NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F019023

Metagenome / Metatranscriptome Family F019023

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019023
Family Type Metagenome / Metatranscriptome
Number of Sequences 232
Average Sequence Length 121 residues
Representative Sequence MKTGYVHPYHTEANPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET
Number of Associated Samples 203
Number of Associated Scaffolds 232

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 32.83 %
% of genes near scaffold ends (potentially truncated) 51.72 %
% of genes from short scaffolds (< 2000 bps) 84.48 %
Associated GOLD sequencing projects 189
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (84.914 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(11.638 % of family members)
Environment Ontology (ENVO) Unclassified
(31.034 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(49.569 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 49.32%    β-sheet: 1.37%    Coil/Unstructured: 49.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 232 Family Scaffolds
PF00289Biotin_carb_N 0.86
PF02786CPSase_L_D2 0.43
PF00225Kinesin 0.43
PF00297Ribosomal_L3 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 232 Family Scaffolds
COG0087Ribosomal protein L3Translation, ribosomal structure and biogenesis [J] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.34 %
UnclassifiedrootN/A14.66 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352003|2199735358All Organisms → cellular organisms → Eukaryota1179Open in IMG/M
2199352003|2199747281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea963Open in IMG/M
3300002161|JGI24766J26685_10136862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila515Open in IMG/M
3300003430|JGI25921J50272_10111305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea578Open in IMG/M
3300003802|Ga0007840_1010203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300003802|Ga0007840_1015157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea506Open in IMG/M
3300003824|Ga0007874_1010445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea786Open in IMG/M
3300003910|JGI26437J51864_10015395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1661Open in IMG/M
3300004112|Ga0065166_10424875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea557Open in IMG/M
3300004128|Ga0066180_10124262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum965Open in IMG/M
3300004240|Ga0007787_10411178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea674Open in IMG/M
3300004463|Ga0063356_100422632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1725Open in IMG/M
3300004686|Ga0065173_1022220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1161Open in IMG/M
3300004764|Ga0007754_1395407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1015Open in IMG/M
3300004769|Ga0007748_11681125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea641Open in IMG/M
3300004789|Ga0007752_10893076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea643Open in IMG/M
3300004789|Ga0007752_11084538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300004790|Ga0007758_11128852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea647Open in IMG/M
3300004795|Ga0007756_11253698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea610Open in IMG/M
3300004795|Ga0007756_11528659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1209Open in IMG/M
3300004802|Ga0007801_10179623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea599Open in IMG/M
3300004836|Ga0007759_10523378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300005516|Ga0066831_10029602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1485Open in IMG/M
3300005580|Ga0049083_10091775All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1055Open in IMG/M
3300005662|Ga0078894_11007781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea716Open in IMG/M
3300005758|Ga0078117_1119399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1254Open in IMG/M
3300005805|Ga0079957_1185108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1020Open in IMG/M
3300005982|Ga0075156_10236247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea969Open in IMG/M
3300006037|Ga0075465_10039512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea980Open in IMG/M
3300006112|Ga0007857_1063053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300006164|Ga0075441_10340750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea545Open in IMG/M
3300006355|Ga0075501_1248963All Organisms → cellular organisms → Eukaryota588Open in IMG/M
3300006374|Ga0075512_1230762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea650Open in IMG/M
3300006393|Ga0075517_1322434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300006393|Ga0075517_1555516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea672Open in IMG/M
3300006397|Ga0075488_1104391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300006641|Ga0075471_10090504All Organisms → cellular organisms → Eukaryota1650Open in IMG/M
3300006641|Ga0075471_10220711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila982Open in IMG/M
3300006875|Ga0075473_10155690All Organisms → cellular organisms → Eukaryota918Open in IMG/M
3300007242|Ga0075172_1322754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea630Open in IMG/M
3300007513|Ga0105019_1132598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1314Open in IMG/M
3300007513|Ga0105019_1154854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1186Open in IMG/M
3300007551|Ga0102881_1133696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300007555|Ga0102817_1153173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila516Open in IMG/M
3300007559|Ga0102828_1023146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1361Open in IMG/M
3300007600|Ga0102920_1192114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea656Open in IMG/M
3300007661|Ga0102866_1095691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum737Open in IMG/M
3300007957|Ga0105742_1004154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1358Open in IMG/M
3300007957|Ga0105742_1042531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300007981|Ga0102904_1014045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1759Open in IMG/M
3300008108|Ga0114341_10198926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1121Open in IMG/M
3300008120|Ga0114355_1129211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1715Open in IMG/M
3300008259|Ga0114841_1243616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea595Open in IMG/M
3300008952|Ga0115651_1173506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1482Open in IMG/M
3300008958|Ga0104259_1028618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300008998|Ga0103502_10216432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea701Open in IMG/M
3300009068|Ga0114973_10624330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300009159|Ga0114978_10221465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1187Open in IMG/M
3300009187|Ga0114972_10174569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1345Open in IMG/M
3300009187|Ga0114972_10466197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea719Open in IMG/M
3300009432|Ga0115005_10030776All Organisms → cellular organisms → Eukaryota4139Open in IMG/M
3300009434|Ga0115562_1208815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea696Open in IMG/M
3300009436|Ga0115008_10570455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum813Open in IMG/M
3300009441|Ga0115007_11106769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300009469|Ga0127401_1105150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea743Open in IMG/M
3300009498|Ga0115568_10276663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum748Open in IMG/M
3300009592|Ga0115101_1032078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1125Open in IMG/M
3300009677|Ga0115104_10385177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300009677|Ga0115104_11015695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea568Open in IMG/M
3300010354|Ga0129333_11081807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum670Open in IMG/M
3300010885|Ga0133913_13001529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1125Open in IMG/M
3300010985|Ga0138326_11169094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum693Open in IMG/M
3300012418|Ga0138261_1563811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum674Open in IMG/M
3300012516|Ga0129325_1180764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1222Open in IMG/M
3300012523|Ga0129350_1010904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea608Open in IMG/M
3300012523|Ga0129350_1066810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum795Open in IMG/M
3300012725|Ga0157610_1136185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea608Open in IMG/M
3300012760|Ga0138273_1197336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea539Open in IMG/M
3300012952|Ga0163180_10886242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300012953|Ga0163179_10854976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum784Open in IMG/M
3300012953|Ga0163179_11239222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300012962|Ga0129335_1035753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea692Open in IMG/M
3300012963|Ga0129340_1129622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1365Open in IMG/M
3300013087|Ga0163212_1249087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea552Open in IMG/M
3300016751|Ga0182062_1297863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300016791|Ga0182095_1135970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300017166|Ga0186523_106059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1342Open in IMG/M
3300017710|Ga0181403_1073475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300017782|Ga0181380_1084771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1107Open in IMG/M
3300017783|Ga0181379_1149930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum832Open in IMG/M
3300017788|Ga0169931_10283441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1319Open in IMG/M
3300017951|Ga0181577_10818910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300018036|Ga0181600_10469528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300018049|Ga0181572_10582929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300018565|Ga0188826_105947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1015Open in IMG/M
3300018813|Ga0192872_1092897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea509Open in IMG/M
3300018934|Ga0193552_10044452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1115Open in IMG/M
3300018968|Ga0192894_10044803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1148Open in IMG/M
3300018989|Ga0193030_10146073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum763Open in IMG/M
3300019021|Ga0192982_10305753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300019031|Ga0193516_10050027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1383Open in IMG/M
3300019050|Ga0192966_10327930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300019085|Ga0188830_1003920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1037Open in IMG/M
3300019149|Ga0188870_10029506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1264Open in IMG/M
3300019261|Ga0182097_1434361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea503Open in IMG/M
3300020147|Ga0196976_1061314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea813Open in IMG/M
3300020157|Ga0194049_1035501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1293Open in IMG/M
3300020162|Ga0211735_11241251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea595Open in IMG/M
3300020172|Ga0211729_10326664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300020202|Ga0196964_10122480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1160Open in IMG/M
3300020204|Ga0194116_10558814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea524Open in IMG/M
3300020205|Ga0211731_11675616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1257Open in IMG/M
3300020578|Ga0194129_10300348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea900Open in IMG/M
3300021062|Ga0196974_1014298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1223Open in IMG/M
3300021067|Ga0196978_1054032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea755Open in IMG/M
3300021091|Ga0194133_10497940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea632Open in IMG/M
3300021355|Ga0206690_10666706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea575Open in IMG/M
3300021365|Ga0206123_10279131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum717Open in IMG/M
3300021376|Ga0194130_10489217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea633Open in IMG/M
3300021389|Ga0213868_10487844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300021424|Ga0194117_10359695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea675Open in IMG/M
3300021872|Ga0063132_132828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300021887|Ga0063105_1100644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea563Open in IMG/M
3300021910|Ga0063100_1033575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1244Open in IMG/M
3300021910|Ga0063100_1101460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea536Open in IMG/M
3300021922|Ga0063869_1047870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea602Open in IMG/M
3300021939|Ga0063095_1171845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea521Open in IMG/M
3300021959|Ga0222716_10377463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum831Open in IMG/M
3300021962|Ga0222713_10454782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum775Open in IMG/M
3300022752|Ga0214917_10221124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum911Open in IMG/M
3300023174|Ga0214921_10431786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea658Open in IMG/M
3300024343|Ga0244777_10122997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1676Open in IMG/M
3300024343|Ga0244777_10484543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea761Open in IMG/M
3300024346|Ga0244775_10391299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1144Open in IMG/M
3300025138|Ga0209634_1266410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea610Open in IMG/M
3300025336|Ga0208619_117887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300025382|Ga0208256_1061052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300025389|Ga0208257_1022079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum974Open in IMG/M
3300025392|Ga0208380_1021848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1050Open in IMG/M
3300025732|Ga0208784_1118558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum789Open in IMG/M
3300025809|Ga0209199_1250511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300025848|Ga0208005_1006557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea3584Open in IMG/M
3300025848|Ga0208005_1105605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea879Open in IMG/M
3300025872|Ga0208783_10327025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea604Open in IMG/M
3300025890|Ga0209631_10195678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1045Open in IMG/M
3300025896|Ga0208916_10314989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea682Open in IMG/M
3300026182|Ga0208275_1029230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1145Open in IMG/M
3300026495|Ga0247571_1047958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum959Open in IMG/M
3300026500|Ga0247592_1073642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum830Open in IMG/M
3300027192|Ga0208673_1046821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum698Open in IMG/M
3300027216|Ga0208677_1043904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300027229|Ga0208442_1054778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum683Open in IMG/M
3300027254|Ga0208177_1049553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea792Open in IMG/M
3300027259|Ga0208178_1043595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea822Open in IMG/M
3300027259|Ga0208178_1061261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea680Open in IMG/M
3300027320|Ga0208923_1098857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300027416|Ga0207994_1119431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300027621|Ga0208951_1063315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1056Open in IMG/M
3300027712|Ga0209499_1071533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1368Open in IMG/M
3300027720|Ga0209617_10070651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1439Open in IMG/M
3300027720|Ga0209617_10114790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1078Open in IMG/M
3300027770|Ga0209086_10240158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea807Open in IMG/M
3300027771|Ga0209279_10155992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea668Open in IMG/M
3300027781|Ga0209175_10075240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1445Open in IMG/M
3300027791|Ga0209830_10314962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300027797|Ga0209107_10188925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1024Open in IMG/M
3300027797|Ga0209107_10505231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea536Open in IMG/M
3300027805|Ga0209229_10093602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1352Open in IMG/M
3300027820|Ga0209578_10372024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea655Open in IMG/M
3300027885|Ga0209450_10651279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea767Open in IMG/M
3300027899|Ga0209668_10183825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1291Open in IMG/M
3300027899|Ga0209668_10222262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1185Open in IMG/M
(restricted) 3300027997|Ga0255057_10390025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum675Open in IMG/M
3300028134|Ga0256411_1095958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1011Open in IMG/M
3300028137|Ga0256412_1125797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum940Open in IMG/M
3300028233|Ga0256417_1191164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300028776|Ga0302303_10266504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea582Open in IMG/M
3300030671|Ga0307403_10538956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea632Open in IMG/M
3300030699|Ga0307398_10143075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1227Open in IMG/M
3300030702|Ga0307399_10400500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum665Open in IMG/M
3300030741|Ga0265459_10363963All Organisms → Viruses → Predicted Viral1148Open in IMG/M
3300030778|Ga0075398_11287332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea825Open in IMG/M
3300030840|Ga0074020_10035863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1160Open in IMG/M
3300031569|Ga0307489_10905852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum626Open in IMG/M
3300031594|Ga0302131_1281606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea525Open in IMG/M
3300031626|Ga0302121_10143324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300031710|Ga0307386_10109162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1227Open in IMG/M
3300031729|Ga0307391_10136918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1229Open in IMG/M
3300031735|Ga0307394_10085117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1176Open in IMG/M
3300031737|Ga0307387_10201030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1138Open in IMG/M
3300031738|Ga0307384_10488444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300031743|Ga0307382_10600492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300031784|Ga0315899_10228812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1863Open in IMG/M
3300032093|Ga0315902_10790419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea752Open in IMG/M
3300032150|Ga0314779_1007939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum949Open in IMG/M
3300032617|Ga0314683_10678315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300032754|Ga0314692_10642039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300034096|Ga0335025_0439501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea667Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.64%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.05%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake8.19%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.90%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.03%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater4.74%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.31%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.02%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.59%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.59%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent2.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.16%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.16%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil2.16%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.72%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.72%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.29%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.29%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.29%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.29%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.86%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.86%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.86%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.86%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.86%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.86%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.86%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.86%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.43%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.43%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.43%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.43%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.43%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.43%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.43%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.43%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.43%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.43%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.43%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater0.43%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.43%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.43%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.43%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.43%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.43%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.43%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.43%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.43%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.43%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352003Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300003430Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SDEnvironmentalOpen in IMG/M
3300003802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07EnvironmentalOpen in IMG/M
3300003824Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08EnvironmentalOpen in IMG/M
3300003910Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LWEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004128Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2)EnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004686Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2)EnvironmentalOpen in IMG/M
3300004764Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004790Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2MEnvironmentalOpen in IMG/M
3300004836Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005982Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNAEngineeredOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006112Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08EnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007242Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 C RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007661Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3EnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300007957Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_3.0umEnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009469Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012707Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012725Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012760Freshwater microbial communities from Lake Croche, Canada - C_130709_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300016751Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016791Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017166Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in filtered seawater, 15 C, 29.4 psu salinity and 162 ?mol photons light - Favella taraikaensis Fe Narragansett Bay (MMETSP0436)Host-AssociatedOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018565Metatranscriptome of marine microbial communities from Baltic Sea - GS669_3p0_dTEnvironmentalOpen in IMG/M
3300018813Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172)EnvironmentalOpen in IMG/M
3300018866Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 9hrs v1EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019085Metatranscriptome of marine microbial communities from Baltic Sea - GS670_3p0_dTEnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020147Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13CEnvironmentalOpen in IMG/M
3300020157Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25mEnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020202Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10EnvironmentalOpen in IMG/M
3300020204Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surfaceEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300021062Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10-13CEnvironmentalOpen in IMG/M
3300021067Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20-13CEnvironmentalOpen in IMG/M
3300021091Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40mEnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025336Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025382Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes)EnvironmentalOpen in IMG/M
3300025389Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025392Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025608Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027216Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027229Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027254Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027259Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300027416Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes)EnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027712Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027786Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027820Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027997 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028329Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028392Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030778Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030840Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031594Marine microbial communities from Western Arctic Ocean, Canada - CB9_20mEnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032150Metatranscriptome of sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB 2018 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
21998883622199352003FreshwaterMKTGYVHPYHTEANPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET
21999013042199352003FreshwaterLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET
JGI24766J26685_1013686213300002161Freshwater And SedimentEANPLVYSHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMXFHHEFLLAFYVGYIETRHFSFMLGPKFTIFYNVYTRYET*
JGI25921J50272_1011130513300003430Freshwater LakePYHTEANPLVYSHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIFHHEFLLAFYVGYIETRHFSFMLGPKFTIFYNVYTRYET*
Ga0007840_101020323300003802FreshwaterAEYGTNYYNASRLANMKIGYVHPYHTDGSPLFMSHTYYLKNLFAAVGPEQVSPHYETLSRSRRGLIFAGLYVASINTISRFGGWEHNDWLRAMIWHHEFLLAYYIGYIEIRHFTFFIGPKFSIFYNVYSGYEY*
Ga0007840_101515713300003802FreshwaterMKTGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRGMIFHHEFLLAFYLGYMETRHFTFMLGPKFTVFYNVYTRYET*
Ga0007874_101044513300003824FreshwaterMKSGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRGMIFHHEFLLAFYLGYIETRHFTFMLGPKFTVFYNVYTRYETQQLCN*
JGI26437J51864_1001539533300003910Freshwater Lake SedimentVFIRKEPVDKAQYGKAYYADKLNSMKKGYQHPYHTTAHPISFNYFYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFLYVGSITSLSRMGSWSHNEWLRGMVFHHEYILAFYLGVSEMRHFTFMIGPKFTNFYNVYTRYETQ*
Ga0065166_1042487513300004112Freshwater LakeMRQGYVHPYHSDKYPMVFSHFHYMKTLFEAVGPEQVSPHYESLSRSRRGLLFIFFYIGTINTISRFGGWSHNEWIRGMIFHHEFLIAFYLGYIEIRHFTYFVGPKFTVFYNVYSRYE
Ga0066180_1012426213300004128Freshwater LakeMKIGYVHPYHTDGSPLFMSHTYYLKNLFAAVGPEQVSPHYESLSRSRRGLIFAGLYVASINTISRFGGWEHNDWLRAMIWHHEFLLAYYIGYIEIRHFTFFIGPKFSIFYNVYSGYEY*
Ga0007787_1041117823300004240Freshwater LakeMKQGYVHPYHSDKYPLVFSHFHYMKTLFEAVGPEQVSPHYESLSRSRRGLLFIFFYIGTINTISRFGGWSHNEWIRGMIFHHEYLLAFYLGYIEIRHFTYFIGPKFSVFYNVYSRYE
Ga0063356_10042263243300004463Arabidopsis Thaliana RhizosphereMKKGYVHPYHSEKYPILFSHYHYMKTLFEGVGPEQVSPHYESLSRSRRGLLFLFFYVGTWTTVARMGGWANNEWLRAMIWHHEYLISFYLAYAEIRHFTYFLGPKFTVFYNVYSRYET*
Ga0063356_10291972013300004463Arabidopsis Thaliana RhizosphereMKTLFEAVGPEQVSPHYESLSRSRRGLLFFFFYIGTINTISRFGGWSHNEWIRGMIWHHEYLIAFYLGYIEIRHFTYFLGPKFTVFYNVYTRYETQQLCA
Ga0065173_102222033300004686FreshwaterMKIGYVHPYHTDGSPLFMSHTYYLKNLFAAVGPEQVSPHYETLSRSRRGLIFAGLYVASINTISRFGGWEHNDWLRAMIWHHEFLLAYYIGYIEIRHFTFFIGPKFSIFYNVYSGYEY*
Ga0007754_139540733300004764Freshwater LakeMKSGYVHPYHTEANPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET*
Ga0007748_1123636113300004769Freshwater LakeVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIFHHEFLLAFYVGYIETRHFSFMLGPKFTIFYNVYTRYET*
Ga0007748_1168112523300004769Freshwater LakeMVFSHFHYMKTLFEAVGPEQVSPHYESLSRSRRGLLFIFFYIGTINTISRFGGWSHNEWIRGMIFHHEFLIAFYLGYIEIRHFTYFIGPKFTVFYNVYSRYETQQLCSQWADVTEEEQLRHLRHTKEQM
Ga0007752_1089307613300004789Freshwater LakeMKTGYVHPYHTEANPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET*
Ga0007752_1108453813300004789Freshwater LakeMKIGYVHPYHTDGSPLFMSHTYYLKNLFAAVGPEQVSPHYETLSRSRRGLIFAGLYVASINTISRFGGWEHNDWLRAMIWHHEFLLAYYIGYIEIRHFTFFIGPKFSIF
Ga0007758_1112885213300004790Freshwater LakeKIANMKTGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRGMIFHHEFLLAFYLGYMETRHFTFMLGPKFTVFYNVYTRYET*
Ga0007756_1125369823300004795Freshwater LakeMVFSHFHYMKTLFEAVGPEQVSPHYDSLSRSRRGLLFIFFYIGTINTISRFGGWSHNEWIRGMIFHHEFLIAFYLGYIEIRHFTYFIGPKFTVFYNVYSRYETQQLCSQWADVTEEEQLR
Ga0007756_1152865913300004795Freshwater LakeMKSGYVHPYHTEANPLVYSHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIFHHEFLLAFYVGYIETRHFSFMLGPKFTIFYNVYTRYET*
Ga0007801_1009096413300004802FreshwaterMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRGMIWHHEFLIAFYIGYIETRHFTWLPGPKFTVFYNVYTRYET*
Ga0007801_1017962313300004802FreshwaterMKTLFEAVGPEQVSPHYESLSRSRRGLLFFFFYIGTINTISRFGGWSHNEWIRGMIWHHEYLIAFYLGYIEIRHFTYFLGPKFTVFYNVYNRYETQQLCAQWPDVTEEEQLRH
Ga0007759_1052337813300004836Freshwater LakeMKVGYVHPYHTEGSPIYMSHTYYLKSLFSAVGPEQVSPHYETLSRSRRGLIFAGLYIASINTISRFGGWENNDWLRAMIWHHEFLLAYYIGYIEIRHFTFFIGPKFSVFYNVYSGYEYQQLCNQWADTVELQ*
Ga0071100_108703713300005043Marine Subseafloor AquiferFQAVGPEQVSPHYETLSRSRRGILFMAAYVGSITTISRFGGWEHNDWLRAMIWHHEYLIALYVGFIEIRHFTYFLGPKFNTFYNTYTKYEF*
Ga0066831_1002960233300005516MarineMKTGYVHPYHSEGSPVYMSTMYYMKNLFKAAGPEQVSPHYETLSRSRRGLIFLMLYVGSINTISRFGGWEHNDWLRAMLWHHEFLIAYYVGFIEIRHFSFWFGPKFSVFYNTYSNYEYS*
Ga0049083_1009177543300005580Freshwater LenticRIANMKSGYVHPYHTEANPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET*
Ga0078894_1057235613300005662Freshwater LakeMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRGMIFHHEFLLAFYLGYMETRHFTFMLGPKFTVFYNVYTRYET*
Ga0078894_1100778113300005662Freshwater LakeMKTLFEAVGPEQVSPHYESLSRSRRGLLFIFAYIGTINTISRFGGWSHNEWIRGMIFHHEFLIAFYLGYIEIRHFTYFIGPKFTVFYNVYSRYETQQLASTWADVTEEEQLRHLRHTKEQME
Ga0078117_111939923300005758Lake WaterMSFNRVEPKNKEAYGKSYYQERIANMKTGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET*
Ga0079957_118510823300005805LakeSFNYFYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFLYVGSITSLSRMGSWSHNEWLRGMVFHHEYILAFYLGVSEMRHFTFMIGPKFTNFYNVYTRYETQ*
Ga0075156_1023624713300005982Wastewater EffluentYPLIYSKYHYLKTLFEAVGPEQVSPHYESLSRSRRGLLFLFFYIGTINTVSRFGGWSHNEWIRAMIWHHEYLIAFYLGYLETRHFTYFLGPKFTTFYNVYTRYETQ*
Ga0075158_1013222013300005987Wastewater EffluentMKTLFEAVGPEQVSPHYESLSRSRRGLLFIFLYIGTINTVSRLGGWSHNEWIRGLIWHHEYLIAFYLGYIEIRHFTYFLGPKFTTFYNVYSRYETQQLCQ*
Ga0075158_1033656123300005987Wastewater EffluentMKTLFEAVGPEQVSPHYESLSRSRRGVIFMMLYIGSIVSISKLGGWSHNEWLRGMIWHHEYLIAFYVGYAETKHFSYFMGPKFNVFYNTYSRYEIKQCMLGWADVTEEV*
Ga0075465_1003951213300006037AqueousLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET*
Ga0007857_106305313300006112FreshwaterMKIGYVHPYHTDGSPLFMSHTYYLKNLFAAVGPEQVSPHYETLSRSRRGLIFAGLYVASINTISRFGGWEHNDWLRAMIWHHEFLLAYYIGYIEIRHFTFFIGPKFSIFYN
Ga0075441_1034075023300006164MarineMKEGYKHPYHTAEHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFLYVGSITSLSRMGGWSHNEWLRGMVFHHEYIIAFYLGVSEMRHFTFLIGPKFTNFYNVYSRYE
Ga0075501_124896313300006355AqueousKGKQVQKHEVKNKTLYGKGYYEDKLASMKQGYKHPYHSAEHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFMFLYIGSITSLSRMGSWSHNEWLRGMVFHHEFIIAWYLGMSELRHFTFLVGPKFTNFYNVYTRYETQ*
Ga0075512_123076213300006374AqueousMKKGYQHPYHTDENPLVFKYNDYMKYLYQAVGPEQVSPHYETLSRSRRGLIFLFVYIGSITSLSRMGGWSHNEWIRGMVFHHEFILCFYLAMIETRHFTSIIGPRFTNWYNTYTKYEIAQIMSTWNDVVEEAQQWHLVPAKQQMEYM*
Ga0075517_132243423300006393AqueousMKVGYVHPYHSDGSPIYLSNAYYMKQLFQAVGPEQVSPHYESLSRSRRGLLFMFLYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAFYVGFIETRHFSFFLGPKFSVFYNVYSKYEFQQLANQWADSVEL*
Ga0075517_155551613300006393AqueousMKKGYQHPYHTDENPLVFKYNDYMKYLYQAVGPEQVSPHYETLSRSRRGLIFLFVYIGSITSLSRMGGWSHNEWIRGMVFHHEFILCFYLAMIETRHFTSIIGPRFTNWYNTYTKYEIAQIMSTWNDVVEEAQQWHLVPAKQQMEYM
Ga0075488_110439113300006397AqueousMKVGYVHPYHTEASPIYMSNMYYLKNLFQAVGPEQVSPHYESFSRSRRGLLFAGLYVASINTISRFGGWEHNDWLRAMIWHHEFLLVYYIGYTEIKFFTAWPGPKFSAFYNTYSAYEYAQLSNQWADAVETVQNQSLKHTK
Ga0075471_1009050423300006641AqueousVKNKTLYGKGYYEDKLASMKQGYKHPYHSAEHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFMFLYIGSITSLSRMGSWSHNEWLRGMVFHHEFIIAWYLGMSELRHFTFLVGPKFTNFYNVYTRYETQ*
Ga0075471_1022071133300006641AqueousYLSGTYYMQSVFAAVGPEQVSPHYESLSRSRRGLIFSGLYISSIMTISRLGGWDHNSWLRAMLFHHEFLLALYLSNAEMRHFTFVLGPKFSIFYNSYSRYEYKQLMLMWADSAELLQNTHLR*
Ga0075473_1015569023300006875AqueousVKNKTLYGKGYYGDKLASMKQGYKHPYHSAEHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFMFLYIGSITSLSRMGSWSHNEWLRGMVFHHEFIIAWYLGMSELRHFTFLVGPKFTNFYNVYTRYETQ*
Ga0075172_132275423300007242Wastewater EffluentMRKGYEHPYHSAEQPLNLTYFHYLKTLHEAVGPEQVSAHYETLSRSRRGLIFIAFYIGMITSISRMGGWTHNEWLRAMLWHHEYMICLYLGYIETRHFTFFLGPKWTLWYGVYTNYEQQQLANQWADNTEELQLKHTRHSKDQLELTRLNQEYDFVKK
Ga0105019_113259813300007513MarineMYYLKNLFVATGPEQVSPHYETLSRSRRGLIWFALYIGSINSISRFGGWEHNEWLRGMIFHHEFLVAYYVGFIEIRHFTFMIGPKFSVFYNTFTNYEYAQLANQWADNCEMLQNQHLRHTKE*
Ga0105019_115485433300007513MarineMESMKTGFVHPYHSDGSPLYMSNMYFMKTLFHAVGPEQVSPHYESLSRSRRGLIFMFAYIGSINTISRFGGWEHNDWLRAMIWHHEFLIALYVGWIEIRHFTFMLGPKFSVFYNTYSNYEYTQMANMWADCAEMQ*
Ga0102881_113369613300007551EstuarineMKTGYVHPYHTDGSPIYMSNMYYMKNLFQAVGPEQVSPHYETLTRSRRGLIFFALYIGSINTISRFGGWEHNDWLRAMIWHHEFLIALYLGYIEIRHFTYFVGPKFSVFYNVYSGYEYTQLANMWADCAEMAQNQH
Ga0102817_115317313300007555EstuarineTTDSRPPTSLAELTSTRSRRRGKSAPLHRSETDCRPEAENKEQYGKSYYQDKLRMIKSGYVHPYHTESNPLVYTHYNYMKTLFEAVGAEQVSPHYESLSRSRRGVIFMFAYISVINSISRLGGWSHNEWIRGMIFHHEFLITFYLGYIETRHFVFMPGPKFSIFYNTYARY
Ga0102828_102314623300007559EstuarineMKTGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET*
Ga0102920_119211423300007600EstuarineMKQGYVHPYHSDKYPLVFSHFHYMKTLFEAVGPEQVSPHYESLSRSRRGLLFIFFYIGTINTISRFGGWSHNEWIRGMIFHHEYLLAFYLGYIEIRHFTYFIGPKFSVFYNVYSRYET
Ga0102866_109569113300007661EstuarineMKTGYVHPYHTDGSPIYMSNMYYMKNLFQAVGPEQVSPHYETLTRSRRGLIFFALYIGSINTISRFGGWEHNDWLRAMIWHHEFLIALYLGYIEIRHFTYFVGPKFSVFYNVYSGYEYTQLANMWADCAEMAQNQHLRHTKEQLEY
Ga0105740_107805323300007955Estuary WaterMYYMRNLFAAVGPEQVSPHYESLSRSRRGLIFFFLYIGSITTISRMGGWEHNAWLRAMIWHHEYLISLYLGYMELRHFTYLVGPKFTIFYNVYS
Ga0105742_100415433300007957Estuary WaterMNMKEGYKHPYHTSEHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFLYIGSITSLSRLGSWSHNEWLRGMVFHHEYIIAFYLGVSEMRHFTFLIGPKFTNFYNVYSRYETQQLVS*
Ga0105742_104253123300007957Estuary WaterMKSMKVGYVHPYHTEGSPVFFSSQYFLKNLFAAVGPEQVSPHYETLTRSRRGLIFFALYIGSINTVSRFGGWEHNDWLRAMIWHHEFLIAFYIGLIEIRHFTYFVGPKFSVFYNVYSDYEYSQLCNQWADTVEMVQNQHLRHT
Ga0102904_101404533300007981EstuarineMKEGYKHPYHTSEHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFLYIGSITSLSRLGSWSHNEWLRGMVFHHEYIIAFYLGVSEMRHFTFLIGPKFTNFYNVYSRYETQQLVS*
Ga0108970_1034026013300008055EstuaryMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRGMIWHHEFLLAFYLGYMETRHFTFMLGPKFTVFYNVYTRYETQ*
Ga0114341_1019892633300008108Freshwater, PlanktonMKVGYVHPYHTDGSPLFMSHTYYLKNLFAAVGPEQVSPHYETLSRSRRGLIFAGLYVASINTISRFGGWEHNDWLRAMIWHHEFLLAYYIGYIEIRHFTFFIGPKFSIFYNVYSGYEY*
Ga0114346_129090723300008113Freshwater, PlanktonYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRGMIFHHEFLLAFYLGYMETRHFTFMLGPKFTVFYNVYTRYET*
Ga0114355_112921133300008120Freshwater, PlanktonMTHYSYMKTLFEAVGPEQVSPHYESLSRSRRGVLFMFGYIGAIVSISRLGGWSHNEWIRGMVFHHEFLITFYLGYIETRHFVFMPGPKFTIFYNTYARYETQQLNSQWADMVE
Ga0114841_124361613300008259Freshwater, PlanktonMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGTITSISRLGGWSHNEWIRGMIFHHEFLLAFYLGYIETRHFTWLPGPKFTVFYNVYSRYETQQLCSQWADVVEEQQMTHLRFTKEQ
Ga0115651_117350633300008952MarineMKVGYVHPYHSEGSPIYMSTMYYLKNLFVATGPEQVSPHYETLSRSRRGLIWFALYIGSINSISRFGGWEHNEWLRGMIFHHEFLVAYYVGFIEIRHFTFMIGPKFSVFYNTFTNYEYAQLANQWADNCEMLQNQHLRHTKE*
Ga0104259_102861823300008958Ocean WaterMATMKVGYMHPYHCEGSPILMSNMYFMKNLMHAVGPEQVSPHYETLSRSRRGILFFGLYIMSINTVSRMGGWEHNEWLRGMIWHHEFLIALYIGHIEIRHFTYFLGPKFTAFYNVYTNYE
Ga0103502_1021643213300008998MarineDRRSSARLCWQGRAELSQEKSYHTKANPIFFSHYHYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFLYIGSITSLSRMGGWANNEWIRGMIWHHEFLMCWFIGYMEIRHFTFMFGPKFTNFYNTYTLYETKQLASQWADTCEESQMQHL*
Ga0114973_1062433013300009068Freshwater LakeMKVGYVHPYHTEGSPIYMSHTYYLKSLLSAVGPEQVSPHYETLSRSRRGLIFAGLYIASINTISRFGGWENNDWLRAMIWHHEFLLAYYIGYIEIRHFTFFIGPKFSVFYNVYSGYEYKQLCN*
Ga0114978_1022146533300009159Freshwater LakeMKTGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYETQ*
Ga0114972_1017456933300009187Freshwater LakeLALLTQAIRQEPKNKEAYGKSYYQDKIANMKTGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRGMIFHHEFLLAFYLGYMETRHFTFMLGPKFTVFYNVYTRYET*
Ga0114972_1046619723300009187Freshwater LakeMKTLFEAVGPEQVSPHYESLSRSRRGLLFIFFYIGTINTISRFGGWSHNEWIRGMIFHHEYLLAFYLGYIEIRHFTYFIGPKFSVFYNVYSRYETQQLCSMWADVTEEE
Ga0114972_1083417713300009187Freshwater LakeVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRGMIWHHEFLIAFYIGYIETRHFTWLPGPKFTVFYNVYTRYET*
Ga0115005_1003077673300009432MarineMEAGYVHPYHTEGSPIYMSNLYFMRTLFQAVGPEQVSPHYETLTRSRRGLLFMGAYIGSINTISRFGGWEHNEWLRALIWHHEFLIALYVGYIEVKHFSAVPGPKFSIFYNTYSGYEYTQLA
Ga0115562_120881523300009434Pelagic MarineMYYQDKINSMGKGYVHPYHTQQNPLVYSHYNYMRTLFEAVGPEQVSPHYETLSRSRRGLLFMFAYIGTITSISRLGAWSHNEWLRGMIFHHEFLLAWYIGYIESRHFTFLLGPKFTIFYNVY
Ga0115562_123070813300009434Pelagic MarineMANMKVGYVHPYHCDGSPIYMSNMYYLKTLFTAVGPEQVSPHYETLTRSRRGLLFFGAYIASINTIARFGGWEHNDWLRAMIWHHEFLFAYYLG
Ga0115008_1057045523300009436MarineLIVKRIYEYSQEPEDKATYGTNYYNKDRMAAMKVGYVHPYHCDGSPIYMSNMYYLKNLFKAVGPEQVSPHYETLSRSRRGLIFFGAYIASINTIARFGGWEHNDWLRAMIWHHEFLFAYYLGYIEVRHFTYFIGPKFSVFYNVYS*
Ga0115007_1110676913300009441MarineKAYYADKLNNMNEGFKHPYHSAEHPISFGYYYYMKTLMEAVGPEQVSPHYESLSRSRRGILFLFLYIGSITSLSRMGGWSHNEWIRGMIFHHEYILAFYLGIAEIRHFTFVIGPKFTNFYNVYSRYET*
Ga0127401_110515013300009469Meromictic PondMGQSGYKHPYHTEQNPLFFSHYGYLKSLFEAVGPEQVSPHYESLSRSRRGVIFIFGYIGSILTVSRLGGWSHNEWIRGMIFHHEFLIAFYLGLCETRHFMYLPGPKFTIFYNVFTRYECQQVAHMWAEPHRYRRQW*
Ga0115568_1027666333300009498Pelagic MarineMANMKVGYVHPYHCDGSPLYMSNMYYLKTLFKAVGPEQVSPHYETLTRSRRGLIAFGLYIASINTISRFGGWEHNDWLRAMIWHHEFLFAYYLGYIEVRHFTYFIGPKFSVFYNVYSNYE
Ga0115101_103207823300009592MarineMKVGYVHPYHTEGSPIYMSSMYYMKNLFRAVGPEQVSPHYEALTRSRRGLIFFALYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAYYVGLIELRHYTMVVGPKFSVFYNTYTDYEYKQLANMWADSAEMTQNIAL*
Ga0115104_1038517723300009677MarineMKVGYVHPYHSDGSPIYLSNAYYMKQLFQAVGPEQVSPHYESLSRSRRGLLFMFLYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAFYVGFIETRHFSFFLGPKFSVFYNVFSKYEFQQLANQWADNVELQQNAHLRHT
Ga0115104_1101569513300009677MarineETNPLIFGQMEYMKLLYDAVGPEQVSPHYESLSKSRRGLIFLFAYIGSITSLSRLGGWSHNEWIRGMVFHHEYILCFYLALIETRHFTFVVGPKFTNWYNAYTNYEIAQMLSSWNDVVEEVQ*
Ga0129333_1108180713300010354Freshwater To Marine Saline GradientMKTGYVHPYHTDGSPIYMSNMYYMKNLFQAVGPEQVSPHYETLTRSRRGLIFFALYIGSINTISRFGGWEHNDWLRAMIWHHEFLIALYLGYIEIRHFTYFVGPKFSVFYNVYSGYEYTQLANM
Ga0133913_1300152933300010885Freshwater LakeMKIGYVHPYHTDGSPLFMSHTYYLKNLFAAVGPEQVSPHYETLSRSRRGLIFAGLYVASINTISRFGGWEHNDWLRAMIWHHEFLLAYYIGYIEIRHYTFFIGPKFSIFYNVYSGYEY*
Ga0138326_1116909413300010985MarineMKVGYVHPYHCDGSPIFFSNSYFMKNLFQAVGPEQVSPHYETLTRSRRGIILFGLYIASINTVSRFGGWEHNDWLRAMIWHHEFLIAYYIGIIEIRHFTFFPGPKFTHFYNVYSNYEYNQLCQ*
Ga0138261_156381123300012418Polar MarineYMSNMYYLKTLFTAVGPEQVSPHYETLTRSRRGLLFFGAYIASINSIARFGGWEHNDWLRAMIWHHEFLFAYYLGYIEVRHFTYFIGPKFSVFYNVYS*
Ga0129334_106917813300012471AqueousEQVSPHYETLSRSRRGVLFMGAYIGSIVLISRFGGWEHNNMLRGMIWHHEFLIALYLGNIELRHFTYLVGPKFSVFYNVYSRYEYQQFT*
Ga0129325_118076423300012516AqueousMYYMKTLFQAVGPEQVSPHYETLSRSRRGLIMSGAYIGSIATISRMGGWEHNDWLRAMIWHHEMLFGLYIGFIETKHFTFFVGPKFSIFYNTYSNYEYQQLSNQWADTVEML*
Ga0129350_101090413300012523AqueousMRQGYVHPYHSQQNPLVFTHYNYMRTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGTITSLSRMGSWSHNEWLRGLVFHHEFLMCWYIGYAETRHFTFLLGPKFTVFYNVYSRYETQQMCNQWADIAEEVQASWLIH
Ga0129350_106681023300012523AqueousMKVGYVHPYHTEGSPLFFSNLYYMKNLFTAVGPEQVSPHYETLSRSRRGIIFFGLYIASINTVSRMGGWEHNDWLRAMIWHHEFLIAYYVGQMEIRHFTMFLGPKFTIFYNTYSNYEY*
Ga0157623_120600113300012707FreshwaterGPEQVSPHYESLSRSRRGLLFIFFYIGTINTISRFGGWSHNEWIRGMIFHHEYLLAFYLGYIEIRHFTNFIGPKFSVFYNVYSRYETQQLC*
Ga0157610_113618523300012725FreshwaterMVFSHFHYMKTLFEAVGPEQVSPHYESLSRSRRGLLFIFFYIGTINTISRFGGWSHNEWIRGMIFHHEFLIAFYLGYIEIRHFTYFVGPKFTVFYNVYSRYETQQLCSQWA
Ga0138273_119733613300012760Freshwater LakeMKTGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRGMIFHHEFLLAFYLGYMETRHFTFMLGPKFTVFYNVYTRYE
Ga0163180_1088624223300012952SeawaterMKVGYVHPYHSDGSPIYLSNAYYMRQLFQAVGPEQVSPHYESLSRSRRGLLFMFLYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAFYVGFIETRHFSFFFGPKFSVFYNTYSNYEFQ*
Ga0163179_1085497613300012953SeawaterMKVGYVHPYHSEGSPIYMSTMYYLKNLFVGVGPEQVSPHYETLSRSRRGLIWFALYIGSINSISRFGGWEHNEWLRGMIFHHEFLIAYYVGVIEIRHFTFLIGPKFSVFYNTFTNYEYAQ
Ga0163179_1123922213300012953SeawaterMKVGYVHPYHSDGSPIYLSNAYYMRQLFQAVGPEQVSPHYESLSRSRRGLLFMFLYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAFYVGFIETRH
Ga0129335_103575323300012962AqueousVGYVHPYHTEGSPIYMSTPYLMNLLFSAAGPEQVSPHYETLSRSRRGVLFMGAYIGSIVLISRFGGWEHNNMLRGMIWHHEFLIALYLGNIELRHFTYLVGPKFSVFYNVYSRYEYQQFT
Ga0129340_112962213300012963AqueousMLTGYDYMRTLFEAVGPEQVSPHYESLSKSRRGIIFFFLYIASIRSLSMMGGWSNNEWLRGMIYHHEFIIAFYLSSMETRHFTYMVGPKFTTWYEVYTRYETQQLALQWADACEEVQH*
Ga0129337_142557213300012968AqueousSPHYETLSRSRRGVLFMGAYIGSIVLISRFGGWEHNNMLRGMIWHHEFLIALYLGNIELRHFTYLVGPKFSVFYNVYSRYEYQQFT*
Ga0163212_124908713300013087FreshwaterMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSIASISRLGGWSHNEWIRNMIMHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYETQQLCLQWADVVEEQQ
Ga0182062_129786313300016751Salt MarshMKVGYVHPYHSTGSPIYMSNMYYMKTLFQAVGPEQVSPHYETLSRSRRGLLFTGAYIGSIVTISRMGGWEHNDWLRAMVWHHEMLFGLYIGFIETRHFSFFVGPK
Ga0182095_113597023300016791Salt MarshMSNMYYMKTLFQAVGPEQVSPHYETLSRSRRGLLFTGAYIGSIVTISRMGGWEHNDWLRAMVWHHEMLFGLYIGFIETRHFSFFVGPKFSVFYNVYSNYEYQQLSNQWADNVEMIQNQHL
Ga0186523_10605933300017166Host-AssociatedMKEGYKHPYHSAEHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFMFLYIGSITSLSRMGSWSHNEWLRAMVFHHEYIIAFYVGMSELRHFTFLVGPKFTNFYNVYTRYETQQLVSQWADHTEEAQM
Ga0181403_107347523300017710SeawaterMAAMKVGYVHPYHCDGSPIYMSNMYYLKNLFKAVGPEQVSPHYETLSRSRRGLIFFGAYIASINTIARFGGWEHNDWLRAMIWHHEFLFAYYLGYIEVRHFTYFIGPKFSVFYNV
Ga0181380_108477123300017782SeawaterVKTYGKGYYTDKLKGMKSGYVHPYHTETNPLIFGQMEYMKLLYDAVGPEQVSPHYESLSKSRRGLIFLFAYIGSITSLSRLGGWSHNEWIRGMVFHHEYILCFYLALIETRHFTFVVGPKFTNWYNAYTNYEIAQMLSSWNDVVEEVQ
Ga0181379_114993013300017783SeawaterMKVGYVHPYHSDGSPIYLSNAYFMKQLFQAVGPEQVSPHYESLSRSRRGLLFMFLYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAFYVGFIETRHFSFFLGPKFSVFYNVYSKYEFQQLANQWADQVEL
Ga0169931_1028344133300017788FreshwaterMKTGYVHPYHTEANPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYMETRHFTWLIGPKFTIFYNVYTRYET
Ga0181577_1081891013300017951Salt MarshMKEYGTAYYNEARTANMKVGYVHPYHTDGSPIYMSNMYYLKNLFQAVGPEQVSPHYESFSRSRRGLLFAGLYVASINTISRFGGWEHNDWLRAMIWHHEFLLLYYIGYTEIKFFTAWP
Ga0181600_1046952813300018036Salt MarshMFRPDVENKAEYGEAYYSKSRLDNMKVGYVHPYHCDGSPIYMSNLYYLKNLFKAVGPEQVSPHYETLSRSRRGLIFFGAYIASINTISRFGGWEHNDWLRAMIWHHEFLFAYYLGYIEVRHFTYFIGPKFS
Ga0181572_1058292913300018049Salt MarshMKVGYVHPYHCDGSPIYMSNMYYLKNLFKAVGPEQVSPHYETLSRSRRGLIFFGAYIASINTIARFGGWEHNDWLRAMIWHHEFLFAYYLGYIEVRHFTYFIGPKFSVFY
Ga0188826_10594713300018565Freshwater LakeRIANMKTGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET
Ga0192872_109289713300018813MarineMREGYKHPYHSADAPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFLYIGSITSLSRMGSWSHNEWIRGLVFHHEFILGFYLGVSEIRHFTFVIGPKFTNFYNVYSRYETQQLTNQWADTVEECQTQW
Ga0193613_106951923300018866SoilMKTLFEAVGPEQVSPHYESLSRSRRGLLFVFFYIGTINTISRLGGWSHNEWIRGMLWHHEYLIAFYLGYAEIRHFTYFLGPKFTVFYNVYSRYETQ
Ga0193552_1004445213300018934MarineKREPEDKKRYGQSYYQDKLRSMKQGYSHPYHTTTNPLIFTNLEYMKLLYKAVGPEQVSPHYETLSRSRRGLIFLFLYIGSITSLSRLGGWSHNEWIRGMVFHHEFILCFYLALIETRHFTMVVGPKFTNWYNAYTKYELAQMFSTWNDIIEEQ
Ga0192894_1004480333300018968MarineMGKGYVHPYHTQSNPLVFTHYNYMRTLFEAVGPEQVSPHYESLSRSRRGLIFMFAYVGSIVSITRLGGWSHNEWLRGMIFHHEFLITWYIGFIESRHFTLLLGPKFTIFYNVYSRYEIQQLCNQWADRVEEVQA
Ga0193030_1014607313300018989MarineMKVGYVHPYHCEGSPIYMSTMYYLKNLFVATGPEQVSPHYETLSRSRRGLIWFALYIGSINSISRFGGWEHNEWLRGMIFHHEFLVAYYVGFIEIRHFTFMVGPKFSVFYNTFTNYEYAQLANQWADNCEMLQNQHLRHTKE
Ga0193569_1041774613300019017MarineQVSPHYESLSRSRRGLIFLFLYIGSITSLSRLGGWANNEWIRGMIWHHEFLMCWFIGYMEIRHFTFMFGPKFTNFYNTYTLYETKQLASQWADTCEESQMQHL
Ga0192982_1030575323300019021MarineMEAGYVHPYHTEGSPIYMSNLYFMRTLFQAVGPEQVSPHYETLTRSRRGLLFLGAYIGSINTISRFGGWEHNEWLRALIWHHEFLIALYVGYIEVKHFSAIPGPKFSIFYNTYSGYE
Ga0193516_1005002723300019031MarineMKVGYVHPYHCEGSPIYMSTMYYLKNLFVAAGPEQVSPHYETLSRSRRGLIWFALYIGSINSIARFGGWEHNEWLRGMIFHHEFLVAYYVGFIEIRHFTFMIGPKFSVFYNTFTNYEYAQLANSWGDSVEML
Ga0192966_1032793013300019050MarineMEAGYVHPYHCEGSPIYMSNLYFMRTLFQAVGPEQVSPHYETLTRSRRGLLFLGAYIGSINTISRFGGWEHNEWLRALIWHHEFLIALYVGYIEVKHFSAIPGPKFSIFYNTYSGYEYTQLANQW
Ga0188830_100392013300019085Freshwater LakeGKSYYQERIANMKTGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET
Ga0188870_1002950623300019149Freshwater LakeMKVGYVHPYHSDGSPIYLSNAYYMKQLFQAVGPEQVSPHYESLSRSRRGLLFMFLYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAFYVGFIETRHFSFFLGPKFSVFYNVYSKYEFQQLANQWADSVEL
Ga0188870_1005787323300019149Freshwater LakeRTLFQAVGPEQVSPHYETLTRSRRGLLFLFAYIGSINTISRMGGWEHNEWLRALVWHHEFLIALYVGYIEVKHFTAIPGPKFSIFYNTYS
Ga0182097_143436113300019261Salt MarshMLTGYDYMRTLFEAVGPEQVSPHYESLSKSRRGIIFFFLYIASIRSLTMMGGWSNNEWLRGMIYHHEFIIAFYLSSMETRHFTYMVGPKFTTWYEVYTRYETQQLALQWADACEEVQH
Ga0196976_106014013300020147SoilMKTLFEAVGPEQVSPHYETLSRSRRGLLFIFFYIGTINTISRFGGWSHNEWLRAMIWHHEYLIAFYLGYAEIRHFTYFLGPKFTVFYNVYSRYETQ
Ga0196976_106131423300020147SoilMKQGYVHPYHSDKYPIMFSHFHYMKTLFEAVGPEQVSPHYESLSRSRRGLLFIFFYIGSINTISRLGGWSHNEWIRGMIWHHEYLICFYLGYAEIRHFTYFLGPKFTVFYNVYSRYETQQLAGMWADFSEEEQAKHLIHT
Ga0194049_103550123300020157Anoxic Zone FreshwaterMKTGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET
Ga0211735_1124125123300020162FreshwaterIANMKTGYVHPYHTEANPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYE
Ga0211729_1032666413300020172FreshwaterMKVGYVHPYHTDGSPLFMSHTYYLKNLFAAVGPEQVSPHYETLSRSRRGLIFAGLYVASINTISRFGGWEHNDWLRAMIWHHEFLLAYYIGYIEIRH
Ga0196964_1012248013300020202SoilHLKNMRKGYVHPYHSDKYPLMFSHFHYMKTLFEAVGPEQVSPHYESLSRSRRGVIWFFLYVATINSISRFGGWSHNEWLRGMIWHHEFLICFYLGYIEIRHFTYFLGPKFTVFYNVYTRYETQQLCSMWADVSEEEQMIHLRHTKE
Ga0194116_1055881413300020204Freshwater LakeMRQGYVHPYHSDKYPLVFSHFHYMKTLFEAVGPEQVSPHYESLSRSRRGLLFIFFYIGTINSISRFGGWSHNEWIRGMIFHHEYLLAFYLGYIEIRHFTYFIGPKFSVFYNVYSRY
Ga0211731_1167561613300020205FreshwaterMKVGYVHPYHTEGSPIYMSHTYYLKSLFSAVGPEQVSPHYETLSRSRRGLIFAGLYIASINTISRFGGWENNDWLRAMIWHHEFLLAYYIGYIEIRHFTFFIGPKFSVFYNVYSGYEYQQLCNQWADTVELQ
Ga0194129_1030034823300020578Freshwater LakeVCEVCRPQPQNKEVYGKGYYSDKIAQMKSGYVHPYHTETNPLVYSHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIFHHEFLLAFYLGYIEIRHFTFMLGPKFTVFYNVYTRYETQQLCS
Ga0196974_101429823300021062SoilMRKGYVHPYHSDKYPLMFSHFHYMKTLFEAVGPEQVSPHYESLSRSRRGVIWFFLYVATINSISRFGGWSHNEWLRGMIWHHEFLICFYLGYIEIRHFTYFLGPKFTVFYNVYTRYETQQLCSMWADVSEEE
Ga0196978_105403213300021067SoilMKNMKQGYVHPYHTDKYPITFSHFHYMKTLFEAVGPEQVSPHYETLSRSRRGLLFIFFYIGTINTISRFGGWSHNEWLRAMIWHHEYLIAFYLGYAEIRHFTYFLGPKFTVFYNVYSRYETQ
Ga0194133_1049794023300021091Freshwater LakeVYGKGYYSDKIAQMKSGYVHPYHTETNPLVYSHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIFHHEFLLAFYLGYIEIRHFTFMLGPKF
Ga0206692_182631633300021350SeawaterMKTLFEAVGEEHVSPHYESFARSRRGLIALFAYIGTITSVSKLGGWSHNEWIRGMIFHHEFMIGFYLGWAEIRHFHWLPGPKFSVFYDVYSNYEM
Ga0206690_1066670613300021355SeawaterQANIMNMRQGYQHPYHTERHPLVFSHMHHLKTLFEAVGPEQVSPHYESLSRSRRGLLFLFFYIGTINSVSRMGGWSHNEWIRALIFHHEYLLALYIGYIEIRHHTFILGPKFSVFYNVFSRYEFQQLAVGWAD
Ga0206689_1016218613300021359SeawaterRTLFEAVGPEQVSPHYESLSRSRRGLIFVFAYIGAMTSMSRMGGWSHNEWIRGLVFHHEFLLCWYIGYAETRHFTFLLGPKFTVFYNVYSRYETQQMCN
Ga0206123_1027913113300021365SeawaterMANMKVGYVHPYHCDGSPIYMSNMYYLKTLFTAVGPEQVSPHYETLTRSRRGLLFFGAYIASINTIARFGGWEHNDWLRAMIWHHEFLFAYYLGYIEVRHFTYFIGPKFSVFYNVY
Ga0194130_1048921713300021376Freshwater LakeMKSGYVHPYHTETNPLVYSHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIFHHEFLLAFYLGYIEIRHFSFMLGPKFT
Ga0213868_1048784413300021389SeawaterMFRPDVENKAEYGEAYYSKSRLDNMKVGYVHPYHCDGSPIYMSNLYYLKNLFKAVGPEQVSPHYETLSRSRRGLIFFGAYIASINTISRFGGWEHNDWLRAMIWHHEFLFAYYLGYIEVRHFTYFIG
Ga0194117_1035969513300021424Freshwater LakeMKSGYVHPYHTETNPLVYSHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIFHHEFLLAFYLGYIEIRHFSFMLGPKFTVFYNVYTRYETQQLCSQWADVVEEH
Ga0063132_13282813300021872MarineLAKYPPKKPEIENKAEYGQAYHHADKLKSMKVGYVHPYHTDGSPIFFSHQYFLKNLFSAVGPEQVSPHYETLTRSRRGLIFFALYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAFYVGLIEIRHFTYFVGPKFSVFYNVYTDYEYSQLCNQWAD
Ga0063105_110064423300021887MarineMRTGYVHPYHTERNPLVFSHFHYMKTLFEAVGPEQVSPHYESLSRSRRGILFLMGYIGSITTMTQMGGWSNNEWLRGLIMHHEYLLAFYLGFMETRHFSFMLGPKFTLFYNVYSRYETVQLFQQWADTIEESQ
Ga0063100_103357513300021910MarineMQEGYQHPYHSAEHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFMFFYIGSITSLSRMGSWSHNEWLRAMVFHHEYIIAFYLGVSELRHFTFLVGPKFTNFYNVYTRYETQQLVSQWADHTEEA
Ga0063100_110146013300021910MarineMRTGYVHPYHTERNPLVFSHFHYMKTLFEAVGPEQVSPHYESLSRSRRGILFLMGYIGSITTMTQMGGWSNNEWLRGLIMHHEYLLAFYLGFMETRHFSFMLGPKFTLFYNVYSRYETVQLFQQWADTIEESQMHFLRHSKE
Ga0063869_104787013300021922MarineMKEGYKHPYHTSAHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFFYIGSITSLSRMGSWSHNEWLRGMVFHHEYIIAFYLGVSEMRHFTFLVGPKFTNFYNVYTRYETQQLVSQWADTVEEAQMQWLVPSKE
Ga0063095_117184523300021939MarineMKEGYKHPYHTSAHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFFYIGSITSLSRMGSWSHNEWLRGMVFHHEYIIAFYLGVSEMRHFTFLVGPKFTNFYNVYTRYETQ
Ga0222716_1037746323300021959Estuarine WaterSPIYLSNAYYMKQLFQAVGPEQVSPHYESLSRSRRGLLFMFLYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAFYVGFIETRHFSFFLGPKFSVFYNVYSKYEFQQLANQWADSVEL
Ga0222713_1045478223300021962Estuarine WaterVLCSPEAQNKVEYGSAYYNPQRFNNMKVGYVHPYHTEGSPIYMSTPYLMNLLFSAAGPEQVSPHYETLSRSRRGVLFMGAYIGSIVLISRFGGWEHNNMLRGMIWHHEFLIALYLGNIELRHFTYLVGPKFSVFYNVYSRYEYQQFT
Ga0214917_1022112423300022752FreshwaterMKVGYVHPYHTEGSPIYMSHTYYLKSLLSAVGPEQVSPHYETLSRSRRGLIFAGLYIASINTISRFGGWENNDWLRAMIWHHEFLLAYYIGYIEIRHFTFFIGPKFSVFYNVYSGYEYKQLCN
Ga0214921_1043178613300023174FreshwaterMKTGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRGMIFHHEFLLAFYLGYMETRHFTFMLGPKFTVFYNVYTRYET
Ga0244777_1012299723300024343EstuarineMNMKEGYKHPYHTSEHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFLYIGSITSLSRLGSWSHNEWLRGMVFHHEYIIAFYLGVSEMRHFTFLIGPKFTNFYNVYSRYETQQLVS
Ga0244777_1048454313300024343EstuarineMAGRTEPNDKKQYGKGYYADKLSKMGEGYKHPYHTTQHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFLYVGSITSLSRMGSWSHNEWLRGMVFHHEYIIALYIGMAEVRHFTFMVGPKFTNFYNVYTRYETSQLVSQWADTVEEAQMQHLTAS
Ga0244775_1039129913300024346EstuarineCPLTSKLFNSVEPKNKEAYGKSYYQERIANMKTGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET
Ga0209634_126641023300025138MarineMYGKAYYADKLKMANQGYVHPYHTEQNPLIFSYYGFMKTLYEAVGPEQVSPHYESLSRSRRGVIMMFAYISTICSISRLGGWSHNEWIRGMIFHHEFLIAFYLGYIEVRHFTW
Ga0208619_11788713300025336FreshwaterMKIGYVHPYHTDGSPLFMSHTYYLKNLFAAVGPEQVSPHYETLSRSRRGLIFAGLYVASINTISRFGGWEHNDWLRAMIWHHEFLLAYYIGYIEIRHFTFFIGPKFSIFYNVYSGYEY
Ga0208256_106105213300025382FreshwaterVHPYHTDGSPLFMSHTYYLKNLFAAVGPEQVSPHYETLSRSRRGLIFAGLYVASINTISRFGGWEHNDWLRAMIWHHEFLLAYYIGYIEIRHFTFFIGPKFSIFYNVYSGYEY
Ga0208257_102207913300025389FreshwaterAEYGTNYHNASRLANMKIGYVHPYHTDGSPLFMSHTYYLKNLFAAVGPEQVSPHYETLSRSRRGLIFAGLYVASINTISRFGGWEHNDWLRAMIWHHEFLLAYYIGYIEIRHFTFFIGPKFSIFYNVYSGYEY
Ga0208380_102184833300025392FreshwaterYHNASRLANMKIGYVHPYHTDGSPLFMSHTYYLKNLFAAVGPEQVSPHYETLSRSRRGLIFAGLYVASINTISRFGGWEHNDWLRAMIWHHEFLLAYYIGYIEIRHFTFFIGPKFSIFYNVYSGYEY
Ga0209654_112689813300025608MarineMFRPDVENKAEYGEAYYSKSRLDNMKVGYVHPYHCDGSPIYMSNLYYLKNLFKAVGPEQVSPHYETLSRSRRGLIFFGAYIASINTISRFGGWEHNDWLRAMIWHHEFLFAYYLGYIEVR
Ga0208784_111855813300025732AqueousVCSPEPQNKTEYGAEYHNEKRMANMKVGYVHPYHSEGSPIYLSGTYYMQSVFAAVGPEQVSPHYESLSRSRRGLIFSGLYISSIMTISRLGGWDHNSWLRAMLFHHEFLLALYLSNAEMRHFTFVLGPKFSIFYNSYSRYEYKQLMLMWADSAELLQNTHLR
Ga0209199_125051113300025809Pelagic MarineMENMKVGYVHPYHCDGSPLYMSNMYYLKTLFTAVGPEQVSPHYETLTRSRRGLLFFGAYIASINTIARFGGWEHNDWLRAMIWHHEFLFAYYLGYIEVRHFTYFIGP
Ga0208005_100655793300025848AqueousVKNKTLYGKGYYEDKLASMKQGYKHPYHSAEHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFMFLYIGSITSLSRMGSWSHNEWLRGMVFHHEFIIAWYLGMSELRHFTFLVGPKFTNFYNVYTRYETQ
Ga0208005_110560523300025848AqueousVFIRKEPVDKAQYGKAYYADKLNSMKKGYQHPYHTTAHPISFNYFYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFLYVGSITSLSRMGSWSHNEWLRGMVFHHEYILAFYLGVSEMRHFTFMIGPKFTNFYNVYTRYETQ
Ga0208783_1032702523300025872AqueousIYLSGTYYMQSVFAAVGPEQVSPHYESLSRSRRGLIFSGLYISSIMTISRLGGWDHNSWLRAMLFHHEFLLALYLSNAEMRHFTFVLGPKFSIFYNSYSRYEYKQLMLMWADSAELLQNTHLR
Ga0209631_1019567833300025890Pelagic MarineEGSPLYMSNLYFMRTLFQAVGPEQVSPHYETLTRSRRGLLFLFAYIGSINTISRMGGWEHNEWLRALVWHHEFLIALYVGYIEVKHFTAIPGPKFSIFYNTYS
Ga0208916_1031498923300025896AqueousANPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET
Ga0208275_102923013300026182MarineSEYYNKDRLSKMKTGYVHPYHSEGSPVYMSTMYYMKNLFKAAGPEQVSPHYETLSRSRRGLIFLMLYVGSINTISRFGGWEHNDWLRAMLWHHEFLIAYYVGFIEIRHFSFWFGPKFSVFYNTYSNYEYS
Ga0247571_104795813300026495SeawaterRLANMKVGYVHPYHSDGSPIYLSNAYFMKQLFQAVGPEQVSPHYESLSRSRRGLLFMFLYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAFYVGFIETRHFSFFLGPKFSVFYNVYSKYEFQQLANQWADQVEL
Ga0247592_107364223300026500SeawaterMKVGYVHPYHSDGSPIYLSNAYYMRQLFQAVGPEQVSPHYESLSRSRRGLLFMFLYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAFYVGFIETRHFSFMVGPKFSVFYNVYSNYEF
Ga0208673_104682113300027192EstuarineMKTGYVHPYHTDGSPIYMSNMYYMKNLFQAVGPEQVSPHYETLTRSRRGLIFFALYIGSINTISRFGGWEHNDWLRAMIWHHEFLIALYLGYIEIRHFTYFVGPKFSVFYNVYSGYEYTQLANMWADCAEMAQ
Ga0208677_104390413300027216EstuarineMKTGYVHPYHTDGSPIYMSNMYYMKNLFQAVGPEQVSPHYETLTRSRRGLIFFALYIGSINTISRFGGWEHNDWLRAMIWHHEFLIALYLGYIEIRHFT
Ga0208442_105477813300027229EstuarineMKTGYVHPYHTDGSPIYMSNMYYMKNLFQAVGPEQVSPHYETLTRSRRGLIFFALYIGSINTISRFGGWEHNDWLRAMIWHHEFLIALYLGYIEIRHFTYFVGPKFSVFYNVYSGYEYTQLANMWADC
Ga0208177_104955313300027254EstuarineMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGTITSISRLGGWSHNEWIRGMIFHHEFLLAFYLGYIETRHFTWLPGPKFTVFYNVYSRYETQQLCSQWADVVEEQQMT
Ga0208178_104359513300027259EstuarineMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGTITSISRLGGWSHNEWIRGMIFHHEFLLAFYLGYIETRHFTWLPGPKFTVFYNVYSRYETQQLCSQWADVVEEQQMTHLRFTKEQLE
Ga0208178_106126123300027259EstuarineMKQGYVHPYHSDKYPLVFSHFHYMKTLFEAVGPEQVSPHYESLSRSRRGLLFIFFYIGTINTISRFGGWSHNEWIRGMIFHHEYLLAFYLGYIEIRHFTYFIGPKFSVFYNVYSRYETQ
Ga0208923_109885723300027320EstuarineMSYLSFQINREEPKNKAEYGTNYYNPSRLANMKTGYVHPYHTTGAPIYMTTMYFMKNLMAATGPEQVSPHYESLSRSRRGLIFFGAYIGSIATISRMGGWEHNNWLRALVCHHEFLIAMYMGYIEFRHFTYLIGPK
Ga0207994_111943113300027416EstuarineMKTGYVHPYHTDGSPIYMSNMYYMKNLFQAVGPEQVSPHYETLTRSRRGLIFFALYIGSINTISRFGGWEHNDWLRAMIWHHEFLIALYLGYIEIR
Ga0208951_106331513300027621Freshwater LenticERIANMKSGYVHPYHTEANPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET
Ga0209499_107153323300027712Freshwater LakeMKTGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYETQ
Ga0209617_1007065133300027720Freshwater And SedimentMKTGYVHPYHTEANPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYVGTITSISRLGGWSHNEWIRGMLFHHEFLLAFYLGYIETRHFTWLPGPKFTVFYNVYSRYET
Ga0209617_1011479013300027720Freshwater And SedimentYYQDKLKQLKTGYVHPYHTSENPLVMTHYSYMKTLFEAVGPEQVSPHYESLSRSRRGVLFMFGYIGAIVSISRLGGWSHNEWIRGMVFHHEFLITFYLGYIETRHFVFMPGPKFTIFYNTYARYETQQLNAQWADMVEQQ
Ga0209086_1024015823300027770Freshwater LakeAEYGQGYYQEHLKNMKQGYVHPYHSDKYPLVFSHFHYMKTLFEAVGPEQVSPHYESLSRSRRGLLFIFFYIGTINTISRFGGWSHNEWIRGMIFHHEYLIAFYLGYIEIRHFTYFIGPKFTVFYNVYTRYETQ
Ga0209279_1015599213300027771MarineMKEGYKHPYHTAEHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFLYVGSITSLSRMGGWSHNEWLRGMVFHHEYIIAFYLGVSEMRHFTFLIGPKFTNFYNVYSRYETQQLVSQWADHTEEAQ
Ga0209175_1007524033300027781Wastewater EffluentMKQGYVHPYHSERHSLIYSQYHYLKTLFEAVGPEQVSPHYESLSRSRRGLLFLFFYIGTINTVSRFGGWSHNEWIRAMIWHHEYLIAFYLGYLETRHFTYFLGPKFTTFYNVYTRYETQ
Ga0209812_1009222633300027786Wastewater EffluentMKTLFEAVGPEQVSPHYESLSRSRRGLLFIFLYIGTINTVSRLGGWSHNEWIRGLIWHHEYLIAFYLGYIEIRHFTYFLGPKFTTFYNVYSRYETQQLCQ
Ga0209830_1031496233300027791MarineLLNLIFISPEIKNKAEYEQAYYNKTRMANMKVGYMHPYHCEGSPILMSNLYFIKNLMHAVGPEQVSPHYETLSRSRRGILFFGLYIMSINTVSRMGGWEHNDWLRGMIWHHEFLIALYIGHIEIRHFTYFLGPK
Ga0209107_1018892523300027797Freshwater And SedimentTEANPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET
Ga0209107_1050523113300027797Freshwater And SedimentEPKNKEAYGKSYYQERIANMKTGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYET
Ga0209229_1009360223300027805Freshwater And SedimentMKSGYVHPYHTEANPLVYSHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIFHHEFLLAFYVGYIETRHFSFMLGPKFTIFYNVYTRYET
Ga0209578_1037202423300027820Marine SedimentMRKGYAHPYHSAEQPLNLTYFHYLKTLHEAVGPEQVSPHYETLSRSRRGVIFIALYVGMIASISRMGGWTHNEWLRAMLWHHEYMICLYLGYIETRHFTFFLGPKWTLWYGVYTNYEQQQLANQWA
Ga0209450_1065127913300027885Freshwater Lake SedimentMKQGYVHPYHTESNPLVYTHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIWHHEFLLAFYLGYIETRHFTWLIGPKFTIFYNVYTRYETQ
Ga0209624_1053017913300027895Forest SoilMKTLFEAVGPEQVSPHYETLSRSRRGILFIFFYIGSINTISRFGGWSHNEWIRGMIWHHEFLIAFYLGYAEIRHFTYFLGPKFSVFYNVYTRYETQ
Ga0209668_1018382543300027899Freshwater Lake SedimentMKIGYVHPYHTDGSPLFMSHTYYLKNLFAAVGPEQVSPHYETLSRSRRGLIFAGLYVASINTISRFGGWEHNDWLRAMIWHHEFLLAYYIGYIEIRHYTFFIGPKFSIFYNVYSGYEY
Ga0209668_1022226213300027899Freshwater Lake SedimentDKAQYGKAYYADKLNSMKKGYQHPYHTTAHPISFNYFYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFLYVGSITSLSRMGSWSHNEWLRGMVFHHEYILAFYLGVSEMRHFTFMIGPKFTNFYNVYTRYETQ
(restricted) Ga0255057_1039002513300027997SeawaterMFRPDVVNKAEYGDAYYNKSRLDNMKVGYVHPYHCDGSPIYMSNLYYLKNLFKAVGPEQVSPHYETLSRSRRGLIFFGAYIASINTISRFGGWEHNDWLRAMIWHHEFLFAYYLGYIEVRHFTYFIGPKFS
Ga0256411_109595823300028134SeawaterMKVGYVHPYHTEGSPLFFSNLYYMKNLFTAVGPEQVSPHYETLSRSRRGIIFFGLYIASINTVSRMGGWEHNDWLRAMIWHHEFLIAYYVGQMEIRHFTMFLGPKFTIFYNTYSNYEY
Ga0256412_112579713300028137SeawaterMYYLKNLHVAVGPEQVSPHYETLSRSRRGLILFGFYIASINTISRFGGWEHNDWLRAMIWHHEFLIAYYVGLVEIRHFTFFIGPKFSTFYNVYSAYEYSQLCEQWADEVE
Ga0256417_119116423300028233SeawaterMKVGYVHPYHTEGSPLFFSNLYYMKNLFTAVGPEQVSPHYETLSRSRRGIIFFGLYIASINTVSKMGGWEHNDWLRAMIWHHEFLIAYYVGQMEIRHF
Ga0256413_113896133300028282SeawaterQVSPHYESLSRSRRGLLFMFLYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAFYVGFIETRHFSFFLGPKFSVFYNVYSKYEFQQLANQWADQVEL
Ga0256413_128153013300028282SeawaterLSNAYYMRQLFQAVGPEQVSPHYESLSRSRRGLLFMFLYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAFYVGFIETRHFSFMVGPKFSVFYNVYSNYEF
Ga0210315_104472113300028329EstuarineMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYVGTITSISRLGGWSHNEWIRGMLFHHEFLLAFYLGYIETRHFTWLPGPKFTVFYNVYSRYET
Ga0304729_114443913300028392Freshwater LakeMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRGMIWHHEFLIAFYIGYIETRHFTWLPGPKFTVFYNVYTRYET
Ga0304731_1142419823300028575MarineMKVGYVHPYHCDGSPIFFSNSYFMKNLFQAVGPEQVSPHYETLTRSRRGIILFGLYIASINTVSRFGGWEHNDWLRAMIWHHEFLIAYYIGIIE
Ga0302303_1026650423300028776PalsaVNKVEYGEGYYQKNIKNMKTGYVHPYHSSKYPIYFSHLYYMKTLFEAVGPEQVSPHYESLTRSRKGLLFIFLYIGTINSISRFGGWSHNEWLRGMIFHHEFLIAFYLGYSEIRHFTYFLGPKFSIFYNVYTRYETKQLCLMWSDTVE
Ga0307403_1053895613300030671MarineMHMKEGYKHPYHTTEHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFFYVGSITSLSRMGGWSHNEWLRGMVFHHEYIIAFYLGVSEMRHFTFLIGPKFTNFYNVYSRYETQQLVSQWADTVEEGQQQWLIPAKE
Ga0307398_1014307533300030699MarineMKEGYKHPYHTAEHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFLYVGSITSLSRMGGWSHNEWLRGMVFHHEYIIAFYLGVSEMRHFTFLIGPKFTNFYNVYSRYETQQLVSQWADHTEEAQQ
Ga0307399_1040050013300030702MarineMKVGYVHPYHCEGSPIYMSTMYYLKNLFVGVGPEQVSPHYETLSRSRRGLIWFALYIGSINSIARFGGWEHNDWLRGMIFHHEFLIAYYVGFIEIRHFTFMIGPKFSVFYNTFTNYEYAQLANSWGDGVEMI
Ga0265459_1036396313300030741SoilMKSGYVHPYHSEKYPLYMSNMYYMKTLFEAVGPEQVSPHYETLSRSRRGVIFIALYIGSIATISRLGGWSNNECSRGLIFHHEYMIAFYVGYAETKHFSYFLGPKFSIFYNVYSRYETK
Ga0075398_1128733213300030778SoilVNKAEYSKGYYQTHLRQMKQGYVHPYHSDKYPIMFSHFHYMKTLFEAVGPEQVSPHYETLSRSRRGVLFIMLYIGTITSISRFGGWSHNEWLRGMIWHHEYLICFYLGYIEIRHFTYFLGPKFTVFYNVYSRYET
Ga0074020_1003586333300030840SoilMKQGYVHPYHSEKYPILFSHFHYMKTLFEAVGPEQVSPHYESHSRSRRGVLFFFFYIGTINSISRFGGWSNNEWLRAMIWHHEFLICYYLGYIEIRHFTYFLGPKFTTFYNVYTRYET
Ga0170824_12793373923300031231Forest SoilMKTLFEATGPEQVSPHYETLSKSRRGVIFFFVYFGTILTVARMGGWDNNDWLRGLVFHHQYLIALYLGYIEVRHFTYFLGPKFTVFYNVYSRYECM
Ga0307489_1090585223300031569Sackhole BrineGYIHPYHTEGAPIFMSNMYFMKTLFSAVGPEQVSPHYETLSRSRRGILFIGLYIGSIVSISRMGGWEHNTWLRAMIWHHEYLLALYLGYIELRHFTYLIGPKFTVFYNVYSNYEFAQLAN
Ga0302131_128160613300031594MarineMYYQDKINSMGKGYVHPYHTQQNPLVYSHYNYMRTLFEAVGPEQVSPHYETLSRSRRGLLFMFAYIGTITSISRLGAWSHNEWLRGMIFHHEFLLAWYIGYIESRHFTFLLGPKFTIFYNVYSRYETQQL
Ga0302121_1014332413300031626MarineMQEGYQHPYHSAEHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFMFFYIGSITSLSRMGSWSHNEWLRAMVFHHEYIIAFYLGVSELRHFTFLVGPKFTN
Ga0307386_1010916213300031710MarineMKVGYVHPYHSEGSPIYMSQLYFFKTLFQAVGPEQVSPHYESLSRSRRGIIFFAIYIGTINTISRFGGWDNNDWMRGMIFHHEFLICLYLSYIELKHFTYFFGPKFTVFYNTYSEYEF
Ga0307391_1013691823300031729MarineMEKMEAGYVHPYHTEGSPIYMSKLYFMRTLFQAVGPEQVSPHYETLTRSRRGLLFLGAYIGSINTISRFGGWEHNEWLRALIWHHEFLIALYVGYIEVKHFTAIPGPKFSIFYKTYSGYEYTQLANQWADSVEMS
Ga0307397_1021331223300031734MarineMKTLFQAVGPEQVSPHYETLTRSRRGLLFMGAYIGSINTISRFGGWEHNEWLRALIWHHEFLIALYVGYIEVKHFTFLPGPKFSIFYNTYSGYEYTQLAN
Ga0307394_1008511723300031735MarineMEAGYVHPYHTEGSPIYMSNLYFMKTLFQAVGPEQVSPHYETLTRSRRGLLFMGAYIGSINTISRFGGWEHNEWLRALIWHHEFLIALYVGYIEVKHFTFLPGPKFSIFYNTYSGYEYTQLAN
Ga0307387_1020103033300031737MarineMKVGYVHPYHSDGSPIYLSNAYYMKQLFQAVGPEQVSPHYESLSRSRRGLLFMFLYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAFYVGFIETRHFSFFLGPKFSVFYNVYSKYEFQQLANQWADQVEL
Ga0307384_1048844423300031738MarineMKVGYVHPYHSDGSPIYLSNAYFMKQLFQAVGPEQVSPHYESLSRSRRGLLFMFLYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAFYVGFVETRHFSFFLGPKFSVFYNVYSKYEF
Ga0307382_1060049223300031743MarineMKVGYVHPYHSDGSPIYLSNAYYMKQLFQAVGPEQVSPHYESLSRSRRGLLFMFLYIGSINTISRFGGWEHNDWLRAMIWHHEFLIAFYVGFIETRHFSFFFGPKFSVFYNTYTNYE
Ga0315899_1022881223300031784FreshwaterMKTLFEAVGPEQVSPHYESLSRSRRGLLFIFFYIGTINTISRFGGWSHNEWIRGMIFHHEFLIAFYLGYIEIRHFTYFVGPKFTVFYNVYSRYETQQLCSQWADVTEEEQL
Ga0315902_1079041913300032093FreshwaterMTHYSYMKTLFEAVGPEQVSPHYESLSRSRRGVLFMFGYIGAIVSISRLGGWSHNEWIRGMVFHHEFLITFYLGYIETRHFVFMPGPKFTIFYNTYARYETQQLNSQWADMVEQQQMGHLVHTKQ
Ga0314779_100793923300032150SedimentMANMKAGYIHPYHTEGAPIFMSNMYFMKTLFSAVGPEQVSPHYETLSRSRRGILFIGLYIGSIVSISRMGGWEHNTWLRAMIWHHEYLLALYLGYIELRHFTYLIGPKFTVFYNVYSNYEFAQLAN
Ga0314682_1057457923300032540SeawaterLFAAVGPEQVSPHYETLTRSRRGLIFFALYIGSINTVSRFGGWEHNDWLRAMIWHHEFLIAFYVGFIETRHFSFFLGPKFSVFYNVYSKYEFQQLANQWADSVEL
Ga0314683_1067831523300032617SeawaterMKVGYVHPYHTDGSPIYMSSMYYMKNLFRAVGPEQVSPHYESLTRSRRGLIFFGLYIGSINSISRFGGWEHNDWLRAMIWHHEFLIAYYIGLIELRHYTMVVGPKFSVFYNTYTDYEYKQLANMWADSCEM
Ga0314686_1052336923300032714SeawaterMYFLKNIMHAVGPEQVSPHYETLSRSRRGILFFGLYIMSINSVSRMGGWEHNDWLRGMIWHHEFLIALYIGHIEIRHFTYFLGPKFTTFYNTYSNYEYKQL
Ga0314712_1051680523300032747SeawaterMHAVGPEQVSPHYETLSRSRRGILFFGLYIMSINSVSRMGGWEHNDWLRGMIWHHEFLIALYIGHIEIRHFTYFLGPKFTTFY
Ga0314692_1064203913300032754SeawaterMSKFKAKVPDIKNKAEYEKAYYNKERMATMKVGYVHPYHTEGSPIFMSNMYFMKNLFQAVGPEQVSPHYETLSRSRRGVLLFGLYIASINTISRFGGWEHNDWLRAMIWHHEFLIALYIGHLEIRHFTYFLGPKFT
Ga0335025_0439501_2_4213300034096FreshwaterVCRPQPQNKEAYGKGYYSDKIAQMKSGYVHPYHTETNPLVYSHYNYMKTLFEAVGPEQVSPHYESLSRSRRGLIFLFAYIGSITSISRLGGWSHNEWIRNMIFHHEFLLAFYLGYIEIRHFTFMLGPKFTVFYNVYTRYE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.