Basic Information | |
---|---|
Family ID | F018569 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 234 |
Average Sequence Length | 39 residues |
Representative Sequence | MTILDEIAASIRQLAEGAGASVVGIGQRWGAGSGIVLGE |
Number of Associated Samples | 176 |
Number of Associated Scaffolds | 234 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.15 % |
% of genes near scaffold ends (potentially truncated) | 98.29 % |
% of genes from short scaffolds (< 2000 bps) | 91.03 % |
Associated GOLD sequencing projects | 171 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.726 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.598 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.880 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (42.735 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.85% β-sheet: 19.40% Coil/Unstructured: 50.75% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 234 Family Scaffolds |
---|---|---|
PF01638 | HxlR | 68.38 |
PF07992 | Pyr_redox_2 | 2.14 |
PF14759 | Reductase_C | 1.28 |
PF00903 | Glyoxalase | 0.85 |
PF11611 | DUF4352 | 0.85 |
PF00067 | p450 | 0.85 |
PF00248 | Aldo_ket_red | 0.85 |
PF12900 | Pyridox_ox_2 | 0.85 |
PF00296 | Bac_luciferase | 0.85 |
PF01266 | DAO | 0.85 |
PF13365 | Trypsin_2 | 0.85 |
PF13191 | AAA_16 | 0.43 |
PF13561 | adh_short_C2 | 0.43 |
PF00196 | GerE | 0.43 |
PF06325 | PrmA | 0.43 |
PF02852 | Pyr_redox_dim | 0.43 |
PF13376 | OmdA | 0.43 |
PF12680 | SnoaL_2 | 0.43 |
PF13556 | HTH_30 | 0.43 |
PF00440 | TetR_N | 0.43 |
PF13594 | Obsolete Pfam Family | 0.43 |
PF00005 | ABC_tran | 0.43 |
PF05694 | SBP56 | 0.43 |
PF00990 | GGDEF | 0.43 |
PF07479 | NAD_Gly3P_dh_C | 0.43 |
PF12681 | Glyoxalase_2 | 0.43 |
PF01625 | PMSR | 0.43 |
PF02738 | MoCoBD_1 | 0.43 |
PF08240 | ADH_N | 0.43 |
PF13676 | TIR_2 | 0.43 |
PF00171 | Aldedh | 0.43 |
PF03109 | ABC1 | 0.43 |
PF04185 | Phosphoesterase | 0.43 |
PF00723 | Glyco_hydro_15 | 0.43 |
PF13538 | UvrD_C_2 | 0.43 |
PF07366 | SnoaL | 0.43 |
PF01039 | Carboxyl_trans | 0.43 |
PF00561 | Abhydrolase_1 | 0.43 |
COG ID | Name | Functional Category | % Frequency in 234 Family Scaffolds |
---|---|---|---|
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 68.38 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.85 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.85 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.43 |
COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.43 |
COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.43 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.43 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.43 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.43 |
COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.43 |
COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.43 |
COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.43 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.43 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.43 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.73 % |
Unclassified | root | N/A | 4.27 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig113880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 520 | Open in IMG/M |
2228664022|INPgaii200_c1169293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 666 | Open in IMG/M |
3300000903|JGI11872J12872_102179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 622 | Open in IMG/M |
3300001405|JGI20186J14852_1008294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 595 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101637605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 542 | Open in IMG/M |
3300002917|JGI25616J43925_10198887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 775 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10252670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 716 | Open in IMG/M |
3300005332|Ga0066388_101274454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1264 | Open in IMG/M |
3300005355|Ga0070671_101121975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 691 | Open in IMG/M |
3300005435|Ga0070714_100255243 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
3300005436|Ga0070713_101005396 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300005548|Ga0070665_100080654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3260 | Open in IMG/M |
3300005553|Ga0066695_10733721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 576 | Open in IMG/M |
3300005602|Ga0070762_10972704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 581 | Open in IMG/M |
3300005842|Ga0068858_100423979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1280 | Open in IMG/M |
3300006028|Ga0070717_10315200 | Not Available | 1393 | Open in IMG/M |
3300006175|Ga0070712_100899632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 763 | Open in IMG/M |
3300006175|Ga0070712_102059878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
3300006176|Ga0070765_100752828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
3300006804|Ga0079221_10050924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1857 | Open in IMG/M |
3300006806|Ga0079220_10998146 | Not Available | 664 | Open in IMG/M |
3300006893|Ga0073928_10236665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1405 | Open in IMG/M |
3300006904|Ga0075424_102024653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 607 | Open in IMG/M |
3300006914|Ga0075436_100199207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1418 | Open in IMG/M |
3300007258|Ga0099793_10302706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 777 | Open in IMG/M |
3300009147|Ga0114129_12901986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 567 | Open in IMG/M |
3300009522|Ga0116218_1328122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 684 | Open in IMG/M |
3300009545|Ga0105237_12172351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 564 | Open in IMG/M |
3300009665|Ga0116135_1375018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 573 | Open in IMG/M |
3300009700|Ga0116217_10758876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 598 | Open in IMG/M |
3300009824|Ga0116219_10521259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 656 | Open in IMG/M |
3300010159|Ga0099796_10554194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
3300010303|Ga0134082_10538081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 513 | Open in IMG/M |
3300010333|Ga0134080_10422780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 620 | Open in IMG/M |
3300010337|Ga0134062_10778455 | Not Available | 510 | Open in IMG/M |
3300010358|Ga0126370_11074003 | Not Available | 740 | Open in IMG/M |
3300010358|Ga0126370_12025485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 563 | Open in IMG/M |
3300010358|Ga0126370_12103504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 554 | Open in IMG/M |
3300010360|Ga0126372_12561178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 561 | Open in IMG/M |
3300010361|Ga0126378_12412598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 601 | Open in IMG/M |
3300010371|Ga0134125_11008187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 913 | Open in IMG/M |
3300010371|Ga0134125_11331404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 783 | Open in IMG/M |
3300010401|Ga0134121_13282593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
3300011119|Ga0105246_10337790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1230 | Open in IMG/M |
3300012198|Ga0137364_11356352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
3300012200|Ga0137382_10368734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1009 | Open in IMG/M |
3300012355|Ga0137369_10921802 | Not Available | 585 | Open in IMG/M |
3300012360|Ga0137375_10358333 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
3300012363|Ga0137390_10936734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 820 | Open in IMG/M |
3300012930|Ga0137407_10156145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2020 | Open in IMG/M |
3300012960|Ga0164301_10117310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1565 | Open in IMG/M |
3300012971|Ga0126369_11685222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
3300012971|Ga0126369_11818166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 698 | Open in IMG/M |
3300012971|Ga0126369_12881837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 563 | Open in IMG/M |
3300013306|Ga0163162_10970984 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300014654|Ga0181525_10274091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 921 | Open in IMG/M |
3300014968|Ga0157379_12679900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
3300014969|Ga0157376_12676582 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 539 | Open in IMG/M |
3300015372|Ga0132256_100648485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1171 | Open in IMG/M |
3300016270|Ga0182036_11233792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 622 | Open in IMG/M |
3300016270|Ga0182036_11561819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
3300016341|Ga0182035_10759154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 848 | Open in IMG/M |
3300016357|Ga0182032_10075469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2296 | Open in IMG/M |
3300016357|Ga0182032_10448325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
3300016387|Ga0182040_10514552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
3300016445|Ga0182038_10014570 | All Organisms → cellular organisms → Bacteria | 4556 | Open in IMG/M |
3300016445|Ga0182038_10609909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
3300017961|Ga0187778_11365925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
3300017970|Ga0187783_10760680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 699 | Open in IMG/M |
3300017972|Ga0187781_10563106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
3300017994|Ga0187822_10400080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
3300018001|Ga0187815_10070345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1471 | Open in IMG/M |
3300018001|Ga0187815_10172076 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300018037|Ga0187883_10373907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 729 | Open in IMG/M |
3300018054|Ga0184621_10302770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 564 | Open in IMG/M |
3300018060|Ga0187765_10649046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 687 | Open in IMG/M |
3300018482|Ga0066669_10369982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1200 | Open in IMG/M |
3300018482|Ga0066669_11339341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 648 | Open in IMG/M |
3300019879|Ga0193723_1099969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 820 | Open in IMG/M |
3300020199|Ga0179592_10270945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 759 | Open in IMG/M |
3300021088|Ga0210404_10621846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 614 | Open in IMG/M |
3300021401|Ga0210393_10756769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
3300021403|Ga0210397_11073758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 625 | Open in IMG/M |
3300021405|Ga0210387_11861325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
3300021407|Ga0210383_11142059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 656 | Open in IMG/M |
3300021478|Ga0210402_10051057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3618 | Open in IMG/M |
3300021478|Ga0210402_11481090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 606 | Open in IMG/M |
3300021479|Ga0210410_11170957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 660 | Open in IMG/M |
3300021560|Ga0126371_10024046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5643 | Open in IMG/M |
3300021560|Ga0126371_10865783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1048 | Open in IMG/M |
3300021560|Ga0126371_12656657 | Not Available | 607 | Open in IMG/M |
3300024325|Ga0247678_1007107 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
3300024331|Ga0247668_1104471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
3300025898|Ga0207692_10903347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 581 | Open in IMG/M |
3300025898|Ga0207692_10937611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
3300025898|Ga0207692_11027579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 545 | Open in IMG/M |
3300025906|Ga0207699_11118978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 583 | Open in IMG/M |
3300025911|Ga0207654_10798049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 682 | Open in IMG/M |
3300025929|Ga0207664_10016313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 5417 | Open in IMG/M |
3300025929|Ga0207664_10508252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1079 | Open in IMG/M |
3300025929|Ga0207664_11310368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 644 | Open in IMG/M |
3300025929|Ga0207664_11663771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 560 | Open in IMG/M |
3300025942|Ga0207689_10557787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 962 | Open in IMG/M |
3300026088|Ga0207641_11380691 | Not Available | 705 | Open in IMG/M |
3300026319|Ga0209647_1129398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1131 | Open in IMG/M |
3300026489|Ga0257160_1107038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
3300026920|Ga0208575_1022898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 560 | Open in IMG/M |
3300027031|Ga0208986_1003193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1391 | Open in IMG/M |
3300027072|Ga0208238_1020020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 582 | Open in IMG/M |
3300027076|Ga0208860_1000412 | All Organisms → cellular organisms → Bacteria | 2330 | Open in IMG/M |
3300027158|Ga0208725_1053036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 608 | Open in IMG/M |
3300027171|Ga0207947_1016034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
3300027174|Ga0207948_1034187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 610 | Open in IMG/M |
3300027725|Ga0209178_1110479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 925 | Open in IMG/M |
3300027765|Ga0209073_10193452 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300027889|Ga0209380_10107563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 1615 | Open in IMG/M |
3300027915|Ga0209069_10644237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 616 | Open in IMG/M |
3300027986|Ga0209168_10555016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
3300028138|Ga0247684_1022715 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
3300028731|Ga0302301_1114708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 684 | Open in IMG/M |
3300028789|Ga0302232_10040485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2511 | Open in IMG/M |
3300028819|Ga0307296_10156902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1230 | Open in IMG/M |
3300028819|Ga0307296_10340579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 819 | Open in IMG/M |
3300028877|Ga0302235_10070881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1627 | Open in IMG/M |
3300029951|Ga0311371_10873133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
3300030046|Ga0302305_1309195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 543 | Open in IMG/M |
3300030053|Ga0302177_10016341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 4810 | Open in IMG/M |
3300030707|Ga0310038_10458298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 545 | Open in IMG/M |
3300030707|Ga0310038_10489419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 521 | Open in IMG/M |
3300030813|Ga0265750_1040731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 673 | Open in IMG/M |
3300031234|Ga0302325_10847905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1279 | Open in IMG/M |
3300031234|Ga0302325_12749134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
3300031543|Ga0318516_10077513 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
3300031543|Ga0318516_10090641 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
3300031543|Ga0318516_10613520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 621 | Open in IMG/M |
3300031544|Ga0318534_10149215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1349 | Open in IMG/M |
3300031544|Ga0318534_10352947 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300031549|Ga0318571_10073084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1072 | Open in IMG/M |
3300031561|Ga0318528_10133455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1317 | Open in IMG/M |
3300031564|Ga0318573_10116528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1383 | Open in IMG/M |
3300031640|Ga0318555_10474989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 678 | Open in IMG/M |
3300031679|Ga0318561_10710705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
3300031680|Ga0318574_10710261 | Not Available | 589 | Open in IMG/M |
3300031681|Ga0318572_10559973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 681 | Open in IMG/M |
3300031682|Ga0318560_10010440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3983 | Open in IMG/M |
3300031682|Ga0318560_10558023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 620 | Open in IMG/M |
3300031713|Ga0318496_10045903 | All Organisms → cellular organisms → Bacteria | 2251 | Open in IMG/M |
3300031718|Ga0307474_11312750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 571 | Open in IMG/M |
3300031719|Ga0306917_10420743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1045 | Open in IMG/M |
3300031719|Ga0306917_11096694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 620 | Open in IMG/M |
3300031723|Ga0318493_10062179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1799 | Open in IMG/M |
3300031724|Ga0318500_10560377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 577 | Open in IMG/M |
3300031724|Ga0318500_10738588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
3300031736|Ga0318501_10153595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1186 | Open in IMG/M |
3300031744|Ga0306918_10070595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2397 | Open in IMG/M |
3300031748|Ga0318492_10459453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 673 | Open in IMG/M |
3300031751|Ga0318494_10278064 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300031751|Ga0318494_10443972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 754 | Open in IMG/M |
3300031751|Ga0318494_10508189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 702 | Open in IMG/M |
3300031764|Ga0318535_10032582 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
3300031765|Ga0318554_10217671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1087 | Open in IMG/M |
3300031765|Ga0318554_10261265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 986 | Open in IMG/M |
3300031765|Ga0318554_10368053 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300031765|Ga0318554_10392712 | Not Available | 788 | Open in IMG/M |
3300031765|Ga0318554_10445453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 734 | Open in IMG/M |
3300031768|Ga0318509_10264675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 961 | Open in IMG/M |
3300031768|Ga0318509_10581262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 624 | Open in IMG/M |
3300031769|Ga0318526_10311403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 644 | Open in IMG/M |
3300031770|Ga0318521_10277609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 983 | Open in IMG/M |
3300031778|Ga0318498_10067056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1609 | Open in IMG/M |
3300031778|Ga0318498_10112237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1238 | Open in IMG/M |
3300031782|Ga0318552_10015097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3315 | Open in IMG/M |
3300031782|Ga0318552_10019593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2981 | Open in IMG/M |
3300031782|Ga0318552_10123461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1290 | Open in IMG/M |
3300031782|Ga0318552_10577486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
3300031793|Ga0318548_10153280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1124 | Open in IMG/M |
3300031797|Ga0318550_10151467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1114 | Open in IMG/M |
3300031797|Ga0318550_10198964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 969 | Open in IMG/M |
3300031798|Ga0318523_10079721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1584 | Open in IMG/M |
3300031805|Ga0318497_10663280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 585 | Open in IMG/M |
3300031821|Ga0318567_10349859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 835 | Open in IMG/M |
3300031833|Ga0310917_10770622 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300031835|Ga0318517_10542726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
3300031845|Ga0318511_10125479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1109 | Open in IMG/M |
3300031846|Ga0318512_10046783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1917 | Open in IMG/M |
3300031846|Ga0318512_10388919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 700 | Open in IMG/M |
3300031846|Ga0318512_10640054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 543 | Open in IMG/M |
3300031860|Ga0318495_10054469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1773 | Open in IMG/M |
3300031879|Ga0306919_11015112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 634 | Open in IMG/M |
3300031893|Ga0318536_10518908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 598 | Open in IMG/M |
3300031894|Ga0318522_10292812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 617 | Open in IMG/M |
3300031894|Ga0318522_10325732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 582 | Open in IMG/M |
3300031897|Ga0318520_10283269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 995 | Open in IMG/M |
3300031959|Ga0318530_10138417 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300031959|Ga0318530_10290051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 676 | Open in IMG/M |
3300031959|Ga0318530_10327560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 634 | Open in IMG/M |
3300032008|Ga0318562_10044952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2408 | Open in IMG/M |
3300032035|Ga0310911_10282213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
3300032035|Ga0310911_10343632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
3300032039|Ga0318559_10052510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1710 | Open in IMG/M |
3300032039|Ga0318559_10131977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1126 | Open in IMG/M |
3300032044|Ga0318558_10022200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2584 | Open in IMG/M |
3300032044|Ga0318558_10335816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 749 | Open in IMG/M |
3300032051|Ga0318532_10319076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
3300032054|Ga0318570_10025491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2295 | Open in IMG/M |
3300032054|Ga0318570_10196495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
3300032059|Ga0318533_10999145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 614 | Open in IMG/M |
3300032059|Ga0318533_11363828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
3300032063|Ga0318504_10017845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2632 | Open in IMG/M |
3300032063|Ga0318504_10213482 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300032064|Ga0318510_10425630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 568 | Open in IMG/M |
3300032065|Ga0318513_10030438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2327 | Open in IMG/M |
3300032065|Ga0318513_10414128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 658 | Open in IMG/M |
3300032066|Ga0318514_10290764 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300032066|Ga0318514_10292645 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300032067|Ga0318524_10573266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 594 | Open in IMG/M |
3300032076|Ga0306924_10643827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1196 | Open in IMG/M |
3300032076|Ga0306924_10661683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1176 | Open in IMG/M |
3300032076|Ga0306924_12370104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 536 | Open in IMG/M |
3300032089|Ga0318525_10564209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 581 | Open in IMG/M |
3300032091|Ga0318577_10392875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
3300032160|Ga0311301_12448595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 586 | Open in IMG/M |
3300032160|Ga0311301_12595921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 562 | Open in IMG/M |
3300032174|Ga0307470_11307258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 594 | Open in IMG/M |
3300032180|Ga0307471_101794221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 765 | Open in IMG/M |
3300032783|Ga0335079_12363561 | Not Available | 503 | Open in IMG/M |
3300032898|Ga0335072_10323311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1710 | Open in IMG/M |
3300032898|Ga0335072_11308370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 634 | Open in IMG/M |
3300032898|Ga0335072_11761032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 513 | Open in IMG/M |
3300033134|Ga0335073_11494441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 652 | Open in IMG/M |
3300033158|Ga0335077_11708640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 595 | Open in IMG/M |
3300033289|Ga0310914_11706577 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300033290|Ga0318519_10111279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1487 | Open in IMG/M |
3300034820|Ga0373959_0023080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1207 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.41% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.70% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.85% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.42% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.42% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.99% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.14% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.14% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.71% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.71% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.71% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.28% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.28% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.28% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.28% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.43% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.43% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.43% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.43% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.43% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.43% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.43% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.43% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.43% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.43% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000903 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 | Environmental | Open in IMG/M |
3300001405 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
3300026920 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) | Environmental | Open in IMG/M |
3300027031 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027072 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF013 (SPAdes) | Environmental | Open in IMG/M |
3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
3300027171 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF039 (SPAdes) | Environmental | Open in IMG/M |
3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030046 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_3 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0859.00006430 | 2166559005 | Simulated | MTIFDEIQASIARLAENAGPSVAGIGQRWGIGSGIVLGRGGC |
INPgaii200_11692931 | 2228664022 | Soil | MTIFDEIQASIARLAEDAGPSVXGIGQRWGIGSGIVLGAGQVLTNA |
JGI11872J12872_1021792 | 3300000903 | Forest Soil | MAILDEIGASIKQLAEGAGTSVVGIGQRWGAGSGIVLSEGKVLTNA |
JGI20186J14852_10082941 | 3300001405 | Arctic Peat Soil | MAILDEIHQNIRQLAESAGPSVVGIGQRWGVGSGFVLA |
JGIcombinedJ26739_1016376051 | 3300002245 | Forest Soil | MAILDEIQAGIVRLAEGVGSSVVGIGQRWGVGSGIVLG |
JGI25616J43925_101988871 | 3300002917 | Grasslands Soil | MAILDEIQADIVRLADGVGAAVVGIGQRWGVGSGIVLGEGR |
JGIcombinedJ51221_102526702 | 3300003505 | Forest Soil | MTIFDEIQANIARLAQDAGSSVVGIGQRWGVGSGVVLGAG |
Ga0066388_1012744541 | 3300005332 | Tropical Forest Soil | MTILDEVGVSIRQLAEGAGTSVVGIGQRWGAGSGIVLGEGQI |
Ga0070671_1011219751 | 3300005355 | Switchgrass Rhizosphere | MTVLDEIQASIRQLSEGAGRSVVGIGQRWGVGSGVVLGEG |
Ga0070714_1002552432 | 3300005435 | Agricultural Soil | MAAMTILDEIQTSIRQHAEGAGSSVVGIGQRWGVGSGIVLA |
Ga0070713_1010053963 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTILDEIQTSIRQHAAGAGSSVVGIGQRWGVGSGIVLAEG |
Ga0070665_1000806544 | 3300005548 | Switchgrass Rhizosphere | MAILDEIGASIRELGEGAGTSVVGIGQRWGAGSGIVLS |
Ga0066695_107337211 | 3300005553 | Soil | MTILDEIQASIRQHAEGAGSSVVGIGQRWGVGSGIV |
Ga0070762_109727041 | 3300005602 | Soil | MTVLDEIQASIKQLAETAGPSVVGIGQRWGIGSGIVLA |
Ga0068858_1004239793 | 3300005842 | Switchgrass Rhizosphere | MTIFDEIQASIARLAEDAGPSVAGIGQRWGIGSGIVLGEG |
Ga0070717_103152001 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVLDEIQTSIRQHAEDAGSSVVGIGQRWGVGSGIVLAE |
Ga0070712_1008996321 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFLDEVQTNIRQLAEGAGASVVGIGQRWGVGSGIV |
Ga0070712_1020598781 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MAILDEVGASIRQLAEGAGTSVVGIGQRWGAGSGI |
Ga0070765_1007528283 | 3300006176 | Soil | MTILDEIQVSIARLAEEGGSSVVGIGQRWGVGSGIVLG |
Ga0079221_100509241 | 3300006804 | Agricultural Soil | MTILDEVGAGIKQLSEGAGTSVVGIGQRWGAGSGIVLGE |
Ga0079220_109981461 | 3300006806 | Agricultural Soil | MTILDEIQTSIRQQAEGAGASVVGIGQRWGVGSGIVLAE |
Ga0073928_102366654 | 3300006893 | Iron-Sulfur Acid Spring | MMTILDEIGASIRQLAEGAGVSVVGIGQRWGAGSGIVLGAG |
Ga0075424_1020246532 | 3300006904 | Populus Rhizosphere | MTILDEIQASIRQHAEGAGSSVVGIGQRWGVGSGIVL |
Ga0075436_1001992072 | 3300006914 | Populus Rhizosphere | MTILDEIQTSIRQQAEGAGASVVGIGQRWGLGSGIVLAEGRVL |
Ga0099793_103027062 | 3300007258 | Vadose Zone Soil | MTILDEIQTSIRQHAEGADSSVVGIGQRWGVGSGIVL |
Ga0114129_129019862 | 3300009147 | Populus Rhizosphere | MAAMTILDEIQTGIRQHAEGAGSSVVGVGQRWGLGSGIVL |
Ga0116218_13281221 | 3300009522 | Peatlands Soil | MTIFDEIQASIARLAQDAGASVAGIGQRWGAGSGVVLGAGQVL |
Ga0105237_121723512 | 3300009545 | Corn Rhizosphere | MAAMTILDEIQTSIRQHAEGTGSSVAGIGQRWSLGSGIVLAEGRV |
Ga0116135_13750181 | 3300009665 | Peatland | MAILDEIGASIRELAAGAGSSVVGIGQRWGAGSGVVL |
Ga0116217_107588761 | 3300009700 | Peatlands Soil | MAILDEIQQTIRQLAEGAGSSVVGIGQRWGVGSGIVLG |
Ga0116219_105212591 | 3300009824 | Peatlands Soil | MTIFDEIQASIARLAQDAGASVAGIGQRWGAGSGVVLGAGQ |
Ga0099796_105541941 | 3300010159 | Vadose Zone Soil | MTILDEIQTSIRQHADGAGSSVVGIGQRWGVGSGIVLAE |
Ga0134082_105380811 | 3300010303 | Grasslands Soil | MTIFDEIQASITRLTENAGPSVAGIGQRWGIGSGIVLGAG |
Ga0134080_104227801 | 3300010333 | Grasslands Soil | VVAVTVLDEIQASIRQLSEGTGPSVVGIGQRWGVGSGV |
Ga0134062_107784551 | 3300010337 | Grasslands Soil | MTIFDEIQASITRLAEGAGPSVAGIGQRWGIGSGIVLG |
Ga0126370_110740031 | 3300010358 | Tropical Forest Soil | MAAMTILDEIQAGIRQHAGGAGSSVVGIGQRWGLGSGVVLAEG |
Ga0126370_120254852 | 3300010358 | Tropical Forest Soil | MGILDEVGASIRQLAGGAGTSVVGIGQRWGAGSGIVLG |
Ga0126370_121035042 | 3300010358 | Tropical Forest Soil | MTILDEIQAGIRQHAEGAGSSVVGIGQRWGLGSGIVLAEGRVLT |
Ga0126372_125611781 | 3300010360 | Tropical Forest Soil | MAVLDEIQASIRQLAEGAGASVVGIGQRWGAGSGVV |
Ga0126378_124125981 | 3300010361 | Tropical Forest Soil | MTIFDEIQASIAGLAESAGSSVVGIGQRWGVGSGIVLGE |
Ga0134125_110081871 | 3300010371 | Terrestrial Soil | MAAMTILDEIQTSIRQHAEGAGSSVVGIGQRWGVGSGI |
Ga0134125_113314041 | 3300010371 | Terrestrial Soil | MTILDEVQTSIRQHAEGAGSSVVGIGQRWGLGSGIVLAE |
Ga0134121_132825932 | 3300010401 | Terrestrial Soil | MTIFDEIQASIARLEEDAGPSVAGIGQRWGIGSGIVLG |
Ga0105246_103377902 | 3300011119 | Miscanthus Rhizosphere | MTILDEIQTSIRQHAEGTGSSVVGIGQRWGLGSGIVLAE |
Ga0137364_113563522 | 3300012198 | Vadose Zone Soil | MAILDEVGASIRQLAGGAGASVVGIGQRWGAGSGIVLDEGRI |
Ga0137382_103687341 | 3300012200 | Vadose Zone Soil | MTIFDEIQASIARLAEDAGPSVAGIGQRWGIGSGIVLGAG |
Ga0137369_109218021 | 3300012355 | Vadose Zone Soil | MAAMTILDEIQASIRQHAEGAGSSVVGIGQRWGAGSGIVLGE |
Ga0137375_103583331 | 3300012360 | Vadose Zone Soil | MGTLDEIQASIRHLAEGAGPSVVGIGQRWGIGSGIVIS |
Ga0137390_109367341 | 3300012363 | Vadose Zone Soil | MAILDEVGASIRQLAEGAGTSVVGIGQRWGSGSGIVLG |
Ga0137407_101561451 | 3300012930 | Vadose Zone Soil | MTIFDEIQASIERLAENAGSSVAGIGQRWGIGSGIVLG |
Ga0164301_101173103 | 3300012960 | Soil | MTIFYEIQASIARLAEDAGPSVAGIGQRWGIGSGIVLGA |
Ga0126369_116852222 | 3300012971 | Tropical Forest Soil | MTILDEVGASIRQLAEGAGTSVVGIGQRWGVGSGIVLGEA* |
Ga0126369_118181661 | 3300012971 | Tropical Forest Soil | MAILDEIGASIRQLAEGAGTSVVGIGHRWGAGSGIVLG |
Ga0126369_128818371 | 3300012971 | Tropical Forest Soil | MTILDEVGASIRQLAQSAGASVVGIGQRWGTGTGIVLGE |
Ga0163162_109709841 | 3300013306 | Switchgrass Rhizosphere | MAAMTILDEIQTSIRQHAEGAGSSVVGIGQRWGVGSGIVLAE |
Ga0181525_102740913 | 3300014654 | Bog | MTILDEVGASIRQLAEGAGASVVGIGQRWGTGSGIVLGNGQ |
Ga0157379_126799002 | 3300014968 | Switchgrass Rhizosphere | MTIFDEIQASIAQLAEGAGPSVAGIGQRWGIGSGIVL |
Ga0157376_126765821 | 3300014969 | Miscanthus Rhizosphere | MTILDEIGASIRQLAEGAGASVVGIGQRWGAGSGV |
Ga0132256_1006484851 | 3300015372 | Arabidopsis Rhizosphere | MTIFDEIQASIARLAEDAGPSVAGIGQRGGIGSGIVLGEGWV |
Ga0182036_112337921 | 3300016270 | Soil | MAILDEVGASIRQLAGGAGASVVGIGQRWGAGSGIVLGE |
Ga0182036_115618192 | 3300016270 | Soil | MTILDEIQESIRQHAAGAGSSVVGIGQRWGSGSGIVLAE |
Ga0182035_107591541 | 3300016341 | Soil | MAIFDEIQASIAGLAESAGSSVTGIGQRWGVGSGIVLGEG |
Ga0182032_100754691 | 3300016357 | Soil | MTIFDEIQAGIEQVAEGAGSSVVGIGHRWGAGSGIVLGDGQV |
Ga0182032_104483253 | 3300016357 | Soil | MTILDDVGASIRQLAEGAGISVVGIGQRWGAGSGIVLGEG |
Ga0182040_105145521 | 3300016387 | Soil | MAIFDEIQAGIEQVAEGAGSSVVGIGHRWGAGSGIVLGDGQV |
Ga0182038_100145704 | 3300016445 | Soil | MTILDEIQTSIRQHAEGAGSSVVGIGQRWGIGSGIVLAEGRVLT |
Ga0182038_106099091 | 3300016445 | Soil | MAIFDEVGASIRQLAEGAGSSVVGIGQRWGVGSGVVLG |
Ga0187778_113659251 | 3300017961 | Tropical Peatland | MAILDEIQAGIAQLADGVGSSVVGVGQRWGVGSGIVLGA |
Ga0187783_107606801 | 3300017970 | Tropical Peatland | MAIFDEIQAGVERVAAGAGSSVVGIGHRWGTGSGI |
Ga0187781_105631063 | 3300017972 | Tropical Peatland | MTVFDEIQASITRLAEDAGTSVVGIGQRWGVGSGIVLG |
Ga0187822_104000801 | 3300017994 | Freshwater Sediment | MTIFDEIQASIARLAENAGSSVVGIGQRWGIGSGIVLGEGQG |
Ga0187815_100703451 | 3300018001 | Freshwater Sediment | MTVLDEIQAGIARLAGEAGSSVVGIGQRWGVGSGIVLG |
Ga0187815_101720761 | 3300018001 | Freshwater Sediment | MTIFDEIQASIARLAQDTGSSVVGIGQRWGVGSGV |
Ga0187883_103739071 | 3300018037 | Peatland | MTILDEIGTNIRQLAEGAGASVVGIGRRWGTGSGIVLGK |
Ga0184621_103027702 | 3300018054 | Groundwater Sediment | MGVFDDIHAAIGRIAESIGASVVGLGQRWGVGSGIVIGAG |
Ga0187765_106490462 | 3300018060 | Tropical Peatland | MTIFDEIQASISQLAEGAGASVVGIGQRWGAGSGIVLGD |
Ga0066669_103699821 | 3300018482 | Grasslands Soil | MTIFDEIQASITRLAEEAGPSVVGIGQRWGIGSGIVLGE |
Ga0066669_113393411 | 3300018482 | Grasslands Soil | MTILDEIQTSIRQHAERAGSSVVDIGQRWDVGSGIVLAEAGC |
Ga0193723_10999691 | 3300019879 | Soil | MTIFDEIQASIARLAEDAGPSVAGIGQRWGIGSGIVLGE |
Ga0179592_102709452 | 3300020199 | Vadose Zone Soil | MTILDEIQGSIRQLAEGAGPSVVGVGQRWGIGSGIVLGE |
Ga0210404_106218462 | 3300021088 | Soil | MAILDEIGASIRQLAEGAGASVVGIGQRWGAGSGIV |
Ga0210393_107567691 | 3300021401 | Soil | MTILDEIQVSIARLAEESGSSVVGIGQRWGVGSGIVL |
Ga0210397_110737582 | 3300021403 | Soil | MTILDEIQAGIRQQADGAGASVVGIGQRWGAGSGVV |
Ga0210387_118613251 | 3300021405 | Soil | MTILDEIQTSIRQQAEGAGASVVGIGQRWGLGSGIVLAE |
Ga0210383_111420591 | 3300021407 | Soil | MAILDEIGTSIRQLADGAGASVVGVGQRWGAGSGIVL |
Ga0210402_100510571 | 3300021478 | Soil | MAILDEIGASIRQLADGAGASVVGIGQRWGAGSGIVLGEGQV |
Ga0210402_114810901 | 3300021478 | Soil | MAIFDEIQAGIEQVAEGAGSSVVGIGHRWGAGSGI |
Ga0210410_111709572 | 3300021479 | Soil | MTILDEIQVSIARLAEEGGSSVVGIGQRWGVGCGIVR |
Ga0126371_100240467 | 3300021560 | Tropical Forest Soil | MTILDEIQTSIRQHAEGAGSSVVGIGQRWGLGSGIVLA |
Ga0126371_108657831 | 3300021560 | Tropical Forest Soil | MAILDEIGASIRQLAQGAGASVVGIGQRWGTGTGIVLGE |
Ga0126371_126566571 | 3300021560 | Tropical Forest Soil | MTILDEIQIGIRQHAEGAGSAVVGVGQRWGLGSGIVLAE |
Ga0247678_10071074 | 3300024325 | Soil | MTILDEIQTGIRQHAEGAGSSVVGIGQRWGVGSGIVTAE |
Ga0247668_11044711 | 3300024331 | Soil | MTIFDEIQASIARLAEDAGPSVAGIGQRWGIGSGIVLG |
Ga0207692_109033471 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVLDEIAASIRQLAESAGASVVGIGQRWGAGSGIVLGAGQVLTN |
Ga0207692_109376112 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIFDEIQASIARLAEDAGPSVAGIGQRWGIGSGIVLGEGRVL |
Ga0207692_110275792 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MAILDEIGASIKQLAEGPGASVVGVGQRWGVGSGIVLGEGT |
Ga0207699_111189781 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTILDEIQTSIRQHAEGAGSSVVGIGQRWGVGSGI |
Ga0207654_107980491 | 3300025911 | Corn Rhizosphere | MTILDEIQASIRQHAEGAGSSVVGIGQRWGDGSGIVLAEGRVLT |
Ga0207664_100163131 | 3300025929 | Agricultural Soil | MTILDEIQTSIRQHAEGAGSSVVGIGQRWGVGSGIVLA |
Ga0207664_105082521 | 3300025929 | Agricultural Soil | MTIFDEIQASIAGLAENAGSSVAGIGQRWGVGSGIVL |
Ga0207664_113103682 | 3300025929 | Agricultural Soil | MTALDEIQAGIGRLAEGAGRSVVGIGQRWGAGSGIVLGD |
Ga0207664_116637712 | 3300025929 | Agricultural Soil | MTILDEVGASIKQLAEGAGTSVVGIGQRWGAGSGIVL |
Ga0207689_105577873 | 3300025942 | Miscanthus Rhizosphere | MTILDEIQASIRQHAEGAGSSVVGIGQRWGVGSGIVLA |
Ga0207641_113806911 | 3300026088 | Switchgrass Rhizosphere | MAILDEIQTSIRQHAEGTGSSVVGIGQRWGLGSGIVLAEGRV |
Ga0209647_11293982 | 3300026319 | Grasslands Soil | MTILDEIGASIRQLADGAGASVAGIGQRWGAGSGIVLG |
Ga0257160_11070382 | 3300026489 | Soil | MTILDEIAASIRQLAEGAGASVVGIGQRWGAGSGIVLGE |
Ga0208575_10228982 | 3300026920 | Soil | MTIFDEIQASIARLAEDAGPSVAGIGQRWGIGSGIVLGAGQV |
Ga0208986_10031931 | 3300027031 | Forest Soil | MTIFDEIQASIARLAENAGPSVAGIGQRWGIGSGIVLGEGR |
Ga0208238_10200201 | 3300027072 | Forest Soil | MTILDEVGASIRQLSEGAGASVVGVGQRQGAGSGM |
Ga0208860_10004122 | 3300027076 | Forest Soil | MTILDEIQTSIRQHADGAGASVVGIGQRWGLGSGIVLAEGRVL |
Ga0208725_10530361 | 3300027158 | Forest Soil | MALLDEIQAGIKQQAEGAGASVVGVGQRWGVGSGVVLG |
Ga0207947_10160341 | 3300027171 | Forest Soil | MTILDEVGASIRQLAESAGASVVGIGQRWGTGSGIVL |
Ga0207948_10341872 | 3300027174 | Forest Soil | MTIFDEIQASIARLAEDAGSSVTGIGQRWGIGSGIVLGEGR |
Ga0209178_11104791 | 3300027725 | Agricultural Soil | MTVLDEIQASIRQLSEGAGRSVVGIGQRWGVGSCVVL |
Ga0209073_101934522 | 3300027765 | Agricultural Soil | MTILDEIQTNIRQHAEGAGSSVVGIGQRWGLGSGI |
Ga0209380_101075631 | 3300027889 | Soil | MTIFDEIQASITRLAQDAGSSVVGIGQRWGAGSGIVLGEGKV |
Ga0209069_106442372 | 3300027915 | Watersheds | MTILDEIGASIRQLAEGAGASVVGIGQRWGAGSGIVLGEGQV |
Ga0209168_105550161 | 3300027986 | Surface Soil | MTVLDEIGAGIARLADEAGSSVVGIGQRWGAGSGIVLGQGR |
Ga0247684_10227151 | 3300028138 | Soil | MAILDEIGASIKQLAEGPGTSVVGVGQRWGVGSGI |
Ga0302301_11147081 | 3300028731 | Palsa | MAILDEIQANIVQLAEGAGASVVGIGQRWGVGSGIVLA |
Ga0302232_100404851 | 3300028789 | Palsa | MTILDEIGVSIRQLAAGAGTSVVGVGQRWGAGSGIVI |
Ga0307296_101569021 | 3300028819 | Soil | MTILGEIQTSIRQHAEGAGSSVVGIGQRWGVGSGIVL |
Ga0307296_103405793 | 3300028819 | Soil | MAILDEIQANIRQLAEGAGPSVVGIGQRWGVGSGIV |
Ga0302235_100708814 | 3300028877 | Palsa | MTILDEVGTNIRQLAAGAGASVVGIGRRWGTGSGIVLGQG |
Ga0311371_108731333 | 3300029951 | Palsa | MTILDEVGASIRQLAEGAGASVVGIGQRWGTGSGIVLGKG |
Ga0302305_13091951 | 3300030046 | Palsa | MTILDEVGASIRQLAEGAGVSVVGIGQRRGAGSGIV |
Ga0302177_100163415 | 3300030053 | Palsa | MTILDEIQTSIARLAEDGGSSVVGIGQRWGVGSGI |
Ga0310038_104582981 | 3300030707 | Peatlands Soil | MAILDEIQQTIRQLAEGAGSSVVGIGQRWGVGSGIVL |
Ga0310038_104894192 | 3300030707 | Peatlands Soil | MTIFDEIQASIARLAQDAGSSVVGIGQRWGVGSGVVLG |
Ga0265750_10407312 | 3300030813 | Soil | MTILDEVGASIRQLASGAGASVVGVGQRQGAGSGIVLGKGQVLTNA |
Ga0302325_108479051 | 3300031234 | Palsa | MAILDEIQANIVQLAEGAGASVVGIGQRWGVGSGIV |
Ga0302325_127491341 | 3300031234 | Palsa | MTILDEIGTNIRQLAEGAGASVVGIGRRWGTGSGI |
Ga0318516_100775133 | 3300031543 | Soil | MTVLDEIQTSIRQHAGGAGSSVVGIGQRWGLGSGIVLAEGR |
Ga0318516_100906411 | 3300031543 | Soil | MTVLDEIQTSISQHAGGAGSSVVGIGQRWGLGSGIVLAEGQV |
Ga0318516_106135202 | 3300031543 | Soil | MTILDEVGASIKQLAEGTGASVVGIGQRWGVGSGIVLG |
Ga0318534_101492151 | 3300031544 | Soil | MTILDEIQAGIAQRAESTGGSVVGIGQRWGAGSGIVLG |
Ga0318534_103529473 | 3300031544 | Soil | MTILDEVGASIRQLAEGAGSSVVGIGQRWGAGSGVV |
Ga0318571_100730841 | 3300031549 | Soil | MTILDEVGVSIRQLAEGAGTSVAGIGQRWGAGSGIVLGEGQI |
Ga0318528_101334551 | 3300031561 | Soil | MTILDEVGASIRQLAEGAGSSVVGIGQRWGAGSGVVLGEGR |
Ga0318573_101165282 | 3300031564 | Soil | MTILDDVGASIRQLAEGAGISVVGIGQRWGAGSGI |
Ga0318555_104749892 | 3300031640 | Soil | MTILDEVGVSIRQLAEGAGTSVVGIGQRWGAGSGIVLGQGQ |
Ga0318561_107107052 | 3300031679 | Soil | MTILDEVGVSIRQLAEGAGTSVVGIGQRWGAGSGI |
Ga0318574_107102613 | 3300031680 | Soil | VTILDEIQASIRQHAQGAGSSVVGIGQRWGAGSGIVLAEGR |
Ga0318572_105599731 | 3300031681 | Soil | MTIFDEIQASIARLAESAGSSVVGIGQRWGVGSGIVLGE |
Ga0318560_100104401 | 3300031682 | Soil | MAIFDEIQAGIEQVAEGAGSSVVGIGHRWGAGSGIVLGDGQVL |
Ga0318560_105580232 | 3300031682 | Soil | MTILDEVGASIRQLAEGAGSSVVGIGQRWGAGSGIVLGEGRILT |
Ga0318496_100459034 | 3300031713 | Soil | MAILDEVGANIRQLAEGAGTSVVGIGQRWGAGSGVVFGEGRI |
Ga0307474_113127502 | 3300031718 | Hardwood Forest Soil | MAIFDEIQESIAQLAEGVGASVVGIGQRWGVGSGIVIG |
Ga0306917_104207434 | 3300031719 | Soil | MTILDEIQTSIRQHAEGAGSSVVGIGQRWGLGSGIV |
Ga0306917_110966941 | 3300031719 | Soil | MTIFDEIQASIARLAENAGSSVVGIGQRWGVGSGIVLGEG |
Ga0318493_100621791 | 3300031723 | Soil | MTIFDEIQASIARLAETAGSSVVGIGQRWGAGSGIVLGEGQVLT |
Ga0318500_105603772 | 3300031724 | Soil | MAILDEVGASIRQLAGGAGSSVVGIGQRWGAGSGVVLGEGRVLT |
Ga0318500_107385882 | 3300031724 | Soil | MAIFDEIQAGIEQLAEGAGASVVGVGHRWGAGSGI |
Ga0318501_101535951 | 3300031736 | Soil | MTILDEIQTSIRQHAEGAGSSVVGIGQRWGLGSGIVLAEGRV |
Ga0306918_100705951 | 3300031744 | Soil | MTIFDEIQASIARLAETAGSSVVGIGQRWGAGSGIVLGEGQV |
Ga0318492_104594532 | 3300031748 | Soil | MTILDEVGVSIRQLAEGAGTSVVGIGQRWGAGSGIVLSEGQI |
Ga0318494_102780641 | 3300031751 | Soil | MTVLDEIQTSIKQHAGGAGSSVVGIGQRWGLGSGIVLAE |
Ga0318494_104439721 | 3300031751 | Soil | MTILDEIQISIRQHAEGAGSSVVGIGQRWGVGSGI |
Ga0318494_105081892 | 3300031751 | Soil | MAILDEVGASIRQLAGGAGSSVVGIGQRWGAGSGVVLGEGR |
Ga0318535_100325824 | 3300031764 | Soil | MAILDEVGASIRQLAGGAGASVVGIGQRWGAGSGIVLGEGRI |
Ga0318554_102176711 | 3300031765 | Soil | MAILDGVGASIRQLAEGAGASVVGIGQRWGIGSGVVLGEGRVLT |
Ga0318554_102612653 | 3300031765 | Soil | MTILDEVGASIKQLAEGAGTSVVGIGQRWGAGSGVVLG |
Ga0318554_103680531 | 3300031765 | Soil | MAILDEVGASIRQLAGGAGTSVVGIGQRWGAGSGV |
Ga0318554_103927121 | 3300031765 | Soil | MSILDEIQTGIRQHAEGAGSSVVGIGQRWGLGSGVVLA |
Ga0318554_104454531 | 3300031765 | Soil | MAIFDEIQAGIEQLAEGAGASVVGVGHRWGAGSGIVLGDGQVLT |
Ga0318509_102646752 | 3300031768 | Soil | MAILDEIQAGIAQQAEGAGASVVGIGQRWGAGSGVVLGPGRVLT |
Ga0318509_105812622 | 3300031768 | Soil | MAILDEIGASIRQLSGSAGTSVVGIGQRWGAGSGVVLGEGRVLT |
Ga0318526_103114031 | 3300031769 | Soil | MTIFDEIQASITRLAENAGASVTGIGQRWGVGSGIVL |
Ga0318521_102776092 | 3300031770 | Soil | MTILDDVGASIRQLAEGAGISVVGIGQRWGAGSGIVLGEGRIL |
Ga0318498_100670561 | 3300031778 | Soil | MTILDDVGASIRQLAEGAGISVVGIGQRWGAGSGIVLGEGR |
Ga0318498_101122373 | 3300031778 | Soil | MTVLDEIGAGIARLGGEAGPSVVGIGQRWGVGSGV |
Ga0318552_100150971 | 3300031782 | Soil | MAILDEIQASIRQLAENAGASVVGVGQQWGAGSGIVLGAGQVLT |
Ga0318552_100195934 | 3300031782 | Soil | MTVLDEIGAGIARLGGEAGPSVVGIGQRWGVGSGVV |
Ga0318552_101234611 | 3300031782 | Soil | MTILDEIQAGIRQHAEGAGSSVVGVGQRWGLGSGI |
Ga0318552_105774862 | 3300031782 | Soil | MTILDEVGASIKQLAEGTGASVVGIGQRWGVGSGIV |
Ga0318548_101532801 | 3300031793 | Soil | MTVLDEIGAGIARLAGEAGSSVVGIGQRWGVGSGVVLGEGRV |
Ga0318550_101514673 | 3300031797 | Soil | MTIFDEIQGSIARLAETAGRCPRPRSQRWGAGSGIVLGEGEVL |
Ga0318550_101989642 | 3300031797 | Soil | MTILDEIQTSIRQHAEGAGSSVVGIGQRWGLGSGIVLAEGRVLTYA |
Ga0318523_100797211 | 3300031798 | Soil | MTIFDEIQASIARLAETAGSSVVGIGQRWGAGSGIVLGE |
Ga0318497_106632801 | 3300031805 | Soil | MTIFDEIQAGIEQVAEGAGSSVVGIGHRWGAGSGIVLGDGQVL |
Ga0318567_103498591 | 3300031821 | Soil | MTVLDEIGAGIARLAEEAGSSVVGIGQRWGVGSGIVLGEGQ |
Ga0310917_107706221 | 3300031833 | Soil | MTVLDEIQTSIRQHAGGAGSSVVGIGQRWGLGSGIVLAEGRV |
Ga0318517_105427262 | 3300031835 | Soil | MTILDEIQAGIAQRAESTGGSVVGIGQRWGAGSGIVLGPGRVL |
Ga0318511_101254793 | 3300031845 | Soil | MAILDEVGASIRQLAGDAGTSVVGIGQRWGAGSGI |
Ga0318512_100467831 | 3300031846 | Soil | MAILDEVGASIRQLAGGAGASVVGIGQRWGAGSGIVLGEGRIL |
Ga0318512_103889192 | 3300031846 | Soil | MTILDDVGASIRQLAEGAGISVVGIGQRWGAGSGIV |
Ga0318512_106400542 | 3300031846 | Soil | MAIFDEVGASIRQLAEGAGSSVVGIGQRWGVGSGVVLGEGR |
Ga0318495_100544691 | 3300031860 | Soil | MAILDEVGANIRQLAEGAGTSVVGIGQRWGAGSGVV |
Ga0306919_110151122 | 3300031879 | Soil | MTILDDVGASIRQLAEGAGISVVGIGQRWGAGSGIVLGEGRI |
Ga0318536_105189081 | 3300031893 | Soil | MTILDDVGASIRQLAGGAGTSVVGIGQRWGAGSGVILGEGRILT |
Ga0318522_102928122 | 3300031894 | Soil | MAIFDEIQTGIEQVAEGAGSSVVGIGHRWGAGSGIV |
Ga0318522_103257321 | 3300031894 | Soil | MPIFDEIQAGIEQVAEDAGSSVVGIGHRWGAGSGIVLGDGQIL |
Ga0318520_102832691 | 3300031897 | Soil | MTILDEVGVSIRQLAEGAGTSVVGIGQRWGAGSGIVLGEGQILTNA |
Ga0318530_101384171 | 3300031959 | Soil | MAILDEIQAGIAQQAEGAGASVVGIGQRWGAGSGVVLGP |
Ga0318530_102900512 | 3300031959 | Soil | MTTLDEVGASIRQLAEGAGTSVVGIGQRWGAGSGIVLGEGKVL |
Ga0318530_103275601 | 3300031959 | Soil | MTVLDEIGAGIARLGGEAGPSVVGIGQRWGVGSGVVLGE |
Ga0318562_100449521 | 3300032008 | Soil | MAILDEIQAGIAQQAAGAGASVVGIGQRWGAGSGVV |
Ga0310911_102822133 | 3300032035 | Soil | MTVLDEIGAGIARLGGEAGPSVVGIGQRWGVGSGVVL |
Ga0310911_103436323 | 3300032035 | Soil | MTILDEVGASIRQLAEGAGSSVVGIGQRWGAGSGVVLGE |
Ga0318559_100525104 | 3300032039 | Soil | MAILDEIQAGIAQQAEGAGASVVGIGQRWGAGSGVVLGQGR |
Ga0318559_101319773 | 3300032039 | Soil | MAILDEVGASIRQLAGGAGASVVGIGQRWGAGSGIVLGEGR |
Ga0318558_100222001 | 3300032044 | Soil | MAILDEIQAGIAQQAEGAGASVVGIGQRWGAGSGVVLGPGR |
Ga0318558_103358163 | 3300032044 | Soil | MAILDEIQASIRQHAAGAGSSVVGIGQRWGSGSGIVLAEG |
Ga0318532_103190761 | 3300032051 | Soil | MAILDEVGASIRQLAGGAGASVVGIGQRWGAGSGI |
Ga0318570_100254911 | 3300032054 | Soil | MTIFDEIQASVARLAQDAGSSVVGIGQRWGIGSGIVLGE |
Ga0318570_101964953 | 3300032054 | Soil | MTILDEVGASIRQTAEGAGASVVGIGQRWGAGSGVVLGAG |
Ga0318533_109991451 | 3300032059 | Soil | MTILDEIQTSIRQHAEGAGSSVVGIGQRWGLGSGIVLAE |
Ga0318533_113638281 | 3300032059 | Soil | MAILDEVGASIRQLAGGAGSSVVGIGQRWGAGSGIVLGEGRILT |
Ga0318504_100178451 | 3300032063 | Soil | MAILDEIQAGIAQQAEGAGASVVGIGQRWGAGSGVVLG |
Ga0318504_102134822 | 3300032063 | Soil | MTVLDEIQTSIKQHAGGAGSSVVGIGQRWGLGSGIVLAQG |
Ga0318510_104256301 | 3300032064 | Soil | MAIFDEIQAGIEQVAEGAGASVVGIGHRWGAGSGIVLGDGQVLT |
Ga0318513_100304381 | 3300032065 | Soil | MTILDEVGVSIRQLAEGAGTSVVGIGQRWGAGSGIVLGEG |
Ga0318513_104141281 | 3300032065 | Soil | MTIFDDIQASIARLAENAGSSVVGIGQRWGVGSGIVLGEGDRRL |
Ga0318514_102907641 | 3300032066 | Soil | MTILDEIQAGIAQRAESTGGSVVGIGQRWGAGSGIVLGPGR |
Ga0318514_102926451 | 3300032066 | Soil | MAILDEIQAGIAQQAEGAGASVVGIGQRWGAGSGIVLGPGRV |
Ga0318524_105732661 | 3300032067 | Soil | MTVLDEVGANIRQLAEGAGSSVVGIGQRWGSGSGIV |
Ga0306924_106438271 | 3300032076 | Soil | MAIFDEIQAGIEQLAEGAGASVVGVGHRWGAGSGIVLGDGQ |
Ga0306924_106616831 | 3300032076 | Soil | MTILDEVGVSIRQLAEGAGTSVVGIGQRWGAGSGIVL |
Ga0306924_123701041 | 3300032076 | Soil | MTILDEVGASIRQLAGGAGTSVVGIGQRWGAGSGIVLGE |
Ga0318525_105642091 | 3300032089 | Soil | MTVLDEIGAGIARLAEQAGSSVVGIGQRWGVGSGIVLGEGDRRVAA |
Ga0318577_103928751 | 3300032091 | Soil | MTILDEIQTSIRQHAEGAGSSVVGIGQRWGAGSGIVLAEGR |
Ga0311301_124485952 | 3300032160 | Peatlands Soil | MTILDEVQAGIVRVAEGAGSSVVGIGQRWGVGSGIVLDG |
Ga0311301_125959211 | 3300032160 | Peatlands Soil | MALLDEIQAGIRQQAEGAGASVVGVGQRWGVGSGVVLGP |
Ga0307470_113072582 | 3300032174 | Hardwood Forest Soil | MSILDEVQASIGQLAEGAGASVVGIGQRWGLGSGIVL |
Ga0307471_1017942211 | 3300032180 | Hardwood Forest Soil | MAILDEIGASIRQQAEGPGTSVVGIGQRWGAGTGIVLGEGRVLT |
Ga0335079_123635611 | 3300032783 | Soil | MTILDEIQTSIRQHAEGAGSSVVGIGQRWGLGSGIVLAEGRVL |
Ga0335072_103233111 | 3300032898 | Soil | MAILDDIGASIKQLADGPGASVVGVGQRWGVGSGIVLGEG |
Ga0335072_113083701 | 3300032898 | Soil | MTVLDEIGAGIARLAEEAGSSVVGIGQRWGVGSGIVLGERR |
Ga0335072_117610322 | 3300032898 | Soil | MAILDEIQAGIAGLAESAGASVVGIGQRWGAGSGIV |
Ga0335073_114944411 | 3300033134 | Soil | MAILDEIGASIRQLAEGAGASVVGIGQRWGVGSGIVLGEGKV |
Ga0335077_117086402 | 3300033158 | Soil | MTIFDEIQACIRQLAEGAGASVVGIGQRWGAGSGVVL |
Ga0310914_117065771 | 3300033289 | Soil | MTVLDEIQTSISQHAGGAGSSVVGIGQRWGLGSGIVLAEG |
Ga0318519_101112794 | 3300033290 | Soil | MAILDEIQAGIAQQAEGAGASVVGIGQRWGAGSGVVLGPGRV |
Ga0373959_0023080_1089_1205 | 3300034820 | Rhizosphere Soil | MTVLDEIQASIRQLSEGAGRSVVGIGQRWGVGSGVVLGE |
⦗Top⦘ |