| Basic Information | |
|---|---|
| Family ID | F018560 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 234 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MENTKCIEVRKDYYLLIIDDKSLGEFERSELRHIIEVIDNAI |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 234 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 23.08 % |
| % of genes from short scaffolds (< 2000 bps) | 80.77 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (82.906 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (19.231 % of family members) |
| Environment Ontology (ENVO) | Unclassified (74.359 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (78.632 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 28.57% Coil/Unstructured: 51.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 234 Family Scaffolds |
|---|---|---|
| PF05766 | NinG | 71.37 |
| PF08291 | Peptidase_M15_3 | 7.26 |
| PF01541 | GIY-YIG | 2.56 |
| PF13481 | AAA_25 | 1.28 |
| PF01555 | N6_N4_Mtase | 0.85 |
| PF13385 | Laminin_G_3 | 0.85 |
| PF02739 | 5_3_exonuc_N | 0.85 |
| PF11325 | DUF3127 | 0.43 |
| PF12728 | HTH_17 | 0.43 |
| PF08299 | Bac_DnaA_C | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 234 Family Scaffolds |
|---|---|---|---|
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.85 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.85 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.85 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 82.91 % |
| All Organisms | root | All Organisms | 17.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 19.23% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 12.82% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.97% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 8.12% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.98% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.70% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.42% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.42% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.99% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.56% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.14% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.14% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.71% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.71% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.71% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.71% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.28% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.28% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.28% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 1.28% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.28% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.85% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.43% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.43% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.43% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.43% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.43% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.43% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.43% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.43% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.43% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000121 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m | Environmental | Open in IMG/M |
| 3300000128 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45m | Environmental | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004642 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_10m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005609 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006399 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007552 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 | Environmental | Open in IMG/M |
| 3300007981 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011126 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300011247 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_3, 0.02 | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020317 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555998-ERR599027) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022853 | Saline water microbial communities from Ace Lake, Antarctica - #371 | Environmental | Open in IMG/M |
| 3300022857 | Saline water microbial communities from Ace Lake, Antarctica - #419 | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023229 | Saline water microbial communities from Ace Lake, Antarctica - #551 | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
| 3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300031167 | Marine microbial communities from water near the shore, Antarctic Ocean - #418 | Environmental | Open in IMG/M |
| 3300031227 | Saline water microbial communities from Ace Lake, Antarctica - #232 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100407213 | 3300000101 | Marine | MEKVKCIEVRKDYYLLIINDINLGEFEKSDLRNIIEKIDNAI* |
| DelMOSum2010_100696112 | 3300000101 | Marine | MENTKCIQVRKDYYLLIVNDKSLGEFEKSELRHIIEVIDNAI* |
| DelMOSum2010_101171034 | 3300000101 | Marine | MENTKCIQVRKDYYLLIVNDISLGEFEKSELRNIIEVIDNAI* |
| DelMOSum2010_102065082 | 3300000101 | Marine | MENTKCIAVRKDHYLLIIDDKSLGEFERSQLRHIIETIDNAI* |
| DelMOSum2010_102376521 | 3300000101 | Marine | MENVKCINVRKDYYLLIVNDISLGEFERSQLRHIIETIDNAI* |
| DelMOSum2010_102630081 | 3300000101 | Marine | MENTKCIAVRKDYYLXIVNDISLGEFEKSELRNIIEVIDNAI* |
| DelMOSum2011_100320184 | 3300000115 | Marine | MENTKCIAVRKDYYLLIIDNKSLGEFEKSQLRHIIETIDNAI* |
| DelMOSum2011_100603834 | 3300000115 | Marine | MENTKCIKVRKDYYLLVIGDKSLGEFERSELRNIIEVIDNAI* |
| DelMOSum2011_101447252 | 3300000115 | Marine | MENTKCIQVRKDYYLLIVDDKSLGEFEKSELRNIIEVIDNAI* |
| DelMOSum2011_102266952 | 3300000115 | Marine | MENTKCIXVRKDYYLLIVNDISLGEFEKSELRNIIEVIDNAI* |
| DelMOSpr2010_100646415 | 3300000116 | Marine | MENTKCIEVRKDYYLLIVDDKSLGEFERSELRHILEVIDNAI* |
| DelMOSpr2010_100778055 | 3300000116 | Marine | MENTKCIPVRKDYYLLIIDNKSLGEFEKSQLRHIIEVIDNAI* |
| DelMOSpr2010_100890485 | 3300000116 | Marine | EVRKDYYLLIIDDKSLGEFERSQLRHIIETIDNAI* |
| DelMOSpr2010_102232091 | 3300000116 | Marine | MENTKCIQVRKDYYLLIVDDKSLGEFERSELRHIL |
| TDF_OR_ARG04_113mDRAFT_10043784 | 3300000121 | Marine | MENTKCIKVRKDYYLLIIDDKTLGEFEKSQLRHIIETIDNAI* |
| TDF_OR_ARG04_113mDRAFT_10305731 | 3300000121 | Marine | MENTKCIAVRKDYYLLIIDDKSLGEFEKSQLRHIIETIDNAI* |
| SA_S1_NOR08_45mDRAFT_101393572 | 3300000128 | Marine | MENTKCIKVRKDYYLLVIDDKSLGEFERSELRNIIEVIDNAI* |
| BBAY93_100503114 | 3300000973 | Macroalgal Surface | MENTKCIQVRKDYYLLFIGDKSLGEFERSQLRNIIEVIDNAI* |
| JGI20152J14361_100810142 | 3300001344 | Pelagic Marine | MENTKCIAVRKDYYLLIVNDISLGEFEKSELRHILEVIDNAI* |
| JGI20156J14371_100989782 | 3300001347 | Pelagic Marine | MESTKCIAVRKDYYLLIIDDKSLGEFERSQLRYIIETIDNAI* |
| JGI20156J14371_101171593 | 3300001347 | Pelagic Marine | MENTKCIAVRKDYYLLIIDDKSLGEFEKSELRHILEVIDNAI* |
| JGI20154J14316_101037511 | 3300001348 | Pelagic Marine | MENTRCIEVRKDYYLLIIDDKSLGEFERSQLRHIIETIDNAI* |
| JGI24004J15324_100492285 | 3300001472 | Marine | MENTKCIQVRKDYYLLIVNDISLGEFKKSQLRHILEVIDNAI* |
| JGI24005J15628_100056183 | 3300001589 | Marine | MENTKCIKVRKDYYLLIVNDISLGEFERSELRNIIEVIDNAI* |
| JGI24005J15628_100937002 | 3300001589 | Marine | MENTKCIKVRKDYYLLIVNDISLGEFEKSQLRHILEVIDNAI* |
| Ga0066605_1000042029 | 3300004279 | Marine | MENTKCIEVRKDYYLLIIDDKSLGEFEKSQLRHIIEVIDNAI* |
| Ga0066605_101131714 | 3300004279 | Marine | MENTKCIQVRKDYYLLIIDDKSLGEFEKSQLRHIIETIDNAI* |
| Ga0065861_10334003 | 3300004448 | Marine | MENTKCIAVRKDYYLLIVNDKSLGEFERSELRHILEVIDNAI* |
| Ga0065861_10512842 | 3300004448 | Marine | MSIKCIEVRKEYYLLIINDISLGEFEKSDLRHIIEVIDGNI* |
| Ga0066223_10594953 | 3300004461 | Marine | MENTKCIAVRKDYYLLIVNDKSLGEFERSELRNIIEVIDNAI* |
| Ga0066612_12634941 | 3300004642 | Marine | MENTKCIAVRKDYYLLIVNDISLGEFERSELRNIIEVIDNAI* |
| Ga0073579_15617482 | 3300005239 | Marine | MENTKCIEVRKDYYLLIIDDKSLGEFERSQLRHIIETIDNAI* |
| Ga0070729_106254932 | 3300005589 | Marine Sediment | MESTKCIQVRKDYYLLIVDDKSLGEFERSELRHILEVIDNAI* |
| Ga0070724_100369377 | 3300005609 | Marine Sediment | MENTKCIAVRKDYYLLIVDDKSLGEFERSQLRHIIETIDNAI* |
| Ga0070725_104482401 | 3300005920 | Marine Sediment | MENTKCIAVRKDYYLLIVNDISLGEFERSQLRNILEVIDNAI* |
| Ga0075466_11714741 | 3300006029 | Aqueous | MENTKCIAVRKDYYLLIVNDISLGEFEKSELRNIIEVIDNAI* |
| Ga0075445_102672632 | 3300006193 | Marine | LENTKCIKVRKNYYLLIVDDKSLGEFQKSQLKHIIETIDNAI* |
| Ga0075495_10184461 | 3300006399 | Aqueous | MENTKCIQVRKDYYLLIVDDKSLGEFERSELRHILEVIDNAI* |
| Ga0099972_111677392 | 3300006467 | Marine | MENTKCIEVRKDYYLLIIDNKSLGEFEKSQLRHIIEVIDNAI* |
| Ga0099972_131835312 | 3300006467 | Marine | MENTKCIAVRKDYYLLIIDDKSLGEFEKSQLRHILEVIDNAI* |
| Ga0098048_10405642 | 3300006752 | Marine | MENTKCIKVRKDFYLLIINDISLGEFERSQLRHILEVIDNAI* |
| Ga0098055_11442823 | 3300006793 | Marine | MKNIRCIKVRKDYYLLFIDDKSLGEFERSQLRNIIEVIDNA |
| Ga0070749_106352772 | 3300006802 | Aqueous | IQVRKDYYLLIVDDKSLGEFERSELRHILEVIDNAI* |
| Ga0075467_105888212 | 3300006803 | Aqueous | MENVRCIKVRKDYYLLFIGDKSLGEFERSQLRNIIEVIDNAI* |
| Ga0070748_10613165 | 3300006920 | Aqueous | MENTKCIKVRKDYYLLFIGDKSLGEFERSQLRNIIEVIDNAI* |
| Ga0070748_10638734 | 3300006920 | Aqueous | MKNVRCIKVRKDYYLLFIDDKSLGEFERSQLRNIIEVIDNAI* |
| Ga0070748_12407522 | 3300006920 | Aqueous | MSIKCIKVRKEYYLLIINDISLGEFEKSDLRHIIEVIDGNI* |
| Ga0070748_13488122 | 3300006920 | Aqueous | MDNTKCIQVRKDYYLLIVNDISLGEFERSELRNIIEVIDNAI* |
| Ga0075444_103633282 | 3300006947 | Marine | LENTKCIAVRKDYYLLIVDDKSLGEFKKSQLKHIIETIDNAI* |
| Ga0075468_100919994 | 3300007229 | Aqueous | KCIQVRKDYYLLIVDDKSLGEFERSELRHILEVIDNAI* |
| Ga0075468_102058162 | 3300007229 | Aqueous | MENTKCIEVRKDYYLLIIDDKSLGEFEKSELRNILEVIDNAI* |
| Ga0075469_101485461 | 3300007231 | Aqueous | KCIAVRKDYYLLIVNDISLGEFEKSELRNIIEVIDNAI* |
| Ga0075469_101972471 | 3300007231 | Aqueous | NKMEKVKCIEVRKDYYLLIINDINLGEFEKSDLRNIIEKIDNAI* |
| Ga0075469_102142902 | 3300007231 | Aqueous | MENTKCIQVRKDYYLLIVDDKSLGEFERSELRNIIEVIDNAI* |
| Ga0070747_11511763 | 3300007276 | Aqueous | MENTKCIAVRKDYYLLIVDDKSLGEFEKSELRNIIEVIDNAI* |
| Ga0070747_13148542 | 3300007276 | Aqueous | MENTKCIQVRKDYYLLIIDDKSLGEFEKSELRNIIEVIDNAI* |
| Ga0099851_10872041 | 3300007538 | Aqueous | MENTKCIAVRKDYYLLIVNDISLGEFERSQLRHILEVIDNAI* |
| Ga0099847_10213932 | 3300007540 | Aqueous | MENTRCIKVRKDYYLLIIKNTSLGEFEKSELRHILEVIDNGI* |
| Ga0099847_11149661 | 3300007540 | Aqueous | MENTKCIEVRKDYYLLIVNDVSLGEFERSDLRHVIEV |
| Ga0099847_12113691 | 3300007540 | Aqueous | MENTKCIEVRKDYYLLIIDDKSLGEFERSELRNIIEVIDNAI* |
| Ga0102818_10086391 | 3300007552 | Estuarine | VRKDYYLLIVNDISLGEFEKSDLRNIIEVIDNAI* |
| Ga0102904_10885281 | 3300007981 | Estuarine | CIAVRKDYYLLIVNDISLGEFEKSDLRNIIQVIDNAI* |
| Ga0102887_10660841 | 3300008961 | Estuarine | MENTKCIQVRKDYYLLIVNDISLGEFERSELRNIIEVIDNAI* |
| Ga0102816_10374712 | 3300008999 | Estuarine | MENTKCIQVRKDYYLLIVNDISLGEFEKSDLRNIIEVIDNAI* |
| Ga0115549_10083642 | 3300009074 | Pelagic Marine | METTKCIEVRKDYYLLIIDDKSLGEFERSQLRHIIETIDNAI* |
| Ga0115549_12523261 | 3300009074 | Pelagic Marine | MENTKCIAVRKDYYLLIVDDKSLGEFERSELRHIIEVIDNAI* |
| Ga0115549_12559151 | 3300009074 | Pelagic Marine | MENTKCIAVRKDYYLLIIDDKSLGEFEKSELRNILEVIDNAI* |
| Ga0115550_12053552 | 3300009076 | Pelagic Marine | MENTKCIQVRKDYYLLIVDDKSLGEFERSELRHIIEVIDNAI* |
| Ga0115550_12931841 | 3300009076 | Pelagic Marine | VRKDYYLLIVDDKSLGEFERSELRHIIEVIDNAI* |
| Ga0114918_102070391 | 3300009149 | Deep Subsurface | MENTKCIEVRKDYYLLIINDKSLGEFEKSQLRHIIEVIDNAI* |
| Ga0114995_1000117213 | 3300009172 | Marine | MENTKCIEVRKDYYLLIIDDKSLGEFEKSQLRHIIEVIDNAL* |
| Ga0114994_109469822 | 3300009420 | Marine | MKNTKCIQVRKDYYLLIVDDKSLGEFEKSQLRHILEVIDNAI* |
| Ga0115548_12322441 | 3300009423 | Pelagic Marine | METTKCIEVRKDYYLLIIDDKSLGEFERSQLRHIIETIDN |
| Ga0115547_11777122 | 3300009426 | Pelagic Marine | MKKTKCIQVRKDYYLLIVDDKSLGEFERSELRNIIEVIDNAI |
| Ga0115547_12801161 | 3300009426 | Pelagic Marine | MENTKCIQVRKDYYLLIIDDKSLGEFERSQLRNILEVIDNAI* |
| Ga0115005_102876211 | 3300009432 | Marine | IEVRKDYYLLIIDDKSLGEFERSQLRHIIETIDNAI* |
| Ga0115008_1000410723 | 3300009436 | Marine | MKNTKCIKTNKDHYILIINDVSVGEFERSELRNIIEVIDNEI* |
| Ga0115008_101301761 | 3300009436 | Marine | MENTKCIAVRKDYYLLIVDDKSLGEFERSELRHILEVIDNAI* |
| Ga0115008_101732825 | 3300009436 | Marine | MENTKCIAVRKDYYLLIVNDKSLGEFERSELRNILEVIDNAI* |
| Ga0115008_113902722 | 3300009436 | Marine | MENTKCIQVRKDYYLLIVNDISLGEFERSELRHILEVIDNAI* |
| Ga0115559_10677681 | 3300009438 | Pelagic Marine | MSIKCIEVRKEHYLLIINDISLGEFEKSDLRHIIEVIDGNI* |
| Ga0115561_12690671 | 3300009440 | Pelagic Marine | MENTKCIQVRKDYYLLIVDDKSLGEFERSELRHILEV |
| Ga0115565_104932092 | 3300009467 | Pelagic Marine | CIQVRKDYYLLIVDDKSLGEFERSELRHILEVIDNAI* |
| Ga0115570_102837881 | 3300009496 | Pelagic Marine | MENTKCIEVRKDYYLLIIDDKSLGEFEKSQLRHIIEIIDNAI* |
| Ga0115564_100933285 | 3300009505 | Pelagic Marine | MENTKCIEVRKDYYLLIIDDKSLGEFEKSQLRHIIEVIDN |
| Ga0115572_101181562 | 3300009507 | Pelagic Marine | MENTKCIQVRKDYYLLIVNDKSLGEFERSELRHILEVIDNAI* |
| Ga0115003_101503832 | 3300009512 | Marine | MENTKCIQVRKDYYLLIVNDISLGEFEKSQLRHILEVIDNAI* |
| Ga0115004_105392531 | 3300009526 | Marine | MENTKCIEVRKDYYLLIIDDKSLGEFERSELRHIIEVIDNAI* |
| Ga0115103_10342552 | 3300009599 | Marine | MENTKCIKVRKEYYLLIINDISLGEFERSQLRHILEVIDNAI* |
| Ga0115102_105653491 | 3300009606 | Marine | TKCIQVRKDYYLLIINDISLGEFERSDLRNIIEVIDNAI* |
| Ga0115102_109439843 | 3300009606 | Marine | MENTKCIKVRKDYYILIVNDISLGEFEKSDLRNIIEVIDNAI* |
| Ga0115001_106688072 | 3300009785 | Marine | MENTKCIEVRKDYYLLIIDDKSLGEFEKSQLRHIIETIDNAI* |
| Ga0136655_11551992 | 3300010316 | Freshwater To Marine Saline Gradient | MENTKCIEVRKDYYLLIVNDISLGEFERSELRNIIEVIDNAI* |
| Ga0118731_1034963312 | 3300010392 | Marine | MENTRCIKVRKDYYLLIVKNVSLGEFEKSELRHILEVIDNAI* |
| Ga0133547_113459382 | 3300010883 | Marine | MESTKCIKVRKDYYLLIIGDKTLGEYERSELRSIIEVIDNAI* |
| Ga0114922_105467771 | 3300011118 | Deep Subsurface | MKNTKCIQVRKDYYLLIVDDKSLGEFEKSELRNIIEVIDNAI* |
| Ga0151654_10836061 | 3300011126 | Marine | MDNTKCIAVRKDYYLLIVNDISLGEFERSELRNIIEVIDNAI* |
| Ga0151657_10777511 | 3300011247 | Marine | LHDALPI*KDYYLLIVKDISLGEFEKSELRHIIETIDNAI* |
| Ga0151671_10023392 | 3300011253 | Marine | MENTKCIAVRKDYYLLIIDDKSLGEFEKSQLRHIIEVIDNAI* |
| Ga0129327_106321742 | 3300013010 | Freshwater To Marine Saline Gradient | IEVRKDYYLLIIDNKSLGEFEKSQLRHIIETIDNAI* |
| Ga0129327_108891682 | 3300013010 | Freshwater To Marine Saline Gradient | MIENTKCIEVRKDYYLLVVNDVSLGEFEKSDLRHII |
| Ga0181369_11252291 | 3300017708 | Marine | KKTQSYYFYFKKTNMENVRCIKVRKDYYLLFIGDKSLGEFERSQLRNIIEVIDNAI |
| Ga0181398_11113942 | 3300017725 | Seawater | MENTKCIAVRKDYYLLIIDDKSLGEFEKSQLRHIIEVIDNAI |
| Ga0181392_10302554 | 3300017749 | Seawater | MENTKCIKVRKDYYLLIIDNKTLGEFERSQLRHILEVIDNAI |
| Ga0187219_10682921 | 3300017751 | Seawater | MENTKCIKVRKDFYLLIINDISLGEFERSQLRHILEVIDNAI |
| Ga0181409_11386962 | 3300017758 | Seawater | MENTKCIKVRKDYYLLIIDDKTLGEFERSQLRHILEVIDNAI |
| Ga0181430_11006213 | 3300017772 | Seawater | MENTKCIQVRKDYYLLFIGDKSLGEFERSQLRNIIEVIDNAI |
| Ga0206125_101993551 | 3300020165 | Seawater | MENVRCIKVRKDYYLLFIGDKSLGEFERSELRHILEVIDNAI |
| Ga0206128_10072057 | 3300020166 | Seawater | MENTKCIAVRKDYYLLIIDDKSLGEFEKSELRNIIEVIDNAI |
| Ga0206128_10318456 | 3300020166 | Seawater | MENTKCIEVRKDYYLLIIDDKSLGEFERSQLRHIIETIDNAI |
| Ga0206128_10336996 | 3300020166 | Seawater | MENTKCIQVRKDYYLLIVDDKSLGEFERSELRHILEVIDNAI |
| Ga0206128_10348479 | 3300020166 | Seawater | METTKCIEVRKDYYLLIIDDKSLGEFERSQLRHIIETIDNAI |
| Ga0206128_10363484 | 3300020166 | Seawater | MENTKCIAVRKDYYLLIIDDKSLGEFEKSELRNILEVIDNAI |
| Ga0206128_10641796 | 3300020166 | Seawater | MENTKCIAVRKDYYLLIVNDISLGEFEKSELRNIIEVIDNAI |
| Ga0206128_10700693 | 3300020166 | Seawater | MESTKCIAVRKDYYLLIIDDKSLGEFERSQLRHIIETIDNAI |
| Ga0206128_10782781 | 3300020166 | Seawater | MENTKCIEVRKDYYLLIIDDKSLGEFERSQLRNILEVIDNAI |
| Ga0206128_10790512 | 3300020166 | Seawater | MEKTKCIQVRKDYYLLIVDDKSLGEFERSELRNIIEVIDNAI |
| Ga0206128_10941224 | 3300020166 | Seawater | MENVKCINVRKDYYLLIVNDISLGEFEKSQLRHIIETIDNAI |
| Ga0206128_11306332 | 3300020166 | Seawater | MSIKCIEVRKEYYLLIINDISLGEFEKSDLRHIIEVIDGNI |
| Ga0206128_13255122 | 3300020166 | Seawater | MENTKCIQVRKDYYLLIVDDISLGEFEKSELRNIIEVIDNAI |
| Ga0206127_101628214 | 3300020169 | Seawater | MENTKCIAVRKDYYLLIIDDKSLGEFERSQLRNILEVIDNAI |
| Ga0206127_10442833 | 3300020169 | Seawater | MENTKCIAVRKDYYLLIIDDKSLGEFEKSELRHILEVIDNAI |
| Ga0206127_10623526 | 3300020169 | Seawater | MENTKCIQVRKDYYLLIIDDKSLGEFERSQLRNILEVIDNAI |
| Ga0206127_10698914 | 3300020169 | Seawater | MENTKCIKVRKDYYLLIIDNKTLGEFERSQLRNIIEVIDNAI |
| Ga0206127_10782203 | 3300020169 | Seawater | MENTKCIAVRKDYYLLIIDDKSLGEFERSELRNIIEVIDNAI |
| Ga0206127_13086712 | 3300020169 | Seawater | MENVRCIKVRKDYYLLFIGDKSLGEFERSQLRNIIEVIDNAI |
| Ga0206129_1000344038 | 3300020182 | Seawater | MENTKCIKVRKDYYLLFINDKSLGEFERSQLRNIIEVIDNAI |
| Ga0206129_100381341 | 3300020182 | Seawater | MSIKCIEVRKEYYLLIINDISLGEFEKSDLRHIIE |
| Ga0206129_102776141 | 3300020182 | Seawater | MENVKCINVRKDYYLLIVNDISLGEFERSQLRHIIETIDNAI |
| Ga0206131_100468047 | 3300020185 | Seawater | MENTKCIEVRKDYYLLIIDDKSLGEFERSQLRNIIEIIDNAI |
| Ga0206131_100783761 | 3300020185 | Seawater | MENTRCIKVRKDYYLLIIKNTSLGEFEKSELRHILEVIDNGI |
| Ga0206131_101433663 | 3300020185 | Seawater | MSIKCIEVRKEYYLLIINDISLGEFEKSDLRHIIEVIDGN |
| Ga0206131_102428332 | 3300020185 | Seawater | MENTKCIAVRKDHYLLIIEDKSLGEFERSQLRHIIETIDNAI |
| Ga0206131_102743361 | 3300020185 | Seawater | MESTKCIAVRKDYYLLIIDDKSLGEFEKSELRNILEVID |
| Ga0206130_100410521 | 3300020187 | Seawater | MENTKCIQVRKDYYLLIVNDISLGEFEKSELRNIIEVIDNAI |
| Ga0206130_102925462 | 3300020187 | Seawater | MENTKCIAVRKDYYLLIIDDKSLGEFERSELRHILEVIDNAI |
| Ga0206130_103507442 | 3300020187 | Seawater | RCIKVRKDYYLLIIKNTSLGEFEKSELRHILEVIDNGI |
| Ga0211688_10778702 | 3300020317 | Marine | MENTKCIAVRKDFYLLIIDNKSLGEFEKSQLRYIIETIDNAI |
| Ga0206677_101056843 | 3300021085 | Seawater | MENIKCIAVRKDYYLLIINDISLGEFERSELRNIIEVIDNAI |
| Ga0206682_1000092249 | 3300021185 | Seawater | MENTKCIAVRKDYYLLIVNDISLGEFERSELRNIIEVIDNAI |
| Ga0206682_100011217 | 3300021185 | Seawater | MENTKCIEVRKDYYLLIIDDKSLGEFEKSQLRHIIEVIDNAI |
| Ga0206682_100376986 | 3300021185 | Seawater | MENTKCIAVRKDYYLLIVNDISLGEFERSDLRNIIEVIDNAI |
| Ga0206682_101049234 | 3300021185 | Seawater | MENTKCIEVRKDYYLLIIDDKSLGEFEKSQLRHIIEIIDNAI |
| Ga0206682_102938632 | 3300021185 | Seawater | MENIKCIKVRKDYYLLIINDISLGEFERSELRNIIEVIDNAI |
| Ga0206692_14749171 | 3300021350 | Seawater | INFIFRKKMENTKCIAVRKDYYLLIVNDISLGEFERSELRNIIEVIDNAI |
| Ga0213863_100071268 | 3300021371 | Seawater | MENVKCIKVRKDYYLLFIGDKSLGEFERSQLRHIIEVIDNAI |
| Ga0213861_100942692 | 3300021378 | Seawater | MENTKCIQVRKDYYLLIVNDKSLGEFERSQLRHIIETIDNAI |
| Ga0213861_103719671 | 3300021378 | Seawater | KCIQVRKDYYLLIVDDKSLGEFERSELRHILEVIDNAI |
| Ga0213868_100301238 | 3300021389 | Seawater | MENTKCIAVRKDYYLLIIDDKSLGEFEKSQLRHILEVIDNAI |
| Ga0222716_101765751 | 3300021959 | Estuarine Water | MDNTKCIQVRKDYYLLIVNDISLGEFERSELRNIIEVIDNAI |
| Ga0212030_10001118 | 3300022053 | Aqueous | MENTKCIKVRKDYYLLVIGDKSLGEFERSELRNIIEVIDNAI |
| Ga0212030_10010802 | 3300022053 | Aqueous | MENTKCIQVRKDYYLLIVDDKSLGEFERSELRHILETIDNAI |
| Ga0212030_10205971 | 3300022053 | Aqueous | MENTKCIAVRKDYYLLIVNDISLGEFERSQLRHILEVIDNAI |
| Ga0212030_10400442 | 3300022053 | Aqueous | IEVRKDYYLLIIDDKSLGEFERSQLRHIIETIDNAI |
| Ga0212023_10065371 | 3300022061 | Aqueous | MENTKCIAVRKDYYLLIVNDKSLGEFERSELRHILEVIDNAI |
| Ga0196889_10395674 | 3300022072 | Aqueous | NTKCIQVRKDYYLLIVDDKSLGEFERSELRHILEVIDNAI |
| Ga0196889_11012771 | 3300022072 | Aqueous | CIQVRKDYYLLIVDDKSLGEFERSELRHILEVIDNAI |
| Ga0212022_10225174 | 3300022164 | Aqueous | MENTKCIAVRKDYYLLIVDDKSLGEFERSQLRHIIETIDNAI |
| Ga0196903_10038964 | 3300022169 | Aqueous | MENTKCIQVRKDYYLLIVNDKSLGEFERSQLRHILEVIDNAI |
| Ga0196903_10257431 | 3300022169 | Aqueous | TKCIEVRKDYYLLIIDDKSLGEFERSQLRHIIETIDNAI |
| Ga0196903_10388522 | 3300022169 | Aqueous | MENTKCIQVRKDYYLLIVDDKSLGEFERSELRHILE |
| Ga0196887_10139891 | 3300022178 | Aqueous | MEKVKCIEVRKDYYLLIINDINLGEFEKSDLRNIIEKIDNAI |
| Ga0196887_10224762 | 3300022178 | Aqueous | MENTKCIQVRKDYYLLIVNDISLGEFERSELRNIIEVIDNAI |
| Ga0196887_10989942 | 3300022178 | Aqueous | MENTKCMAVRKDYYLLIVNDISLGEFEKSELRNIIEVIDNAI |
| Ga0196901_11780311 | 3300022200 | Aqueous | MENTKCIAVRKDYYLLIVNDISLGEFERSELRHILEVIDNAI |
| Ga0224513_102043861 | 3300022220 | Sediment | MENTKCIQVRKDYYLLIVNDISLGEFERSDLRNIIEV |
| Ga0222652_10395862 | 3300022853 | Saline Water | MENTKCIQVRKDYYLLIIDNKSLGEFEKSQLRHIIETIDNAI |
| Ga0222653_10239502 | 3300022857 | Saline Water | MENTKCIQVRKDYYLLIIDNKSLGEFEKSQLRSIIETIDNAI |
| Ga0222653_10244952 | 3300022857 | Saline Water | MENTKCIAVRKDYYLLIIDNKSLGEFEKSELRNIIEVIDNAI |
| Ga0222653_10587901 | 3300022857 | Saline Water | MENTKCIAVRKDYYLLIIDNKSLGEFEKSQLRHIIET |
| (restricted) Ga0233411_100375211 | 3300023112 | Seawater | MSIKCIEVRKEHYLLIINDISLGEFEKSDLRHIIEVIDGNI |
| (restricted) Ga0233412_100265832 | 3300023210 | Seawater | MENTKCIQVRKDYYLLIVNDISLGEFEKSQLRHILEVIDNVI |
| (restricted) Ga0233412_101103102 | 3300023210 | Seawater | MENTKCIQVRKDYYLLIIDDKSLGEFEKSQLRHILEVIDNAI |
| (restricted) Ga0233412_105986272 | 3300023210 | Seawater | MENTKCIAVRKDYYLLIIDDKSLGEFERSQLRHIIETIDNAI |
| Ga0222661_10517472 | 3300023229 | Saline Water | MENTKCIAVRKDYYLLIIDDKSLGEFEKSQLRHIIETIDNAI |
| (restricted) Ga0233410_100380315 | 3300023276 | Seawater | KMSIKCIEVRKEHYLLIINDISLGEFEKSDLRHIIEVIDGNI |
| (restricted) Ga0233410_103087191 | 3300023276 | Seawater | MENTKCIEVRKDYYLLIIDDKSLGEFEKSELRNIIEVIDNAI |
| (restricted) Ga0255040_103894041 | 3300024059 | Seawater | MENTKCIEVRKDYYLLIVNDISLGEFERSDLRNIIEVIDNAI |
| Ga0210003_10763232 | 3300024262 | Deep Subsurface | MKNTKCIQVRKDYYLLIVNDKSLGEFERSQLRNIIEVIDNAI |
| Ga0210003_11273081 | 3300024262 | Deep Subsurface | MKNTKCIQVRKDYYLLIVDDKSLGEFERSQLRNIIEVIDNAI |
| (restricted) Ga0255042_103432881 | 3300024340 | Seawater | MENTKCIQVRKDYYLLIINDISLGEFERSELRNIIEVIDNAI |
| Ga0244775_115255011 | 3300024346 | Estuarine | MENTKCIQVRKDYYLLIVNDISLGEFEKSDLRNIIEVIDNAI |
| Ga0244776_103686143 | 3300024348 | Estuarine | MENTKCIAVRKDYYLLIVNDISLGEFEKSDLRNIIEVIDNAI |
| (restricted) Ga0255048_100393962 | 3300024518 | Seawater | MFKKLKQKKMSIKCIEVRKEHYLLIINDISLGEFEKSDLRHIIEVIDGNI |
| (restricted) Ga0255048_100936045 | 3300024518 | Seawater | MENTKCIQVRKDYYLLIINDISLGEFEKSQLRHILEVIDNAI |
| (restricted) Ga0255048_104212592 | 3300024518 | Seawater | MENTKCIAVRKDYYLLIVNDISLGEFERSELRNIIEVID |
| (restricted) Ga0255046_101588082 | 3300024519 | Seawater | MENTKCIQVRKDYYLLIVEDKSLGEFEKSQLRHILEVIDNAI |
| Ga0209634_10073845 | 3300025138 | Marine | MENTKCIKVRKDYYLLIVNDISLGEFERSELRNIIEVIDNAI |
| Ga0208303_10118775 | 3300025543 | Aqueous | MENTKCIQVRKDYYLLIVDDKSLGEFEKSELRNIIEVIDNAI |
| Ga0208303_10280506 | 3300025543 | Aqueous | MENTKCIEVRKDYYLLIVNDISLGEFERSELRNIIEVIDNAI |
| Ga0208303_10283172 | 3300025543 | Aqueous | MENTKCIAVRKDYYLLIIDNKSLGEFEKSQLRHIIETIDNAI |
| Ga0208303_10516344 | 3300025543 | Aqueous | MENTKCIEVRKDYYLLIIDDKSLGEFERSELRNIIEVIDNAI |
| Ga0208303_11166071 | 3300025543 | Aqueous | MENTKCIEVRKDYYLLIVNDVSLGEFERSDLRHVIEVI |
| Ga0208660_11153181 | 3300025570 | Aqueous | NKMEKVKCIEVRKDYYLLIINDINLGEFEKSDLRNIIEKIDNAI |
| Ga0209304_10118834 | 3300025577 | Pelagic Marine | MENTRCIEVRKDYYLLIIDDKSLGEFERSQLRHIIETIDNAI |
| Ga0209304_10788911 | 3300025577 | Pelagic Marine | MENTKCIAVRKDYYLLIVDDKSLGEFERSELRHIIEVIDNAI |
| Ga0209304_11126492 | 3300025577 | Pelagic Marine | MENTKCIKVRKDYYLLVIDDKSLGEFERSELRNIIEVIDNAI |
| Ga0209195_10213476 | 3300025590 | Pelagic Marine | MENTKCIQVRKDYYLLIVDDKSLGEFERSELRHILEVID |
| Ga0209833_10126553 | 3300025641 | Pelagic Marine | MESTKCIAVRKDYYLLIIDDKSLGEFERSQLRYIIETIDNAI |
| Ga0208643_11059641 | 3300025645 | Aqueous | KTNMENVRCIKVRKDYYLLFIGDKSLGEFERSQLRNIIEVIDNAI |
| Ga0208643_11495872 | 3300025645 | Aqueous | CIAVRKDYYLLIVNDISLGEFEKSELRNIIEVIDNAI |
| Ga0208643_11547482 | 3300025645 | Aqueous | FEVIKNCKVINFIFRKKMENTKCIKVRKDYYLLFIGDKSLGEFERSQLRNIIEVIDNAI |
| Ga0208134_10466496 | 3300025652 | Aqueous | MENTKCIEVRKDYYLLIVDDKSLGEFERSELRHILEVIDNAI |
| Ga0208795_11444502 | 3300025655 | Aqueous | KMENTKCIEVRKDYYLLIIDDKSLGEFERSQLRHIIETIDNAI |
| Ga0209119_12469681 | 3300025860 | Pelagic Marine | MIENTKCIEVRKDYYLLVVNDVSLGEFEKSDLRHIIEVID |
| Ga0208950_10082078 | 3300027413 | Marine | MENTKCIQVRKDYYLLIVNDISLGEFERSDLRNIIEVIDNAI |
| Ga0209192_100076651 | 3300027752 | Marine | NMENTKCIEVRKDYYLLIIDDKSLGEFEKSQLRHIIEVIDNAI |
| Ga0209192_100841954 | 3300027752 | Marine | MENTKCIEVRKDYYLLIIDDKSLGEFEKSQLRHIIEVIDNAL |
| Ga0209502_104008421 | 3300027780 | Marine | MENTKCIEVRKDYYLLIIDDKSLGEFERSELRHIIEVIDNAI |
| Ga0209711_101678662 | 3300027788 | Marine | MENTKCIQVRKDYYLLIVNDISLGEFEKSQLRHILEVIDNAI |
| Ga0209830_102920753 | 3300027791 | Marine | NTKCIQVRKDYYLLIVNDISLGEFEKSQLRHILEVIDNAI |
| Ga0209092_1000109630 | 3300027833 | Marine | MENTKCIAVRKDYYLLIVNDKSLGEFERSELRNILEVIDNAI |
| Ga0209092_1001278619 | 3300027833 | Marine | MENTKCIAVRKDYYLLIVDDKSLGEFERSELRHILEVIDNAI |
| Ga0209092_100458122 | 3300027833 | Marine | MENTKCIQVRKDYYLLIVNDISLGEFERSELRHILEVIDNAI |
| Ga0209712_103660341 | 3300027849 | Marine | MENTKCIAVRKDYYLLIVNDISLGEFERSELRNIIEVI |
| Ga0209013_102753052 | 3300027858 | Marine | MENVRCIKVRKDYYLLFIGDKSLGEFERSQLRNIIEIIDNAI |
| (restricted) Ga0233415_105479412 | 3300027861 | Seawater | TKCIAVRKDYYLLIVNDISLGEFERSELRNIIEVIDNAI |
| Ga0209165_103188322 | 3300027978 | Marine Sediment | MENTKCIAVRKDYYLLIVNDISLGEFEKSQLRNILEVIDNAI |
| (restricted) Ga0233414_104098861 | 3300028045 | Seawater | NTKCIQVRKDYYLLIVNDISLGEFERSELRNIIEVIDNAI |
| Ga0256368_10161622 | 3300028125 | Sea-Ice Brine | MENTKCIQVRKDYYLLIVDDKSLGEFEKSQLRHILEVIDNAI |
| Ga0256368_10870101 | 3300028125 | Sea-Ice Brine | MENTKCIAVRKDYYLLIIEDKSLGEFERSQLRHILEVID |
| Ga0308023_100007742 | 3300031167 | Marine | MKSTRCIKTNKDHYILIINDVSVGVLERSELRNLIKIIDNEI |
| Ga0307928_104104782 | 3300031227 | Saline Water | MENTKCIAARKDYYLLIIDDKSLGEFEKSELRNIIEVIDNAI |
| Ga0307488_107434932 | 3300031519 | Sackhole Brine | MENTKCIAVRKDYYLLIIEDKSLGEFERSQLRHILEV |
| Ga0307380_100061559 | 3300031539 | Soil | MENTKCIEVRKDYYLLIVNDVLLGEFEKSDLRHVIQVIDNAI |
| Ga0307379_103976222 | 3300031565 | Soil | MENVKCINIRKDYYLLIVNDISLGEFERSQLRHIIETIDNAI |
| Ga0307379_113300301 | 3300031565 | Soil | MENTKCIEVRKDYYLLIIDDKSLGEFEKSQLRHIIEVIDNAV |
| Ga0307984_10551473 | 3300031658 | Marine | MENTKCIAVRKDFYLLIIDNKSLGEFEKSQLRHIIETIDNVI |
| Ga0307984_10600242 | 3300031658 | Marine | MENTKCIAVRKDYYLLIIDNKSLGEFERSQLRHIIETIDNAI |
| Ga0307377_102503842 | 3300031673 | Soil | MENVKCINVRKDYYLLIVDDKSLGEFERSQLRNIIEVIDNAI |
| Ga0307377_107960161 | 3300031673 | Soil | MKNTKCIQVRKDYYLLIVDDKSLGEFERSQLRNII |
| Ga0315320_102483773 | 3300031851 | Seawater | MENTKCIEVRKDYYLLIIDDKSLGEFEKSQLRHIIETIDNAI |
| Ga0314858_113514_192_320 | 3300033742 | Sea-Ice Brine | MENTKCIKVRKDYYLLVIGDKTLGEYERSELRSIIEKIDNAI |
| Ga0314858_126007_33_161 | 3300033742 | Sea-Ice Brine | MESTKCIKVRKDYYLLIIGDKTLGEYERSELRSIIEVIDNAI |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |