKSVKGPKEWSGTVTVMLHDGEAMPFVVDDEIACQFHVDATNYISGTILVTEVGAITVDADSGDPIAIDYKFDGQGVPATSGTAMDIV
Ga0209668_1015984623300027899Freshwater Lake SedimentMAAGTVFSGKDMTFKTGSPVAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSGQGAPAASGTAFDVV
Ga0209668_1021124323300027899Freshwater Lake SedimentMPAGNVFSGKDMSFKTGATPTVEVHTGKWELTITGNPGKFATNSTGGWRKSVKGVKEWSGTVTVMLHDGEAMPFVVDDEMAAQFLVDATNYISGTILITEVGSITVDADSGDPIAIDYKFDGQGAPSSSGTAMDVV
Ga0209668_1054040123300027899Freshwater Lake SedimentMPAGNVFSGKDMSFKTGATPTVEVHTGKWELTITGNAGKFASNSTGGWRKSVKGVKEWSGTVTVMLHDGEAMPFVVDDEMAAQFLVDATNYISGTILITEVGSITVDADSGDPIAIDYKFDGQGAPSSSGTAMDVV
Ga0209820_101091843300027956Freshwater SedimentMAAGAVFSGKDMTFKTGSPVAEEVHTGRWEITLTSDGGKYASNSTSGWRKTVKGVREWSGTVRIMLHDGESMPFILNDEVASQFHVDSDDYISGTIMITEVGPITVDADSGDPIAIDYKFAGQGAPAASGTAFDVV
Ga0315907_1001797563300031758FreshwaterMAAGTPFTGKSMTFKTGASPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITLDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA
Ga0315907_1002535073300031758FreshwaterMAAGTPFTGKSMTLKTGSPAAALDHVGSWELTIGGATGKYATNSTGGWRKTTVGVGEWSGKMTIMLHGGGAQPLARGDEVAAQFHADDDDYISGTIVITEVGPITLDADSGDPVAIDYSFDGQGAPSKSGTAFDIIA
Ga0315907_1082312623300031758FreshwaterMAAGTPFTGKSMTFKTGGTPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTIMLHAGGAQPLARGDEVAAQFHADSDDYISGTIIITEVGPITFDADSGDPVAIDYAFDGQGLPAKSGTAFDIIA
Ga0315900_1002429023300031787FreshwaterMAAGTPFTGKSMTFKTGGTPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITLDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA
Ga0315900_1031059623300031787FreshwaterMAAGTPFTGKSMTFKTGGTPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVSEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITFDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA
Ga0315909_1031272923300031857FreshwaterMAAGTVFSGKDMTFKIGSPLVEEPHSGRWEITLTSNSGKYASNSTSGWRKSVKGTREWSGTVRVMLHDGESMPFVLNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFAGQGAPAASGTAFDVV
Ga0315904_1002775883300031951FreshwaterPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIVITEVGPITLDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA
Ga0315904_1071918023300031951FreshwaterMAAGTVFSGKDMTFKIGSPLVEEPHSGRWEITLTSNSGKYASNSTSGWRKSVKGTREWSGTVRIMLHDGESMPFVLNDEIAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFAGQGAPSASGTAFDVV
Ga0315904_1088799513300031951FreshwaterAAGTVFSGKDMTFKTGSPAAEEVHSGRWEITLTSNSGKYASNSTSGWRKSVKGTREWSGTVRVMLHDGESMPFVLNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFAGQGAPSASGTAFDVV
Ga0315906_1002626083300032050FreshwaterMTLKTGSPAAALDHVGSWELTIGGATGKYATNSTGGWRKTTVGVGEWSGKMTIMLHGGGAQPLARGDEVAAQFHADDDDYISGTIVITEVGPITLDADSGDPVAIDYSFDGQGAPSKSGTAFDIIA
Ga0315906_1108759513300032050FreshwaterMAAGTVFSGKDMTFKIGSPLVEEPHSGRWEITLTSNSGKYASNSTSGWRKSVKGTKEWSGTVRIMLHDGESMPFILNDEVAAQFHADSDDYISGTILITEVGPITLDADSGDPVAIDYKFSG
Ga0315903_1048654313300032116FreshwaterMAAGTVFSGKDMTFKIGSPLVEEPHSGRWEITLTSNSGKYASNSTSGWRKSVKGTREWSGTVRIMLHDGESMPFVLNDEIAAQFHADSDDYISGTIL
Ga0334994_0584853_2_3343300033993FreshwaterMTLKTGSPAAALDHVGSWELTIGGASGKYASNSTAGWRKTTIGVGEWSGKMTIMLHDGGGQPLARGDEVAAQFHADSDDYISGTIVITEVGPITLDADSGDPVAIDYAFDG
Ga0334986_0058994_407_7873300034012FreshwaterMTLKTGSPAAALDHVGSWEVTIGGASGKYASNSTAGWRKTTIGVGEWSGKMTIMLHDGGGQPLARGDEVAAQFHADSDDYISGTIVITEVGPITLDADSGDPVAIDYAFDGQGAPSKSGNAFDIIA
Ga0334995_0579153_106_5163300034062FreshwaterMPAGAPFTGKDGDLKKGSPAAQVVQTVGWEVTIGGASGKYASNSTSGWRKTVMGASEWSGSCTVLLHGGEAQPFKRGDEVAAQFHVDSDDYISGTILITEVGPITVDLDSGEPIAIQYSFDGQGAPSDSGTAFAIV
Ga0335025_0151212_225_6383300034096FreshwaterMAAGTPFTGKSMTFKTGGTPTEVDHTGKWELTIGGASAKYATNSTGGWRKTTVGVGEWSGTVTIMLHAGGAQPLARGDEVAAQFHADSDDYINGTIVITEVGPITFDADSGDPVAIDYAFDGQGLPAKSGTAFDIIA
Ga0335058_0140032_824_12343300034121FreshwaterMAAGTVFSGKDMTLKSGATPTVEVHTGKWELTIAGSPGKYASNSTGGWRKSVKGPKEWSGTITCMLHDGEVQPFVVDDEIACQFHVNDTNYIAGTVLITEVGPITLDADSGDPVAIDYKFAGQGAPTAMGTAMDVV
Ga0335039_0363856_363_7433300034355FreshwaterMTFKTGSPAAEVDHTGKWELTIGGASAKYATNSTGAWRKSTVGVGEWSGTVTVMLHAGGAQPLARGDEVAAQFHADSDDYISGTIIITEVGPITFDADSGDPVAIDYAFDGQGAPSKSGTAFDIIA
Ga0348335_053411_1148_15253300034374AqueousMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITDVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0348335_084722_431_8413300034374AqueousMAAGNVFTGKDMTFKTGGTPAEEVHTGKWELTIGGASGKFASNSTGGWRKTTLGAGEWSGSVTVMLHDGEGQPLKRGDEVAAQFHADADDYISGTIIITNVGPITFDADSGDPVAIDYAFDGQGVPASSGTAFSIV
Ga0348336_054022_1292_16273300034375AqueousTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITQVGDIELDADSGDPVAIDYAFDGQGTPATSGTAFSLV
Ga0348336_133324_130_5403300034375AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITQVGDIALEADSGDPIAIDYAFDGQGTPATSGTAFSLV
Ga0348337_056536_870_12803300034418AqueousMAAGTVFTGKDMTFKFGDPVAEAVQTGKWRINVGGASGKYASNSTGGFRKTTVGVSEWSGTVTVMLHDGEAMPLKRGDEVAAQFHADSDDYISGTIIITQVGDIALEADSGDPVAIDYAFDGQGTPATSGTAFSLV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.