Metagenome / Metatranscriptome Family F020346

Select file to download:
Download

Basic Information
Family ID	F020346
Family Type	Metagenome / Metatranscriptome
Number of Sequences	224
Average Sequence Length	47 residues
Representative Sequence	MYAAALWRSRGSLENVFASFDGMGTAPQQSLTPIVKQLLGIDRPAVA
Number of Associated Samples	152
Number of Associated Scaffolds	224

Basic Information

Family ID

F020346

Family Type

Metagenome / Metatranscriptome

Number of Sequences

224

Average Sequence Length

47 residues

Representative Sequence

MYAAALWRSRGSLENVFASFDGMGTAPQQSLTPIVKQLLGIDRPAVA

Number of Associated Samples

152

Number of Associated Scaffolds

224

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	2.24 %
% of genes near scaffold ends (potentially truncated)	96.43 %
% of genes from short scaffolds (< 2000 bps)	95.09 %
Associated GOLD sequencing projects	142
AlphaFold2 3D model prediction	No

Quality Assessment

Transcriptomic Evidence

Yes

Most common taxonomic group

Viruses

% of genes with valid RBS motifs

2.24 %

% of genes near scaffold ends (potentially truncated)

96.43 %

% of genes from short scaffolds (< 2000 bps)

95.09 %

Associated GOLD sequencing projects

142

AlphaFold2 3D model prediction

Hidden Markov Model

Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (49.107 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Taxonomy

Group

Duplodnaviria (49.107 % of family members)

NCBI Taxonomy ID

2731341

Taxonomy

All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (29.464 % of family members)
Environment Ontology (ENVO)	Unclassified (55.804 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (57.143 % of family members)

Most Common Ecosystem

GOLD Ecosystem

Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(29.464 % of family members)

Environment Ontology (ENVO)

Unclassified
(55.804 % of family members)

Earth Microbiome Project Ontology (EMPO)

Free-living → Non-saline → Water (non-saline)
(57.143 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 34.04% β-sheet: 0.00% Coil/Unstructured: 65.96%
Feature Viewer

Powered by Feature Viewer

Predicted Topology & Secondary Structure

Classification:

Globular

Signal Peptide:

Secondary Structure distribution:

α-helix: 34.04% β-sheet: 0.00% Coil/Unstructured: 65.96%

Feature Viewer

Powered by Feature Viewer

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	53.12 %
Unclassified	root	N/A	46.88 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	53.12 %
Unclassified	root	N/A	46.88 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	49.11 %
Unclassified	root	N/A	46.88 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	4.02 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	49.11 %
Unclassified	root	N/A	46.88 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	4.02 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	49.11 %
Unclassified	root	N/A	46.88 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	4.02 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	49.11 %
Unclassified	root	N/A	46.88 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	4.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.88 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	36.16 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	4.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.88 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	36.16 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	4.02 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002408\|B570J29032_108947689	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	548	Open in IMG/M
3300003277\|JGI25908J49247_10165846	Not Available	512	Open in IMG/M
3300003404\|JGI25920J50251_10125949	Not Available	570	Open in IMG/M
3300005580\|Ga0049083_10166818	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	753	Open in IMG/M
3300005581\|Ga0049081_10186368	Not Available	749	Open in IMG/M
3300005581\|Ga0049081_10213242	Not Available	688	Open in IMG/M
3300005582\|Ga0049080_10313382	Not Available	505	Open in IMG/M
3300005662\|Ga0078894_10363276	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1310	Open in IMG/M
3300005662\|Ga0078894_10524517	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1061	Open in IMG/M
3300005662\|Ga0078894_10998426	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	720	Open in IMG/M
3300005940\|Ga0073913_10017569	Not Available	1012	Open in IMG/M
3300005943\|Ga0073926_10024910	Not Available	1104	Open in IMG/M
3300005943\|Ga0073926_10100027	Not Available	591	Open in IMG/M
3300006639\|Ga0079301_1205537	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	564	Open in IMG/M
3300006641\|Ga0075471_10402211	Not Available	687	Open in IMG/M
3300006802\|Ga0070749_10229842	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1055	Open in IMG/M
3300006802\|Ga0070749_10400316	Not Available	757	Open in IMG/M
3300006802\|Ga0070749_10657747	Not Available	562	Open in IMG/M
3300006802\|Ga0070749_10799993	Not Available	500	Open in IMG/M
3300006803\|Ga0075467_10157509	All Organisms → Viruses → Predicted Viral	1298	Open in IMG/M
3300006805\|Ga0075464_10174167	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1271	Open in IMG/M
3300006805\|Ga0075464_10343266	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	902	Open in IMG/M
3300006805\|Ga0075464_10353009	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	890	Open in IMG/M
3300006805\|Ga0075464_10900026	Not Available	552	Open in IMG/M
3300006805\|Ga0075464_10980700	Not Available	530	Open in IMG/M
3300006863\|Ga0075459_1022993	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1038	Open in IMG/M
3300006870\|Ga0075479_10097055	All Organisms → Viruses → Predicted Viral	1225	Open in IMG/M
3300006917\|Ga0075472_10604541	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	549	Open in IMG/M
3300006920\|Ga0070748_1165664	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	818	Open in IMG/M
3300007346\|Ga0070753_1284214	Not Available	594	Open in IMG/M
3300007363\|Ga0075458_10051244	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1298	Open in IMG/M
3300007363\|Ga0075458_10172636	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	666	Open in IMG/M
3300007542\|Ga0099846_1181448	Not Available	748	Open in IMG/M
3300007542\|Ga0099846_1188073	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	732	Open in IMG/M
3300007708\|Ga0102859_1041733	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1256	Open in IMG/M
3300007708\|Ga0102859_1202905	Not Available	590	Open in IMG/M
3300007960\|Ga0099850_1335974	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	568	Open in IMG/M
3300008055\|Ga0108970_10032117	Not Available	637	Open in IMG/M
3300008450\|Ga0114880_1054093	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1684	Open in IMG/M
3300008450\|Ga0114880_1221485	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	615	Open in IMG/M
3300008450\|Ga0114880_1266825	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	522	Open in IMG/M
3300009039\|Ga0105152_10123867	Not Available	1054	Open in IMG/M
3300009039\|Ga0105152_10197627	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	827	Open in IMG/M
3300009081\|Ga0105098_10302081	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	769	Open in IMG/M
3300009159\|Ga0114978_10833633	Not Available	518	Open in IMG/M
3300009159\|Ga0114978_10857056	Not Available	509	Open in IMG/M
3300009161\|Ga0114966_10178633	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1361	Open in IMG/M
3300009161\|Ga0114966_10411969	Not Available	788	Open in IMG/M
3300009163\|Ga0114970_10365583	Not Available	808	Open in IMG/M
3300009165\|Ga0105102_10766555	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	547	Open in IMG/M
3300009180\|Ga0114979_10291073	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	972	Open in IMG/M
3300009180\|Ga0114979_10774546	Not Available	539	Open in IMG/M
3300009181\|Ga0114969_10149143	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1470	Open in IMG/M
3300009181\|Ga0114969_10617777	Not Available	592	Open in IMG/M
3300009183\|Ga0114974_10164121	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1380	Open in IMG/M
3300009184\|Ga0114976_10157200	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1270	Open in IMG/M
3300009529\|Ga0114919_10112735	All Organisms → Viruses → Predicted Viral	1971	Open in IMG/M
3300009529\|Ga0114919_10163883	All Organisms → Viruses → Predicted Viral	1595	Open in IMG/M
3300009564\|Ga0130019_1031188	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	695	Open in IMG/M
3300010299\|Ga0129342_1263254	Not Available	599	Open in IMG/M
3300010316\|Ga0136655_1051881	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1281	Open in IMG/M
3300010368\|Ga0129324_10153765	Not Available	957	Open in IMG/M
3300010368\|Ga0129324_10154409	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	954	Open in IMG/M
3300010885\|Ga0133913_12263393	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1337	Open in IMG/M
3300011009\|Ga0129318_10238511	Not Available	596	Open in IMG/M
3300011995\|Ga0153800_1036127	Not Available	527	Open in IMG/M
3300012013\|Ga0153805_1045570	Not Available	745	Open in IMG/M
3300012013\|Ga0153805_1090722	Not Available	519	Open in IMG/M
3300012017\|Ga0153801_1026088	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1036	Open in IMG/M
3300012663\|Ga0157203_1033738	Not Available	713	Open in IMG/M
3300013004\|Ga0164293_10221306	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1354	Open in IMG/M
3300013004\|Ga0164293_10728447	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	633	Open in IMG/M
3300013004\|Ga0164293_11063854	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	501	Open in IMG/M
3300013005\|Ga0164292_10970410	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	531	Open in IMG/M
3300013005\|Ga0164292_11046618	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	507	Open in IMG/M
3300013010\|Ga0129327_10411263	Not Available	719	Open in IMG/M
3300013092\|Ga0163199_1075344	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1464	Open in IMG/M
(restricted) 3300013122\|Ga0172374_1286575	Not Available	584	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10938899	Not Available	500	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10995723	Not Available	506	Open in IMG/M
(restricted) 3300013137\|Ga0172375_10456218	Not Available	865	Open in IMG/M
3300013372\|Ga0177922_10157095	Not Available	632	Open in IMG/M
(restricted) 3300014720\|Ga0172376_10323681	Not Available	912	Open in IMG/M
(restricted) 3300014720\|Ga0172376_10779461	Not Available	512	Open in IMG/M
3300015050\|Ga0181338_1034458	Not Available	765	Open in IMG/M
3300015050\|Ga0181338_1048787	Not Available	620	Open in IMG/M
3300017701\|Ga0181364_1019031	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1134	Open in IMG/M
3300017707\|Ga0181363_1059316	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	674	Open in IMG/M
3300017707\|Ga0181363_1066894	Not Available	625	Open in IMG/M
3300017716\|Ga0181350_1138201	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	575	Open in IMG/M
3300017722\|Ga0181347_1183624	Not Available	557	Open in IMG/M
3300017736\|Ga0181365_1123128	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	621	Open in IMG/M
3300017736\|Ga0181365_1167516	Not Available	516	Open in IMG/M
3300017747\|Ga0181352_1078820	Not Available	923	Open in IMG/M
3300017747\|Ga0181352_1140003	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	645	Open in IMG/M
3300017754\|Ga0181344_1002338	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6738	Open in IMG/M
3300017761\|Ga0181356_1121333	Not Available	834	Open in IMG/M
3300017761\|Ga0181356_1232344	Not Available	532	Open in IMG/M
3300017761\|Ga0181356_1251817	Not Available	503	Open in IMG/M
3300017766\|Ga0181343_1019119	All Organisms → Viruses → Predicted Viral	2129	Open in IMG/M
3300017774\|Ga0181358_1239930	Not Available	575	Open in IMG/M
3300017774\|Ga0181358_1279230	Not Available	516	Open in IMG/M
3300017774\|Ga0181358_1290928	Not Available	501	Open in IMG/M
3300017777\|Ga0181357_1002793	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6972	Open in IMG/M
3300017777\|Ga0181357_1088496	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1181	Open in IMG/M
3300017777\|Ga0181357_1100732	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1095	Open in IMG/M
3300017777\|Ga0181357_1170366	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	792	Open in IMG/M
3300017777\|Ga0181357_1216740	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	677	Open in IMG/M
3300017777\|Ga0181357_1259063	Not Available	602	Open in IMG/M
3300017777\|Ga0181357_1286250	Not Available	564	Open in IMG/M
3300017778\|Ga0181349_1085706	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1194	Open in IMG/M
3300017778\|Ga0181349_1194686	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	704	Open in IMG/M
3300017778\|Ga0181349_1202649	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	685	Open in IMG/M
3300017778\|Ga0181349_1259255	Not Available	577	Open in IMG/M
3300017780\|Ga0181346_1216519	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	683	Open in IMG/M
3300017780\|Ga0181346_1244282	Not Available	630	Open in IMG/M
3300017780\|Ga0181346_1264409	Not Available	596	Open in IMG/M
3300017784\|Ga0181348_1281061	Not Available	564	Open in IMG/M
3300017784\|Ga0181348_1299174	Not Available	539	Open in IMG/M
3300017784\|Ga0181348_1318657	Not Available	515	Open in IMG/M
3300017785\|Ga0181355_1194796	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	799	Open in IMG/M
3300017785\|Ga0181355_1212089	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	756	Open in IMG/M
3300017785\|Ga0181355_1247883	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	684	Open in IMG/M
3300017785\|Ga0181355_1282107	Not Available	629	Open in IMG/M
3300017785\|Ga0181355_1309187	Not Available	591	Open in IMG/M
3300018416\|Ga0181553_10260647	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	978	Open in IMG/M
3300018420\|Ga0181563_10362769	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	834	Open in IMG/M
3300019784\|Ga0181359_1057719	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1489	Open in IMG/M
3300019784\|Ga0181359_1091072	Not Available	1130	Open in IMG/M
3300019784\|Ga0181359_1092758	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1117	Open in IMG/M
3300019784\|Ga0181359_1190311	Not Available	670	Open in IMG/M
3300020160\|Ga0211733_11186153	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	854	Open in IMG/M
3300020162\|Ga0211735_10691109	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	708	Open in IMG/M
3300020172\|Ga0211729_10380691	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1277	Open in IMG/M
3300020179\|Ga0194134_10313563	Not Available	613	Open in IMG/M
3300020221\|Ga0194127_10681613	Not Available	646	Open in IMG/M
3300020494\|Ga0208326_105511	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1192	Open in IMG/M
3300021962\|Ga0222713_10289659	All Organisms → Viruses → Predicted Viral	1048	Open in IMG/M
3300021963\|Ga0222712_10039229	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3642	Open in IMG/M
3300021963\|Ga0222712_10595161	Not Available	639	Open in IMG/M
3300022072\|Ga0196889_1078614	Not Available	616	Open in IMG/M
3300022179\|Ga0181353_1024767	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1586	Open in IMG/M
3300022179\|Ga0181353_1089433	Not Available	768	Open in IMG/M
3300022179\|Ga0181353_1109008	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	673	Open in IMG/M
3300022190\|Ga0181354_1026662	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1870	Open in IMG/M
3300022190\|Ga0181354_1172865	Not Available	662	Open in IMG/M
3300022925\|Ga0255773_10237184	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	791	Open in IMG/M
3300024262\|Ga0210003_1243476	Not Available	714	Open in IMG/M
3300024348\|Ga0244776_10442612	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	852	Open in IMG/M
3300025075\|Ga0209615_107405	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	613	Open in IMG/M
3300025585\|Ga0208546_1121565	Not Available	572	Open in IMG/M
3300025635\|Ga0208147_1003953	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4371	Open in IMG/M
3300025645\|Ga0208643_1084681	Not Available	897	Open in IMG/M
3300025645\|Ga0208643_1178747	Not Available	516	Open in IMG/M
3300025646\|Ga0208161_1134655	Not Available	636	Open in IMG/M
3300025647\|Ga0208160_1156818	Not Available	546	Open in IMG/M
3300025655\|Ga0208795_1052904	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1195	Open in IMG/M
3300025655\|Ga0208795_1178756	Not Available	511	Open in IMG/M
3300025759\|Ga0208899_1150810	Not Available	795	Open in IMG/M
3300025771\|Ga0208427_1113165	Not Available	926	Open in IMG/M
3300025771\|Ga0208427_1174071	Not Available	698	Open in IMG/M
3300025843\|Ga0209182_10240280	Not Available	509	Open in IMG/M
3300027114\|Ga0208009_1057085	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	712	Open in IMG/M
3300027127\|Ga0255071_1015831	All Organisms → Viruses → Predicted Viral	1209	Open in IMG/M
3300027128\|Ga0255099_1012743	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1669	Open in IMG/M
3300027131\|Ga0255066_1056751	Not Available	548	Open in IMG/M
3300027133\|Ga0255070_1020149	All Organisms → Viruses → Predicted Viral	1110	Open in IMG/M
3300027134\|Ga0255069_1000718	All Organisms → Viruses → Predicted Viral	3039	Open in IMG/M
3300027137\|Ga0255092_1007885	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2466	Open in IMG/M
3300027141\|Ga0255076_1055806	Not Available	668	Open in IMG/M
3300027508\|Ga0255072_1119427	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	514	Open in IMG/M
3300027518\|Ga0208787_1135520	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	561	Open in IMG/M
3300027578\|Ga0255075_1075510	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	591	Open in IMG/M
3300027586\|Ga0208966_1128647	Not Available	681	Open in IMG/M
3300027659\|Ga0208975_1060339	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1148	Open in IMG/M
3300027679\|Ga0209769_1185117	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	650	Open in IMG/M
3300027688\|Ga0209553_1224196	Not Available	600	Open in IMG/M
3300027697\|Ga0209033_1194934	Not Available	609	Open in IMG/M
3300027759\|Ga0209296_1011190	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5379	Open in IMG/M
3300027764\|Ga0209134_10275691	Not Available	574	Open in IMG/M
3300027770\|Ga0209086_10125769	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1273	Open in IMG/M
3300027785\|Ga0209246_10236566	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	709	Open in IMG/M
3300027785\|Ga0209246_10360371	Not Available	551	Open in IMG/M
3300027798\|Ga0209353_10139865	Not Available	1083	Open in IMG/M
3300027798\|Ga0209353_10342584	Not Available	625	Open in IMG/M
3300027804\|Ga0209358_10220909	Not Available	969	Open in IMG/M
3300027808\|Ga0209354_10119598	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1075	Open in IMG/M
3300027808\|Ga0209354_10438964	Not Available	503	Open in IMG/M
3300027899\|Ga0209668_10381195	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	920	Open in IMG/M
3300028025\|Ga0247723_1166906	Not Available	505	Open in IMG/M
3300031539\|Ga0307380_10716242	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	840	Open in IMG/M
3300031565\|Ga0307379_11641953	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	504	Open in IMG/M
3300031566\|Ga0307378_10420772	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1221	Open in IMG/M
3300031566\|Ga0307378_10929747	Not Available	716	Open in IMG/M
3300031566\|Ga0307378_11355487	Not Available	551	Open in IMG/M
3300031673\|Ga0307377_11183438	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	501	Open in IMG/M
3300031746\|Ga0315293_10803162	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	689	Open in IMG/M
3300031746\|Ga0315293_10936664	Not Available	622	Open in IMG/M
3300031857\|Ga0315909_10691432	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	664	Open in IMG/M
3300031885\|Ga0315285_10662066	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	679	Open in IMG/M
3300031952\|Ga0315294_10468037	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1161	Open in IMG/M
3300031999\|Ga0315274_11558387	Not Available	624	Open in IMG/M
3300031999\|Ga0315274_11621744	Not Available	606	Open in IMG/M
3300032046\|Ga0315289_11401087	Not Available	542	Open in IMG/M
3300032116\|Ga0315903_10900519	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	632	Open in IMG/M
3300033233\|Ga0334722_10053409	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3177	Open in IMG/M
3300033816\|Ga0334980_0229062	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	738	Open in IMG/M
3300033981\|Ga0334982_0459202	Not Available	569	Open in IMG/M
3300033992\|Ga0334992_0284752	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	781	Open in IMG/M
3300033996\|Ga0334979_0667118	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	546	Open in IMG/M
3300034062\|Ga0334995_0432902	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	812	Open in IMG/M
3300034063\|Ga0335000_0204096	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1271	Open in IMG/M
3300034064\|Ga0335001_0298736	Not Available	880	Open in IMG/M
3300034066\|Ga0335019_0313150	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	982	Open in IMG/M
3300034092\|Ga0335010_0623099	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	543	Open in IMG/M
3300034093\|Ga0335012_0498815	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	578	Open in IMG/M
3300034095\|Ga0335022_0402798	Not Available	739	Open in IMG/M
3300034106\|Ga0335036_0692269	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	605	Open in IMG/M
3300034111\|Ga0335063_0495540	Not Available	596	Open in IMG/M
3300034112\|Ga0335066_0377867	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	779	Open in IMG/M
3300034279\|Ga0335052_0021214	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4059	Open in IMG/M
3300034279\|Ga0335052_0484461	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	643	Open in IMG/M
3300034356\|Ga0335048_0496924	Not Available	584	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.55%
Host-Associated	Host-Associated	0.45%

Habitat

Taxonomy

Distribution

Environmental

99.55%

Host-Associated

0.45%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	93.75%
Terrestrial	Environmental → Terrestrial	5.80%
Plants	Host-Associated → Plants	0.45%

Habitat

Taxonomy

Distribution

Aquatic

Environmental → Aquatic

93.75%

Terrestrial

Environmental → Terrestrial

5.80%

Plants

Host-Associated → Plants

0.45%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	70.98%
Marine	Environmental → Aquatic → Marine	22.77%
Soil	Environmental → Terrestrial → Soil	4.02%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.79%
Leaf	Host-Associated → Plants → Leaf	0.45%

Habitat

Taxonomy

Distribution

Freshwater

Environmental → Aquatic → Freshwater

70.98%

Marine

Environmental → Aquatic → Marine

22.77%

Soil

Environmental → Terrestrial → Soil

4.02%

Deep Subsurface

Environmental → Terrestrial → Deep Subsurface

1.79%

Leaf

Host-Associated → Plants → Leaf

0.45%

Habitat	Taxonomy	Distribution
Lentic	Environmental → Aquatic → Freshwater → Lentic	33.48%
Lake	Environmental → Aquatic → Freshwater → Lake	29.02%
Coastal	Environmental → Aquatic → Marine → Coastal	17.41%
River	Environmental → Aquatic → Freshwater → River	4.02%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	2.68%
Clay	Environmental → Terrestrial → Soil → Clay	2.68%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.79%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.34%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	1.34%
Oceanic	Environmental → Aquatic → Marine → Oceanic	1.34%
Unclassified	Environmental → Aquatic → Marine → Unclassified	1.34%
Sand	Environmental → Terrestrial → Soil → Sand	1.34%
Ice	Environmental → Aquatic → Freshwater → Ice	0.89%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.45%
Pond	Environmental → Aquatic → Freshwater → Pond	0.45%
Unclassified	Host-Associated → Plants → Leaf → Unclassified	0.45%

Habitat

Taxonomy

Distribution

Lentic

Environmental → Aquatic → Freshwater → Lentic

33.48%

Lake

Environmental → Aquatic → Freshwater → Lake

29.02%

Coastal

Environmental → Aquatic → Marine → Coastal

17.41%

River

Environmental → Aquatic → Freshwater → River

4.02%

Intertidal Zone

Environmental → Aquatic → Marine → Intertidal Zone

2.68%

Clay

Environmental → Terrestrial → Soil → Clay

2.68%

Unclassified

Environmental → Terrestrial → Deep Subsurface → Unclassified

1.79%

Sediment

Environmental → Aquatic → Freshwater → Sediment

1.34%

Unclassified

Environmental → Aquatic → Freshwater → Unclassified

1.34%

Oceanic

Environmental → Aquatic → Marine → Oceanic

1.34%

Unclassified

Environmental → Aquatic → Marine → Unclassified

1.34%

Sand

Environmental → Terrestrial → Soil → Sand

1.34%

Ice

Environmental → Aquatic → Freshwater → Ice

0.89%

Lotic

Environmental → Aquatic → Freshwater → Lotic

0.45%

Pond

Environmental → Aquatic → Freshwater → Pond

0.45%

Unclassified

Host-Associated → Plants → Leaf → Unclassified

0.45%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	32.59%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	24.11%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	17.41%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	4.91%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	4.02%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	2.68%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.79%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.34%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	1.34%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	1.34%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	1.34%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	1.34%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	1.34%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.34%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.89%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	0.45%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.45%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.45%
Unclassified	Environmental → Aquatic → Freshwater → Pond → Unclassified	0.45%
Unclassified	Host-Associated → Plants → Leaf → Unclassified → Unclassified	0.45%

Habitat

Taxonomy

Distribution

Unclassified

Environmental → Aquatic → Freshwater → Lentic → Unclassified

32.59%

Unclassified

Environmental → Aquatic → Freshwater → Lake → Unclassified

24.11%

Unclassified

Environmental → Aquatic → Marine → Coastal → Unclassified

17.41%

Sediment

Environmental → Aquatic → Freshwater → Lake → Sediment

4.91%

Unclassified

Environmental → Aquatic → Freshwater → River → Unclassified

4.02%

Unclassified

Environmental → Terrestrial → Soil → Clay → Unclassified

2.68%

Unclassified

Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified

1.79%

Unclassified

Environmental → Aquatic → Freshwater → Sediment → Unclassified

1.34%

Unclassified

Environmental → Aquatic → Freshwater → Unclassified → Unclassified

1.34%

Sediment

Environmental → Aquatic → Marine → Oceanic → Sediment

1.34%

Estuary

Environmental → Aquatic → Marine → Intertidal Zone → Estuary

1.34%

Salt Marsh

Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh

1.34%

Unclassified

Environmental → Aquatic → Marine → Unclassified → Unclassified

1.34%

Unclassified

Environmental → Terrestrial → Soil → Sand → Unclassified

1.34%

Unclassified

Environmental → Aquatic → Freshwater → Ice → Unclassified

0.89%

Epilimnion

Environmental → Aquatic → Freshwater → Lentic → Epilimnion

0.45%

Sediment

Environmental → Aquatic → Freshwater → Lentic → Sediment

0.45%

Unclassified

Environmental → Aquatic → Freshwater → Lotic → Unclassified

0.45%

Unclassified

Environmental → Aquatic → Freshwater → Pond → Unclassified

0.45%

Unclassified

Host-Associated → Plants → Leaf → Unclassified → Unclassified

0.45%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	29.46%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	14.73%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	12.95%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	6.25%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	4.02%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	3.57%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	2.68%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	2.68%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	2.68%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	2.68%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	2.23%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.34%
Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment	1.34%
Deep Subsurface	Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface	1.34%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.34%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	1.34%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	1.34%
Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Sand	1.34%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.34%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.89%
Surface Ice	Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice	0.89%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	0.45%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.45%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.45%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.45%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.45%
Meromictic Pond	Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond	0.45%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.45%
Estuary	Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary	0.45%

Habitat

Taxonomy

Distribution

Freshwater Lake

Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake

29.46%

Aqueous

Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous

14.73%

Freshwater

Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater

12.95%

Freshwater Lake

Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake

6.25%

Freshwater

Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater

4.02%

Sediment

Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment

3.57%

Freshwater Lentic

Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic

2.68%

Freshwater

Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater

2.68%

Freshwater To Marine Saline Gradient

Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient

2.68%

Soil

Environmental → Terrestrial → Soil → Clay → Unclassified → Soil

2.68%

Freshwater Lake

Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake

2.23%

Freshwater Sediment

Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment

1.34%

Lake Sediment

Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment

1.34%

Deep Subsurface

Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface

1.34%

Estuarine

Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine

1.34%

Salt Marsh

Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh

1.34%

Estuarine Water

Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water

1.34%

Sand

Environmental → Terrestrial → Soil → Sand → Unclassified → Sand

1.34%

Deep Subsurface

Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface

1.34%

Freshwater

Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater

0.89%

Surface Ice

Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice

0.89%

Freshwater

Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater

0.45%

Freshwater

Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater

0.45%

Freshwater Lake Sediment

Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment

0.45%

Freshwater

Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater

0.45%

Freshwater

Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater

0.45%

Meromictic Pond

Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond

0.45%

Deep Subsurface Sediment

Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment

0.45%

Estuary

Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary

0.45%

Visualization

Powered by ApexCharts

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300003277	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD	Environmental	Open in IMG/M
3300003404	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005940	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14	Environmental	Open in IMG/M
3300005943	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14	Environmental	Open in IMG/M
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental	Open in IMG/M
3300006641	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300006803	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300006863	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA	Environmental	Open in IMG/M
3300006870	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA	Environmental	Open in IMG/M
3300006917	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA	Environmental	Open in IMG/M
3300006920	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12	Environmental	Open in IMG/M
3300007346	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31	Environmental	Open in IMG/M
3300007363	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA	Environmental	Open in IMG/M
3300007542	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG	Environmental	Open in IMG/M
3300007708	Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02	Environmental	Open in IMG/M
3300007960	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG	Environmental	Open in IMG/M
3300008055	Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393	Host-Associated	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300009039	Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009181	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental	Open in IMG/M
3300009529	Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG	Environmental	Open in IMG/M
3300009564	Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; RNA IDBA-UD	Environmental	Open in IMG/M
3300010299	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA	Environmental	Open in IMG/M
3300010316	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA	Environmental	Open in IMG/M
3300010368	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011009	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA	Environmental	Open in IMG/M
3300011995	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m	Environmental	Open in IMG/M
3300012013	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice	Environmental	Open in IMG/M
3300012017	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m	Environmental	Open in IMG/M
3300012663	Freshwater microbial communities from Indian River, Ontario, Canada - S50	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013010	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA	Environmental	Open in IMG/M
3300013092	Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m	Environmental	Open in IMG/M
3300013122 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m	Environmental	Open in IMG/M
3300013131 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m	Environmental	Open in IMG/M
3300013132 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m	Environmental	Open in IMG/M
3300013137 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300014720 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m	Environmental	Open in IMG/M
3300015050	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017701	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017707	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N	Environmental	Open in IMG/M
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017747	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300018416	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)	Environmental	Open in IMG/M
3300018420	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020162	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300020179	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m	Environmental	Open in IMG/M
3300020221	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m	Environmental	Open in IMG/M
3300020494	Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022072	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022925	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG	Environmental	Open in IMG/M
3300024262	Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)	Environmental	Open in IMG/M
3300024348	0.2um to 3um size fraction coassembly	Environmental	Open in IMG/M
3300025075	Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025585	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025635	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025645	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)	Environmental	Open in IMG/M
3300025646	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)	Environmental	Open in IMG/M
3300025647	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)	Environmental	Open in IMG/M
3300025655	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)	Environmental	Open in IMG/M
3300025759	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)	Environmental	Open in IMG/M
3300025771	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025843	Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes)	Environmental	Open in IMG/M
3300027114	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)	Environmental	Open in IMG/M
3300027127	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h	Environmental	Open in IMG/M
3300027128	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d	Environmental	Open in IMG/M
3300027131	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h	Environmental	Open in IMG/M
3300027133	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h	Environmental	Open in IMG/M
3300027134	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h	Environmental	Open in IMG/M
3300027137	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d	Environmental	Open in IMG/M
3300027141	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h	Environmental	Open in IMG/M
3300027508	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h	Environmental	Open in IMG/M
3300027518	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes)	Environmental	Open in IMG/M
3300027578	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h	Environmental	Open in IMG/M
3300027586	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)	Environmental	Open in IMG/M
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental	Open in IMG/M
3300027679	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)	Environmental	Open in IMG/M
3300027688	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)	Environmental	Open in IMG/M
3300027697	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027764	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027770	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027785	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027804	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027808	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)	Environmental	Open in IMG/M
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300031539	Soil microbial communities from Risofladan, Vaasa, Finland - UN-3	Environmental	Open in IMG/M
3300031565	Soil microbial communities from Risofladan, Vaasa, Finland - UN-2	Environmental	Open in IMG/M
3300031566	Soil microbial communities from Risofladan, Vaasa, Finland - UN-1	Environmental	Open in IMG/M
3300031673	Soil microbial communities from Risofladan, Vaasa, Finland - TR-3	Environmental	Open in IMG/M
3300031746	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031885	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36	Environmental	Open in IMG/M
3300031952	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40	Environmental	Open in IMG/M
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental	Open in IMG/M
3300032046	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300033233	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom	Environmental	Open in IMG/M
3300033816	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005	Environmental	Open in IMG/M
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034063	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053	Environmental	Open in IMG/M
3300034064	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054	Environmental	Open in IMG/M
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental	Open in IMG/M
3300034092	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069	Environmental	Open in IMG/M
3300034093	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072	Environmental	Open in IMG/M
3300034095	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034111	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186	Environmental	Open in IMG/M
3300034112	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191	Environmental	Open in IMG/M
3300034279	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163	Environmental	Open in IMG/M
3300034356	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152	Environmental	Open in IMG/M

Taxon OID

Sample Name

Habitat Type

IMG/M Link

3300002408

Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)

Environmental

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Geographical Distribution

Zoom:	Powered by OpenStreetMap