Basic Information | |
---|---|
Family ID | F018483 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 235 |
Average Sequence Length | 46 residues |
Representative Sequence | MMCQAVEAYIYSKKGVAVKINRIAIISDARQMEMLAYAYAYANGDR |
Number of Associated Samples | 163 |
Number of Associated Scaffolds | 234 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 80.43 % |
% of genes near scaffold ends (potentially truncated) | 25.53 % |
% of genes from short scaffolds (< 2000 bps) | 83.40 % |
Associated GOLD sequencing projects | 134 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (60.851 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.979 % of family members) |
Environment Ontology (ENVO) | Unclassified (61.702 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.532 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 69.57% β-sheet: 0.00% Coil/Unstructured: 30.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 234 Family Scaffolds |
---|---|---|
PF04466 | Terminase_3 | 41.45 |
PF16677 | GP3_package | 26.07 |
PF11325 | DUF3127 | 2.14 |
PF13673 | Acetyltransf_10 | 1.71 |
PF04404 | ERF | 0.85 |
PF14550 | Peptidase_S78_2 | 0.43 |
PF13539 | Peptidase_M15_4 | 0.43 |
PF00583 | Acetyltransf_1 | 0.43 |
PF03382 | DUF285 | 0.43 |
PF12851 | Tet_JBP | 0.43 |
PF02195 | ParBc | 0.43 |
PF13508 | Acetyltransf_7 | 0.43 |
COG ID | Name | Functional Category | % Frequency in 234 Family Scaffolds |
---|---|---|---|
COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 41.45 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.15 % |
Unclassified | root | N/A | 0.85 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000124|BS_KBA_SWE12_21mDRAFT_c10003307 | Not Available | 5709 | Open in IMG/M |
3300000241|BS_KBA_SWE21_205mDRAFT_10012687 | All Organisms → Viruses → Predicted Viral | 2419 | Open in IMG/M |
3300000756|JGI12421J11937_10119098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 692 | Open in IMG/M |
3300001371|BBDRAFT_10277151 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 611 | Open in IMG/M |
3300002397|B570J29612_1001660 | All Organisms → Viruses → Predicted Viral | 2223 | Open in IMG/M |
3300002447|JGI24768J34885_10316472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 523 | Open in IMG/M |
3300002835|B570J40625_100073884 | All Organisms → Viruses → Predicted Viral | 4487 | Open in IMG/M |
3300003277|JGI25908J49247_10026606 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
3300003277|JGI25908J49247_10055286 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
3300003277|JGI25908J49247_10158893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300003388|JGI25910J50241_10093329 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300003393|JGI25909J50240_1101365 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 571 | Open in IMG/M |
3300003394|JGI25907J50239_1034283 | All Organisms → Viruses → Predicted Viral | 1076 | Open in IMG/M |
3300003404|JGI25920J50251_10020583 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
3300003404|JGI25920J50251_10112251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300003490|JGI25926J51410_1027434 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
3300003493|JGI25923J51411_1002097 | All Organisms → Viruses → Predicted Viral | 4234 | Open in IMG/M |
3300003493|JGI25923J51411_1052485 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 732 | Open in IMG/M |
3300003497|JGI25925J51416_10026254 | All Organisms → Viruses → Predicted Viral | 1694 | Open in IMG/M |
3300003497|JGI25925J51416_10133890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300004767|Ga0007750_1279234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300004790|Ga0007758_11277590 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300004792|Ga0007761_11265374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 650 | Open in IMG/M |
3300004793|Ga0007760_11458358 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300005517|Ga0070374_10591971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 551 | Open in IMG/M |
3300005580|Ga0049083_10078997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1149 | Open in IMG/M |
3300005581|Ga0049081_10018415 | All Organisms → cellular organisms → Bacteria | 2648 | Open in IMG/M |
3300005581|Ga0049081_10187247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
3300005581|Ga0049081_10228457 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 659 | Open in IMG/M |
3300005581|Ga0049081_10286452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300005581|Ga0049081_10338128 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 512 | Open in IMG/M |
3300005582|Ga0049080_10281456 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 538 | Open in IMG/M |
3300005583|Ga0049085_10062414 | All Organisms → Viruses → Predicted Viral | 1323 | Open in IMG/M |
3300005584|Ga0049082_10189264 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 706 | Open in IMG/M |
3300005584|Ga0049082_10288421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300005585|Ga0049084_10278082 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 558 | Open in IMG/M |
3300005832|Ga0074469_11161459 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 751 | Open in IMG/M |
3300005940|Ga0073913_10083372 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 541 | Open in IMG/M |
3300005943|Ga0073926_10048999 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 815 | Open in IMG/M |
3300005955|Ga0073922_1005294 | All Organisms → Viruses → Predicted Viral | 1472 | Open in IMG/M |
3300005992|Ga0073924_1037409 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 694 | Open in IMG/M |
3300006014|Ga0073919_1007602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
3300006484|Ga0070744_10251012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300006805|Ga0075464_10820144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300006920|Ga0070748_1096557 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1129 | Open in IMG/M |
3300006920|Ga0070748_1320834 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 549 | Open in IMG/M |
3300007540|Ga0099847_1001522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8111 | Open in IMG/M |
3300007543|Ga0102853_1052938 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 714 | Open in IMG/M |
3300007544|Ga0102861_1144842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300007545|Ga0102873_1181476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300007551|Ga0102881_1163802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 615 | Open in IMG/M |
3300007559|Ga0102828_1042025 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1048 | Open in IMG/M |
3300007622|Ga0102863_1110222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
3300007627|Ga0102869_1141254 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 651 | Open in IMG/M |
3300007636|Ga0102856_1025151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
3300007636|Ga0102856_1070795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 568 | Open in IMG/M |
3300007658|Ga0102898_1148964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 549 | Open in IMG/M |
3300007716|Ga0102867_1124080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 694 | Open in IMG/M |
3300007972|Ga0105745_1148498 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 717 | Open in IMG/M |
3300007974|Ga0105747_1089680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
3300008055|Ga0108970_11434971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 795 | Open in IMG/M |
3300008122|Ga0114359_1087343 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1105 | Open in IMG/M |
3300008259|Ga0114841_1053773 | All Organisms → Viruses → Predicted Viral | 1943 | Open in IMG/M |
3300008259|Ga0114841_1147564 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 937 | Open in IMG/M |
3300008259|Ga0114841_1214301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300008259|Ga0114841_1228004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300008267|Ga0114364_1071773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1163 | Open in IMG/M |
3300008267|Ga0114364_1113339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 820 | Open in IMG/M |
3300008450|Ga0114880_1122489 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 975 | Open in IMG/M |
3300008450|Ga0114880_1167707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 772 | Open in IMG/M |
3300008450|Ga0114880_1233917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300008450|Ga0114880_1259313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300008996|Ga0102831_1006904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4146 | Open in IMG/M |
3300008996|Ga0102831_1021316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2217 | Open in IMG/M |
3300008999|Ga0102816_1128245 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 782 | Open in IMG/M |
3300009026|Ga0102829_1128010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
3300009026|Ga0102829_1147626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 751 | Open in IMG/M |
3300009056|Ga0102860_1079377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
3300009059|Ga0102830_1012173 | All Organisms → Viruses → Predicted Viral | 2765 | Open in IMG/M |
3300009068|Ga0114973_10567733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 584 | Open in IMG/M |
3300009071|Ga0115566_10480771 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 706 | Open in IMG/M |
3300009079|Ga0102814_10781652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 527 | Open in IMG/M |
3300009085|Ga0105103_10447874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300009086|Ga0102812_10400676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
3300009158|Ga0114977_10427178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
3300009158|Ga0114977_10478332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
3300009159|Ga0114978_10090144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2037 | Open in IMG/M |
3300009159|Ga0114978_10109843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1812 | Open in IMG/M |
3300009161|Ga0114966_10051940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2908 | Open in IMG/M |
3300009161|Ga0114966_10537248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300009163|Ga0114970_10030770 | All Organisms → cellular organisms → Bacteria | 3571 | Open in IMG/M |
3300009163|Ga0114970_10070204 | All Organisms → Viruses → Predicted Viral | 2217 | Open in IMG/M |
3300009163|Ga0114970_10319932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 879 | Open in IMG/M |
3300009163|Ga0114970_10319933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 879 | Open in IMG/M |
3300009180|Ga0114979_10112676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1677 | Open in IMG/M |
3300009180|Ga0114979_10202027 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1203 | Open in IMG/M |
3300009180|Ga0114979_10304506 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 946 | Open in IMG/M |
3300009180|Ga0114979_10801030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300009181|Ga0114969_10200535 | All Organisms → Viruses → Predicted Viral | 1225 | Open in IMG/M |
3300009181|Ga0114969_10670866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300009181|Ga0114969_10768929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300009183|Ga0114974_10435046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300009185|Ga0114971_10185576 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
3300009797|Ga0105080_1055456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 513 | Open in IMG/M |
3300009807|Ga0105061_1016273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
3300009810|Ga0105088_1093141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300009821|Ga0105064_1097178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 600 | Open in IMG/M |
3300010160|Ga0114967_10172559 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
3300010160|Ga0114967_10436387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300010160|Ga0114967_10589308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300010160|Ga0114967_10592452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300011335|Ga0153698_1026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 60109 | Open in IMG/M |
3300011335|Ga0153698_1026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 60109 | Open in IMG/M |
3300011995|Ga0153800_1017941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 717 | Open in IMG/M |
3300012013|Ga0153805_1020572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
3300012013|Ga0153805_1064170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300012282|Ga0157136_1000337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3851 | Open in IMG/M |
3300015050|Ga0181338_1020403 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1040 | Open in IMG/M |
3300017699|Ga0181345_103311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 634 | Open in IMG/M |
3300017701|Ga0181364_1070891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 533 | Open in IMG/M |
3300017701|Ga0181364_1074657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300017722|Ga0181347_1145810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300017723|Ga0181362_1079521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
3300017736|Ga0181365_1010348 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2324 | Open in IMG/M |
3300017747|Ga0181352_1085901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 875 | Open in IMG/M |
3300017774|Ga0181358_1290359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 501 | Open in IMG/M |
3300017778|Ga0181349_1133765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
3300017778|Ga0181349_1195590 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 701 | Open in IMG/M |
3300017778|Ga0181349_1271963 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 558 | Open in IMG/M |
3300017780|Ga0181346_1105358 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300017784|Ga0181348_1123877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 990 | Open in IMG/M |
3300017784|Ga0181348_1257655 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Larkinella → Larkinella terrae | 601 | Open in IMG/M |
3300019784|Ga0181359_1069630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1334 | Open in IMG/M |
3300019784|Ga0181359_1079282 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
3300019784|Ga0181359_1119985 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300019784|Ga0181359_1259918 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 521 | Open in IMG/M |
3300020141|Ga0211732_1345826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
3300020151|Ga0211736_10306396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1189 | Open in IMG/M |
3300020151|Ga0211736_10313694 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
3300020161|Ga0211726_10620453 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 789 | Open in IMG/M |
3300020162|Ga0211735_10611009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1281 | Open in IMG/M |
3300020162|Ga0211735_11050880 | All Organisms → Viruses → Predicted Viral | 1781 | Open in IMG/M |
3300020172|Ga0211729_11154439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300020205|Ga0211731_10040184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
3300020205|Ga0211731_10207145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300020492|Ga0208483_1021136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 735 | Open in IMG/M |
3300020501|Ga0208590_1038460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 508 | Open in IMG/M |
3300020503|Ga0208363_1001158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5884 | Open in IMG/M |
3300020560|Ga0208852_1043463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
3300020560|Ga0208852_1048676 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 710 | Open in IMG/M |
3300020564|Ga0208719_1087936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300022041|Ga0196881_10231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300022407|Ga0181351_1247240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 558 | Open in IMG/M |
3300023184|Ga0214919_10085648 | All Organisms → Viruses → Predicted Viral | 2758 | Open in IMG/M |
3300023184|Ga0214919_10561578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
3300024346|Ga0244775_10146311 | All Organisms → Viruses → Predicted Viral | 1995 | Open in IMG/M |
3300024346|Ga0244775_10524033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 966 | Open in IMG/M |
3300024491|Ga0255203_1043416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300025543|Ga0208303_1042393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1146 | Open in IMG/M |
3300025645|Ga0208643_1116615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300025896|Ga0208916_10555447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300026837|Ga0209856_1004788 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 624 | Open in IMG/M |
3300026838|Ga0209872_1010205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 577 | Open in IMG/M |
3300026856|Ga0209852_1007745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 636 | Open in IMG/M |
3300026931|Ga0209850_1022057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300027193|Ga0208800_1062146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300027224|Ga0208164_1002126 | All Organisms → Viruses → Predicted Viral | 3932 | Open in IMG/M |
3300027393|Ga0209867_1000662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5776 | Open in IMG/M |
3300027418|Ga0208022_1031967 | All Organisms → Viruses → Predicted Viral | 1205 | Open in IMG/M |
3300027563|Ga0209552_1071659 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 955 | Open in IMG/M |
3300027586|Ga0208966_1196444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 516 | Open in IMG/M |
3300027608|Ga0208974_1009298 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3233 | Open in IMG/M |
3300027608|Ga0208974_1052768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1164 | Open in IMG/M |
3300027621|Ga0208951_1089621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
3300027627|Ga0208942_1147977 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 635 | Open in IMG/M |
3300027631|Ga0208133_1021051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1684 | Open in IMG/M |
3300027649|Ga0208960_1053116 | All Organisms → Viruses → Predicted Viral | 1281 | Open in IMG/M |
3300027659|Ga0208975_1046862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1338 | Open in IMG/M |
3300027659|Ga0208975_1181235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300027659|Ga0208975_1199016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300027679|Ga0209769_1156375 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 720 | Open in IMG/M |
3300027679|Ga0209769_1168321 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 688 | Open in IMG/M |
3300027688|Ga0209553_1061835 | All Organisms → Viruses → Predicted Viral | 1436 | Open in IMG/M |
3300027707|Ga0209443_1013190 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3890 | Open in IMG/M |
3300027707|Ga0209443_1250593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300027733|Ga0209297_1017024 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3490 | Open in IMG/M |
3300027734|Ga0209087_1002170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11123 | Open in IMG/M |
3300027734|Ga0209087_1012205 | All Organisms → Viruses → Predicted Viral | 4360 | Open in IMG/M |
3300027736|Ga0209190_1006411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7425 | Open in IMG/M |
3300027736|Ga0209190_1019527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3826 | Open in IMG/M |
3300027736|Ga0209190_1180639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 887 | Open in IMG/M |
3300027759|Ga0209296_1019461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3887 | Open in IMG/M |
3300027759|Ga0209296_1078352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1635 | Open in IMG/M |
3300027759|Ga0209296_1142344 | All Organisms → Viruses → Predicted Viral | 1088 | Open in IMG/M |
3300027770|Ga0209086_10008211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7226 | Open in IMG/M |
3300027785|Ga0209246_10017131 | Not Available | 2703 | Open in IMG/M |
3300027797|Ga0209107_10030656 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3085 | Open in IMG/M |
3300027797|Ga0209107_10304954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 748 | Open in IMG/M |
3300027798|Ga0209353_10072616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1565 | Open in IMG/M |
3300027798|Ga0209353_10225962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 812 | Open in IMG/M |
3300027798|Ga0209353_10246624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
3300027798|Ga0209353_10299186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300027798|Ga0209353_10373811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300027808|Ga0209354_10012758 | All Organisms → Viruses → Predicted Viral | 3355 | Open in IMG/M |
3300027808|Ga0209354_10045817 | All Organisms → Viruses → Predicted Viral | 1759 | Open in IMG/M |
3300027808|Ga0209354_10369042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300027836|Ga0209230_10203212 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
3300027870|Ga0209023_10646127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300027940|Ga0209893_1005905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
3300027940|Ga0209893_1013105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300027971|Ga0209401_1004452 | All Organisms → cellular organisms → Bacteria | 8653 | Open in IMG/M |
3300027971|Ga0209401_1207224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300028394|Ga0304730_1131426 | All Organisms → Viruses → Predicted Viral | 1034 | Open in IMG/M |
3300031539|Ga0307380_10883271 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 727 | Open in IMG/M |
3300031707|Ga0315291_11320112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300031746|Ga0315293_10738981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
3300031746|Ga0315293_11182076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300031746|Ga0315293_11297348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 500 | Open in IMG/M |
3300031772|Ga0315288_11559152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300031857|Ga0315909_10208866 | All Organisms → Viruses → Predicted Viral | 1538 | Open in IMG/M |
3300031885|Ga0315285_10983701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 507 | Open in IMG/M |
3300031952|Ga0315294_11564299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 512 | Open in IMG/M |
3300031997|Ga0315278_11625508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 617 | Open in IMG/M |
3300032053|Ga0315284_10290866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2062 | Open in IMG/M |
3300032164|Ga0315283_11701265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 638 | Open in IMG/M |
3300032173|Ga0315268_12059624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300032177|Ga0315276_11465189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300032275|Ga0315270_10857668 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 599 | Open in IMG/M |
3300032516|Ga0315273_11017264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1059 | Open in IMG/M |
3300033995|Ga0335003_0008481 | All Organisms → cellular organisms → Bacteria | 5305 | Open in IMG/M |
3300033995|Ga0335003_0148520 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1168 | Open in IMG/M |
3300034063|Ga0335000_0001541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19646 | Open in IMG/M |
3300034082|Ga0335020_0084797 | All Organisms → Viruses → Predicted Viral | 1625 | Open in IMG/M |
3300034105|Ga0335035_0156830 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1430 | Open in IMG/M |
3300034284|Ga0335013_0473575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.98% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.74% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 9.79% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 8.51% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.96% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.68% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 4.68% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.40% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.40% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.98% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.98% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.13% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.70% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.70% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.28% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.28% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.85% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.85% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.85% |
Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.85% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.43% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.43% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.43% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.43% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.43% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.43% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.43% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
3300000241 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5m | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300001371 | Baker-B-sed | Environmental | Open in IMG/M |
3300002397 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns | Environmental | Open in IMG/M |
3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300004767 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
3300005992 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 | Environmental | Open in IMG/M |
3300006014 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009797 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 | Environmental | Open in IMG/M |
3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012282 | Freshwater microbial communities from Central Basin Methane Hotpot in Lake Erie, Ontario, Canada - Station 1365 - Bottom - Depth 20.5m | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017699 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020492 | Freshwater microbial communities from Lake Mendota, WI - 01JUN2011 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020501 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020503 | Freshwater microbial communities from Lake Mendota, WI - 03MAY2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020564 | Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300022041 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N (v2) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024491 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026837 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300026838 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_2-Sept-14 (SPAdes) | Environmental | Open in IMG/M |
3300026856 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300026931 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes) | Environmental | Open in IMG/M |
3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
3300027224 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 (SPAdes) | Environmental | Open in IMG/M |
3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
3300027940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
BS_KBA_SWE12_21mDRAFT_100033072 | 3300000124 | Marine | MMCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR* |
BS_KBA_SWE21_205mDRAFT_100126874 | 3300000241 | Marine | YIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR* |
JGI12421J11937_101190982 | 3300000756 | Freshwater And Sediment | MMCQAVEAYIYSKKGVVVKIDRIAIISNARQMEMLVYAYAYANGDR* |
BBDRAFT_102771512 | 3300001371 | Marine Estuarine | MMCQAVEAYIYSKKGVVVKINRIAIISDARQMEMLAYAYAYANGDR* |
B570J29612_10016602 | 3300002397 | Freshwater | MMCQAVEAYIYSKKGVAIKINRIAIISDARQMEMXAYAYAYANGDR* |
JGI24768J34885_103164722 | 3300002447 | Freshwater And Sediment | MMCLAVEAYIYSKKGVVVKINRIAIISNARQMEMLVYAYAYANGDR* |
B570J40625_1000738844 | 3300002835 | Freshwater | MMCQAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYANGDR* |
JGI25908J49247_100266063 | 3300003277 | Freshwater Lake | MQRIEMMCQAVEAYIYSKKGVVIKINRVAIISNARQMEMLVYAYSFTNADR* |
JGI25908J49247_100552862 | 3300003277 | Freshwater Lake | MMCQAVEAYIYSKKGVAIKINRIAIISNARQMEMLAYAYAYANGDR* |
JGI25908J49247_101588932 | 3300003277 | Freshwater Lake | MMCQAVEAYIYSKKGVVVKINRVAIISDARQMEMLAYAYAYANGDR* |
JGI25910J50241_100933293 | 3300003388 | Freshwater Lake | MMCLAVEAYIYSKKGVVVKINRIAIISDSRQMEMLAYAYAYANGDR* |
JGI25909J50240_11013652 | 3300003393 | Freshwater Lake | MMXQAVEAYIYSKKGVVVKINRLAIISNXRQMEMXAYAYAYANGDR* |
JGI25907J50239_10342832 | 3300003394 | Freshwater Lake | MCQAVEAYIYSKKGVAIKINRIAIISNARQMEMLAYAYAYANGDR* |
JGI25920J50251_100205835 | 3300003404 | Freshwater Lake | MMCQAVEAYIYSKKGVPVKINRVAIISNARQMEMLVYAYSFTNADR* |
JGI25920J50251_101122511 | 3300003404 | Freshwater Lake | MMCQAVEAYIYSKKGVVVKINRIAIISNARQMEMLVYAYAYANGDR* |
JGI25926J51410_10274342 | 3300003490 | Freshwater Lake | MMCQAVEAYIYSKKGVAVKINRIAIISDARQMEMLAYAYAYANGDR* |
JGI25923J51411_100209712 | 3300003493 | Freshwater Lake | MMCQAVEAYIYSKKGVPVKINRIAIISDSRQMEMLAYAYAY |
JGI25923J51411_10524853 | 3300003493 | Freshwater Lake | MCQAVEAYIYSKKGVPVKINRIAIISNARQMEMLAYAYAYANGDR* |
JGI25925J51416_100262542 | 3300003497 | Freshwater Lake | MCQAVEAYIYSKKGVVIKINRLAIISNARQMEMLAYAYAYANGDR* |
JGI25925J51416_101338902 | 3300003497 | Freshwater Lake | MMCQAVEAYIYSKKGVPVKINRLAIISNARQMEMLAYAYAYANGDR* |
Ga0007750_12792341 | 3300004767 | Freshwater Lake | MCQAVEAYIYSKKGVVVKINRIAIISDSRQMEMLAYAYAYANGDR* |
Ga0007758_112775903 | 3300004790 | Freshwater Lake | MMCQAVEAYIYSKKGVVIKINRLAIISNARQMEMLAYAYAYANGDR* |
Ga0007761_112653742 | 3300004792 | Freshwater Lake | TSSLVQRIEMMCQAVEAYIYSKKGVAIKINRIAIISNARQMEMLAYAYAYANGDR* |
Ga0007760_114583582 | 3300004793 | Freshwater Lake | MMCQAVEAYIYSKKGVPVKINRIAIISDSRQMEMLAYAYAYANGDR* |
Ga0070374_105919712 | 3300005517 | Freshwater Lake | MMCLAVEAYIYSKKGVVVKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0049083_100789971 | 3300005580 | Freshwater Lentic | MCQAVEAYIYSKKGVVVKINRVAIISNARQMEMLAYAYAYANGDR* |
Ga0049081_100184154 | 3300005581 | Freshwater Lentic | MMCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYSFTNADR* |
Ga0049081_101872471 | 3300005581 | Freshwater Lentic | MCQAVEAYIYSKKGVPVKINRIAIISDSRQMEMLAYAYAYANGDR* |
Ga0049081_102284572 | 3300005581 | Freshwater Lentic | MMCQAVEAYIYSKKGVVVKINRIAIISDSRQMEMLAYAYAYANGDR* |
Ga0049081_102864522 | 3300005581 | Freshwater Lentic | MMCQAVEAYIYSKKGVAVKINRIAIISNARQMEMLAYAYAYANGDR* |
Ga0049081_103381282 | 3300005581 | Freshwater Lentic | MMCQAVEAYIYSKKGVAVKINRIVIISNARQMEMLAYAYAYANGDR* |
Ga0049080_102814562 | 3300005582 | Freshwater Lentic | MMCQAVEAYIYSKKWVAIKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0049085_100624142 | 3300005583 | Freshwater Lentic | MMCLAVEAYIYSKKGVAIKINRIAIISNARQMEMLVYAYAYANGDR* |
Ga0049082_101892642 | 3300005584 | Freshwater Lentic | MMCQAVEAYIYSKKGVPVKINRVAIISNARQMEMLVYAYAYANGDR* |
Ga0049082_102884212 | 3300005584 | Freshwater Lentic | MMCLAVEAYIYSKKGVVVKINRVAIISNARQMEMLVYAYAYANGDR* |
Ga0049084_102780822 | 3300005585 | Freshwater Lentic | MCLAVEAYIYSKKGVAIKINRIAIISNARQMEMLVYAYAYANGDR* |
Ga0074469_111614592 | 3300005832 | Sediment (Intertidal) | MMCQAVEAYIYSKKGVAVKINRIAIISDSRQMEMLAYAYAYANGDR* |
Ga0073913_100833722 | 3300005940 | Sand | MMCQAVEAYIYSKKGVVVKINRLAIISNARQMEMLAYAYAYANGDR* |
Ga0073926_100489992 | 3300005943 | Sand | VQRIEIMCQAVEAYIYSKKGVVVKINRIAIISDSRQMEMLAYAYAYANGDR* |
Ga0073922_10052942 | 3300005955 | Sand | MMCQAVEAYIYSKKGVAVKINRIAIISDGRQMEMLAYAYAYANGDR* |
Ga0073924_10374092 | 3300005992 | Sand | MCQAVEAYIYSKKGVAVKINRIAIISDGRQMEMLAYAYAYANGDR* |
Ga0073919_10076021 | 3300006014 | Sand | VQRIEMMCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0070744_102510122 | 3300006484 | Estuarine | MMCQAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYA |
Ga0075464_108201442 | 3300006805 | Aqueous | MMCQAVEAYIYSKKGVAIKINRIAIISDARQMEML |
Ga0070748_10965572 | 3300006920 | Aqueous | MMCEAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYANGDR* |
Ga0070748_13208342 | 3300006920 | Aqueous | MMCEAVEAYIYSKKGVLVEINRIAIISDSRQMEMLVYAYAYANGDR* |
Ga0099847_10015227 | 3300007540 | Aqueous | MMCQAVEVYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYTNGDR* |
Ga0102853_10529382 | 3300007543 | Estuarine | MCQAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYANGDR* |
Ga0102861_11448423 | 3300007544 | Estuarine | MMCQAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAY |
Ga0102873_11814761 | 3300007545 | Estuarine | MMCLAVEAYIYSKKGVVVKINRIAIISNARQMEMLAYAYAYANGDR* |
Ga0102881_11638022 | 3300007551 | Estuarine | MMCQAVEAYIYSKKGVAIQINRIAIISDSRQMEMLAYAYAYANGDR* |
Ga0102828_10420252 | 3300007559 | Estuarine | MMCLAVEAYIYSKKGVAIKINRLAIISNARQMEMLAYAYAYANGDR* |
Ga0102863_11102221 | 3300007622 | Estuarine | MCQAVEAYIYSKKGVVVKINRIAIISNARQMEMLAYAYAYANGDR* |
Ga0102869_11412542 | 3300007627 | Estuarine | MMCQAVEAYIYSKKGVVVKINRIAIISNARQMEMLAYAYAYANGDR* |
Ga0102856_10251511 | 3300007636 | Estuarine | MMCLAVEAYIYSKKGVVVKINRLAIISDSRQMEMLAYAYAYANGDR* |
Ga0102856_10707951 | 3300007636 | Estuarine | LLVQRIEMMCQAVEAYIYSKKGVVVKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0102898_11489642 | 3300007658 | Estuarine | AVEAYIYSKKGVPVKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0102867_11240802 | 3300007716 | Estuarine | EAYIYSKKGVAIKINRVAIISDARQMEMLAYAYAYANGDR* |
Ga0105745_11484982 | 3300007972 | Estuary Water | MMCLAVEAYIYSKKGVAIQINMIAIISNARQMEMLVYAYAYANGDR* |
Ga0105747_10896801 | 3300007974 | Estuary Water | MMCLAVEAYIYSKKGVVVKINRIAIISDSRQMEMLAYAYA |
Ga0108970_114349711 | 3300008055 | Estuary | VKRIEMMCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0114359_10873432 | 3300008122 | Freshwater, Plankton | MCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0114841_10537733 | 3300008259 | Freshwater, Plankton | MMCQAVEAFIYSKKEVPVKINRIAIISNARQMEMLVYAYAYANGDR* |
Ga0114841_11475642 | 3300008259 | Freshwater, Plankton | MMCQAVEAFIYSKKEVPVKINMIAIISDSRQMEMLVYAYAYANGDR* |
Ga0114841_12143012 | 3300008259 | Freshwater, Plankton | MMCQAVEAYIYSKKGVAIKINRIAIISNSRQMEMLAYAYAYANGDR* |
Ga0114841_12280042 | 3300008259 | Freshwater, Plankton | MCQAVEAYIYSKKGVPVKINRIAIISDARQMEMLVYAYAYANGDR* |
Ga0114364_10717731 | 3300008267 | Freshwater, Plankton | MCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYTNGDR* |
Ga0114364_11133392 | 3300008267 | Freshwater, Plankton | YSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0114880_11224892 | 3300008450 | Freshwater Lake | MMCQAVEAYIYSKKGVPVKINMIAIISDSRQMEMLAYAYAYANGDR* |
Ga0114880_11677071 | 3300008450 | Freshwater Lake | YSKKGVAVKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0114880_12339172 | 3300008450 | Freshwater Lake | MMCQAVEAYIYSKKGVLVKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0114880_12593131 | 3300008450 | Freshwater Lake | MCQAVEAYIYSKKGVAVKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0102831_10069041 | 3300008996 | Estuarine | VERIEIMCQAVEAYIYSKKGVAVKINRLAIISNARQMEMLAYAYA |
Ga0102831_10213163 | 3300008996 | Estuarine | VERIEIMCQAVEAYIYSKKGVPVKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0102816_11282452 | 3300008999 | Estuarine | MCLAVEAYIYSKKGVVVKINRLAIISNARQMEMLAYAYAYANGDR* |
Ga0102829_11280103 | 3300009026 | Estuarine | MMCQAVEAYIYCKKGVAIKINRIAIISNARQMEMLAYAYAYANGDR* |
Ga0102829_11476262 | 3300009026 | Estuarine | MCQAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYTNGDR* |
Ga0102860_10793773 | 3300009056 | Estuarine | MMCQAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYTNGDR |
Ga0102830_10121732 | 3300009059 | Estuarine | MMCQAVEAYIYSKKGVVIKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0114973_105677332 | 3300009068 | Freshwater Lake | MMCLAVEAYIYSKKGVLVKINRIAIISNARQMEMLVYAYAYANGDR* |
Ga0115566_104807712 | 3300009071 | Pelagic Marine | VERIEMMCQAVEAYIYSKKGVAVKINRLAIISNARQMEMLAYAYAYANGDR* |
Ga0102814_107816521 | 3300009079 | Estuarine | MCQAVEAYIYSKKGVVVKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0105103_104478742 | 3300009085 | Freshwater Sediment | MMCQAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYTNGDR* |
Ga0102812_104006761 | 3300009086 | Estuarine | VERIEIMCQAVEAYIYSKKGVAVKINRLAIISNARQMEMLAYAYAYANGDR* |
Ga0114977_104271782 | 3300009158 | Freshwater Lake | MMCEAVEAYIYSKKGVLVQIDRIAIISDSRQMEMLAYAYAYANGDR* |
Ga0114977_104783322 | 3300009158 | Freshwater Lake | MMCEAVEAYIYSKKGVLVQINRIAIISDSRQMEMLVYAYAYANGDR* |
Ga0114978_100901442 | 3300009159 | Freshwater Lake | MMCLAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0114978_101098431 | 3300009159 | Freshwater Lake | VERIEMMCQAVEAYIYSKKGVAVKINRLAIISNARQMEMLAYAYTYANGDR* |
Ga0114966_1005194010 | 3300009161 | Freshwater Lake | VERIEMMCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0114966_105372481 | 3300009161 | Freshwater Lake | MMCLAVEAYIYSKKGVAIKINRIAIISNARQMEMLAYAYAYANGDR* |
Ga0114970_100307707 | 3300009163 | Freshwater Lake | MMCEAVEAYIYSKKGVLVQINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0114970_100702044 | 3300009163 | Freshwater Lake | MMCQAVEAYIYSKKGVAIKINRIAIISNARQMEMLVYAYAYANGDR* |
Ga0114970_103199322 | 3300009163 | Freshwater Lake | VQRIEMMCLAVEAYIYSKKGVAVKINRIAIISDARQMEMLVYAYAYANGDR* |
Ga0114970_103199332 | 3300009163 | Freshwater Lake | VQRIEMMCLAVEAYIYSKKGVAVKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0114979_101126762 | 3300009180 | Freshwater Lake | MCQAVEAYIYSKKGVPVKINRIAIISNSRQMEMLVYAYAYANGDR* |
Ga0114979_102020272 | 3300009180 | Freshwater Lake | MCQAVEAYIYSKKGVPVKINRIAIISNARQMEMLVYAYAYANGDR* |
Ga0114979_103045062 | 3300009180 | Freshwater Lake | MMCEAVEAYIYSKKGVLVQINRVAIISDSRQMEMLVYAYAYANGDR* |
Ga0114979_108010302 | 3300009180 | Freshwater Lake | MMCLAVEAYIYSKKGVPVKINRIAIISNARQMEMLVYAYAYA |
Ga0114969_102005352 | 3300009181 | Freshwater Lake | MCQAVEAYIYSKKGVPVKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0114969_106708662 | 3300009181 | Freshwater Lake | MMCLAVEAYIYSKKGVPVKINRIAIISDSRQMEMLAYAYAYANGDR* |
Ga0114969_107689292 | 3300009181 | Freshwater Lake | MCQAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAY |
Ga0114974_104350462 | 3300009183 | Freshwater Lake | MMCQAVEAYIYSKKGVPVKINRIAIISNARQMEMLVYAYAYANGDR* |
Ga0114971_101855762 | 3300009185 | Freshwater Lake | MMCQAVEAYIYSKKGVAIKINRVAIISDSRQMEMLAYAYAYANGDR* |
Ga0105080_10554562 | 3300009797 | Groundwater Sand | LVQRIEMMCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0105061_10162731 | 3300009807 | Groundwater Sand | MMCQAVEAYIYSKKGVVIKINRIAIISNARQMEMLAYAYAYANGDR* |
Ga0105088_10931412 | 3300009810 | Groundwater Sand | MCQAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAY |
Ga0105064_10971782 | 3300009821 | Groundwater Sand | MCLAVEAYIYSKKGVPVKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0114967_101725592 | 3300010160 | Freshwater Lake | KKGVAVKINRIAIISDSRQMEMLAYAYAYANGDR* |
Ga0114967_104363873 | 3300010160 | Freshwater Lake | MMCQAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYANG |
Ga0114967_105893082 | 3300010160 | Freshwater Lake | MCQAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYANG |
Ga0114967_105924522 | 3300010160 | Freshwater Lake | VERIEMMCEAVEAYIYSKKGVLVQINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0153698_102653 | 3300011335 | Freshwater | MCLAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYANGDR* |
Ga0153698_10268 | 3300011335 | Freshwater | MCQAVEAYIYSKKGVAIKINRLAIISDARQMEMLAYAYAYANGDR* |
Ga0153800_10179411 | 3300011995 | Freshwater | VEAYIYSKKGVVVKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0153805_10205721 | 3300012013 | Surface Ice | MMCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGD |
Ga0153805_10641702 | 3300012013 | Surface Ice | MCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGD |
Ga0157136_100033711 | 3300012282 | Freshwater | VERIEIMCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR* |
Ga0181338_10204032 | 3300015050 | Freshwater Lake | MMCQAVEAYIYSKKGVVVKINRVAIISNARQMEMLVYAYAYANGDR* |
Ga0181345_1033111 | 3300017699 | Freshwater Lake | QAVEAYIYSKKGVVVKINRIAIISNARQMEMLVYAYAYANGDR |
Ga0181364_10708912 | 3300017701 | Freshwater Lake | MMCQAVEAYIYSKKGVAVKINSIAIISNARQMEMLAYAYSFTNADR |
Ga0181364_10746572 | 3300017701 | Freshwater Lake | MMCQAVEAYIYSKKGVVVKINRIAIISDSRQMEMLAYAYAYAN |
Ga0181347_11458102 | 3300017722 | Freshwater Lake | MCLAVEAYIYSKKGVAIKINRIAIISNARQMEMLAYAYAYANGDR |
Ga0181362_10795211 | 3300017723 | Freshwater Lake | VQRIEMMCQAIEAYIYSKKGVAIKINRIAIISNARQMEMLVYAYAYANGDR |
Ga0181365_10103485 | 3300017736 | Freshwater Lake | MMCQAVEAYIYSKKGVPVKINRVAIISNARQMEMLVYAYSFTNADR |
Ga0181352_10859012 | 3300017747 | Freshwater Lake | SKKGVVVKINRIAIISNSRQMEMLAYAYAYANGDR |
Ga0181358_12903591 | 3300017774 | Freshwater Lake | AYIYSKKGVAVKINSIAIISNARQMEMLAYAYSFTNADR |
Ga0181349_11337651 | 3300017778 | Freshwater Lake | VERIEMMCEAVEAYIYSKKGVPVKINRLAIISNARQMEMLAYAYAYANGDR |
Ga0181349_11955902 | 3300017778 | Freshwater Lake | MQRIEMMCQAVEAYIYSKKGVVIKINRVAIISNARQMEMLVYAYAYANGDR |
Ga0181349_12719632 | 3300017778 | Freshwater Lake | MCLAVEAYIYSKKGVVVKINRVAIISNARQMEMLAYAYAYANGDR |
Ga0181346_11053581 | 3300017780 | Freshwater Lake | VQRIEMMCQAIKAYIYSKKGVAVKINRIAIISNARQMEMLAYAYAYANGDR |
Ga0181348_11238772 | 3300017784 | Freshwater Lake | MQRVEMMCQAVEAYIYSKKGVPVKINRIAIISDARQMEMLVYAYSFTNADR |
Ga0181348_12576551 | 3300017784 | Freshwater Lake | MQRIEMMCQAVEAYIYSKKGVVVKINRIAIISNSRQMEML |
Ga0181359_10696304 | 3300019784 | Freshwater Lake | MCQAVEAYIYSKKGVPVKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0181359_10792821 | 3300019784 | Freshwater Lake | MMCQAVEAYIYSKKGVAVKINRIAIISNARQMEMLAYAYS |
Ga0181359_11199851 | 3300019784 | Freshwater Lake | MCQAVEAYIYSKKGVAIKINRIAIISNARQMEMLAYAYAYANGDR |
Ga0181359_12599182 | 3300019784 | Freshwater Lake | MMCQAVEAYIYSKKGVVIKINRLAIISNARQMEMLAYAYAYANGDR |
Ga0211732_13458262 | 3300020141 | Freshwater | MCLAVEAYIYSKKGVPVKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0211736_103063963 | 3300020151 | Freshwater | MMCQAVEAYIYSKKGVAVKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0211736_103136942 | 3300020151 | Freshwater | MMCQAVEAYIYSKKGVPVKINRLAIISNARQMEMLAYAYAYANGDR |
Ga0211726_106204532 | 3300020161 | Freshwater | MMCLAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0211735_106110094 | 3300020162 | Freshwater | MMCQAVEAYIYSKKGVAVKINRLAIISNARQMEMLAYAYAYANGDR |
Ga0211735_110508804 | 3300020162 | Freshwater | LLLVQRIELMCLAVEAYIYSKKGVAIKINRIAIISNARQMEMLAYAYSFTNGDR |
Ga0211729_111544392 | 3300020172 | Freshwater | VERIEIMCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0211731_100401842 | 3300020205 | Freshwater | MMCQAVEAYIYSKKGVAVKINRIAIISDSRQMEMLAYAYSFTNGDR |
Ga0211731_102071451 | 3300020205 | Freshwater | MMCQAVEAYIYSKKGVPVKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0208483_10211361 | 3300020492 | Freshwater | TSSLVQRIEMMCQAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0208590_10384601 | 3300020501 | Freshwater | MCQAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0208363_10011586 | 3300020503 | Freshwater | MMCQAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0208852_10434632 | 3300020560 | Freshwater | MMCEAVEAYIYSKKGVPVKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0208852_10486762 | 3300020560 | Freshwater | MCQAVEAYIYSKKGVVVKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0208719_10879362 | 3300020564 | Freshwater | MMCLAVEAYIYSKKGVPIKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0196881_102312 | 3300022041 | Freshwater Lake | MMCLAVEAYIYSKKGVVVKINRIAIISDSRQMEMLAYAY |
Ga0181351_12472402 | 3300022407 | Freshwater Lake | MMCQAIKAYIYSKKGVAVKINRIAIISNARQMEMLAYAYAYANGDR |
Ga0214919_100856482 | 3300023184 | Freshwater | MMCEAVEAYIYSKKGVLVQINRIAIISDARQMEMLVYAYAYANGDR |
Ga0214919_105615781 | 3300023184 | Freshwater | MMCQAVEAYIYSKKGVPIKINRIAIISDARQMEML |
Ga0244775_101463112 | 3300024346 | Estuarine | MCQAVEAYIYSKKGVPVKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0244775_105240331 | 3300024346 | Estuarine | AYIYSKKGVVVKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0255203_10434162 | 3300024491 | Freshwater | MMCQAVEAYIYSKKGVPVKINRVAIISNSRQMEMLAYAYAYANGDR |
Ga0208303_10423932 | 3300025543 | Aqueous | MMCQAVEVYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYTNGDR |
Ga0208643_11166151 | 3300025645 | Aqueous | MMCEAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGD |
Ga0208916_105554472 | 3300025896 | Aqueous | MMCEAVEAYIYSKKGVPVKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0209856_10047882 | 3300026837 | Sand | MCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0209872_10102052 | 3300026838 | Sand | MMCQAVEAYIYSKKGVAVKINRIAIISDGRQMEMLAYAYAYANGDR |
Ga0209852_10077452 | 3300026856 | Groundwater Sand | MMCQAVEAYIYSKKGVVVKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0209850_10220572 | 3300026931 | Sand | MMCQAVEAYIYSKKGVVVKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0208800_10621462 | 3300027193 | Estuarine | MCQAVEAYIYSKKGVVVKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0208164_10021261 | 3300027224 | Estuarine | EAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0209867_10006621 | 3300027393 | Sand | AVEAYIYSKKGVVVKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0208022_10319672 | 3300027418 | Estuarine | VERIEIMCQAVEAYIYSKKGVPVKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0209552_10716592 | 3300027563 | Freshwater Lake | MMCQAVEAYIYSKKGVAIKINRIAIISNARQMEMLAYAYAYANGDR |
Ga0208966_11964442 | 3300027586 | Freshwater Lentic | MMCLAVEAYIYSKKGVPVKINRIAIISNARQMEMLVYAYAYANGDR |
Ga0208974_10092982 | 3300027608 | Freshwater Lentic | MMCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYSFTNADR |
Ga0208974_10527682 | 3300027608 | Freshwater Lentic | MMCEAVEAYIYSKKGVLVEINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0208951_10896212 | 3300027621 | Freshwater Lentic | MMCLAVEAYIYSKKGVVVKINRVAIISNARQMEMLVYAYAYANGDR |
Ga0208942_11479772 | 3300027627 | Freshwater Lentic | MMCLAVEAYIYSKKGVAIKINRIAIISNARQMEMLVYAYAYANGDR |
Ga0208133_10210513 | 3300027631 | Estuarine | MMCQAVEAYIYSKKGVVVKINRLAIISNARQMEMLAYAYAYANGDR |
Ga0208960_10531162 | 3300027649 | Freshwater Lentic | MMCQAVEAYIYSKKGVAIKINRVAIISNARQMEMLAYAYAYANGDR |
Ga0208975_10468624 | 3300027659 | Freshwater Lentic | VERIEIMCLAVEAYIYSKKGVAVKINRLAIISNARQMEMLAYAYAYANGDR |
Ga0208975_11812352 | 3300027659 | Freshwater Lentic | MMCQSIEAFIYSKKGVPVKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0208975_11990162 | 3300027659 | Freshwater Lentic | MMCQAVEAYIYSKKGVPVKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0209769_11563752 | 3300027679 | Freshwater Lake | VERIEIMCQAVEAYIYSKKGVAVKINRLAIISNARQMEMLAYAYAYANGDR |
Ga0209769_11683212 | 3300027679 | Freshwater Lake | MCQAVEAYIYSKKGVVVKINRIAIISNARQMEMLVYAYAYANGDR |
Ga0209553_10618352 | 3300027688 | Freshwater Lake | MMCLAVEAYIYSKKGVAIKINRVAIISNARQMEMLVYAYAYANGDR |
Ga0209443_10131903 | 3300027707 | Freshwater Lake | MQRVEMMCQAVEAYIYSKKGVPVKINRVAIISNARQMEMLVYAYSFTNADR |
Ga0209443_12505931 | 3300027707 | Freshwater Lake | MMCQAVEAYIYSKKGVVVKINRIAIISNARQMEMLVYAYAYANGDR |
Ga0209297_10170242 | 3300027733 | Freshwater Lake | MMCEAVEAYIYSKKGVLVQINRIAIISDSRQMEMLVYAYAYANGDR |
Ga0209087_10021708 | 3300027734 | Freshwater Lake | VQRIEMMCLAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0209087_10122056 | 3300027734 | Freshwater Lake | MMCEAVEAYIYSKKGVLVQIDRIAIISDSRQMEMLAYAYAYANGDR |
Ga0209190_10064114 | 3300027736 | Freshwater Lake | VQRIEMMCEAVEAYIYSKKGVLVQINRIAIISDARQMEMLAYAYAYANGDR |
Ga0209190_10195272 | 3300027736 | Freshwater Lake | MMCLAVEAYIYSKKGVAVKINRIAIISDARQMEMLVYAYAYANGDR |
Ga0209190_11806391 | 3300027736 | Freshwater Lake | SLVQRIEMMCLAVEAYIYSKKGVAVKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0209296_10194619 | 3300027759 | Freshwater Lake | MMCEAVEAYIYSKKGVLVQINRVAIISNARQMEMLVYAYAYANGDR |
Ga0209296_10783522 | 3300027759 | Freshwater Lake | MMCQAVEAYIYSKKGVAIKINRIAIISNARQMEMLVYAYAYANGDR |
Ga0209296_11423442 | 3300027759 | Freshwater Lake | MMCEAVEAYIYSKKGVLVQINRVAIISDSRQMEMLVYAYAYANGDR |
Ga0209086_1000821115 | 3300027770 | Freshwater Lake | VERIEMMCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0209246_100171312 | 3300027785 | Freshwater Lake | MQRIEMMCQAVEAYIYSKKGVVIKINRVAIISNARQMEMLVYAYSFTNADR |
Ga0209107_100306567 | 3300027797 | Freshwater And Sediment | MMCQAVEAYIYSKKGVVVKIDRIAIISNARQMEMLAYAYAYANGDR |
Ga0209107_103049542 | 3300027797 | Freshwater And Sediment | YSKKGVVVKIDRIAIISNARQMEMLVYAYAYANGDR |
Ga0209353_100726165 | 3300027798 | Freshwater Lake | MMCQAVEAYIYSKKGVPVKINRIAIISNARQMEMLAYAYAYANGDR |
Ga0209353_102259621 | 3300027798 | Freshwater Lake | SSLVQRIEMMCQAVEAYIYSKKGVAIKINRIAIISNARQMEMLAYAYAYANGDR |
Ga0209353_102466243 | 3300027798 | Freshwater Lake | MCQAVEAYIYSKKGVVVKINRVAIISNARQMEMLAYAYAYANGDR |
Ga0209353_102991862 | 3300027798 | Freshwater Lake | MMCQAVEAYIYSKKGVPVKINRVAIISDARQMEMLAYAYAYANGDR |
Ga0209353_103738111 | 3300027798 | Freshwater Lake | MMCQAVEAYIYSKKAVAIKINRLAIISNARQMEMLAY |
Ga0209354_100127584 | 3300027808 | Freshwater Lake | VQRIEMMCQAVEAYIYSKKGVVVKINRVAIISDARQMEMLAYAYAYANGDR |
Ga0209354_100458173 | 3300027808 | Freshwater Lake | MMCQAVEAYIYSKKGVVVKINRVAIISNARQMEMLAYAYAYANGDR |
Ga0209354_103690421 | 3300027808 | Freshwater Lake | MMCQTVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0209230_102032122 | 3300027836 | Freshwater And Sediment | MMCQAVEAYIYSKKGVPVKINRIAIISNARQMEMLVYAYAYANGDR |
Ga0209023_106461271 | 3300027870 | Freshwater And Sediment | MMCLAVEAYIYSKKGVPVKINRLAIISNARQMEMLAYAYAYANGDR |
Ga0209893_10059051 | 3300027940 | Sand | VQRIEMMCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYA |
Ga0209893_10131052 | 3300027940 | Sand | MCQAVEAYIYSKKGVAIKINRIAIISDARQMEMLAYAYA |
Ga0209401_10044526 | 3300027971 | Freshwater Lake | MMCLAVEAYIYSKKGVLVKINRIAIISNARQMEMLVYAYAYANGDR |
Ga0209401_12072242 | 3300027971 | Freshwater Lake | MMCQAVEAYIYSKKGVVVKIDRIAIISNARQMEMLVYAYAYANGDR |
Ga0304730_11314262 | 3300028394 | Freshwater Lake | MMCEAVEAYIYSKKGVLVQINRIAIISDARQMEMLAYAYAYANGDR |
Ga0307380_108832712 | 3300031539 | Soil | MMCQAVEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYSFTNGDK |
Ga0315291_113201121 | 3300031707 | Sediment | MMCQAVEAYIYSKKGVVVKINRIAIISDSRQMEMLAYAY |
Ga0315293_107389811 | 3300031746 | Sediment | MCQAVEAYIYSKKGVVVKINRIAIISDARQMEMLAYAYAYAN |
Ga0315293_111820761 | 3300031746 | Sediment | MMCQAVEAYIYSKKGVVVKINRIAIISDSRQMEMLAYAYAYA |
Ga0315293_112973481 | 3300031746 | Sediment | SLLVQRIEIMCQAVEAYIYSKKGVVVKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0315288_115591521 | 3300031772 | Sediment | MMCLAVEAYIYSKKGVVVKINRIAIISDARQMEMLAYAYAYANGD |
Ga0315909_102088662 | 3300031857 | Freshwater | MMCQAVEVYIYSKKGVAIKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0315285_109837011 | 3300031885 | Sediment | SKKGVVVKINKIAIISDSRQMEMLAYAYAYANGDR |
Ga0315294_115642992 | 3300031952 | Sediment | MCQAVEAYIYSKKGVAVKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0315278_116255082 | 3300031997 | Sediment | AYIYSKKGVAVKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0315284_102908662 | 3300032053 | Sediment | MMCLAVEAYIYSKKGVAIKINRIAIISDARQMEMLVYAYAYANGDR |
Ga0315283_117012651 | 3300032164 | Sediment | QRIEIMCQAVEAYIYSKKGVVVKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0315268_120596241 | 3300032173 | Sediment | MMCQAVEAYIYSKKGVAVKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0315276_114651892 | 3300032177 | Sediment | MCLAVEAYIYSKKGVVVKINRIAIISDARQMEMLVYAYAYANGDR |
Ga0315270_108576682 | 3300032275 | Sediment | MMCLAVEAYIYSKKGVVVKINRIAIISDARQMEMLVYAYAYANGDR |
Ga0315273_110172641 | 3300032516 | Sediment | MMCLAVEAYIYSKKGVVVKINRIAIISDARQMEML |
Ga0335003_0008481_4210_4347 | 3300033995 | Freshwater | MCQAIEAYIYSKKGVPVKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0335003_0148520_223_360 | 3300033995 | Freshwater | MCQAIEAYIYSKKGVAIKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0335000_0001541_1592_1729 | 3300034063 | Freshwater | MCQAVEAYIYSKKEVAIKINRIAIISDSRQMEMLAYAYAYANGDR |
Ga0335020_0084797_95_235 | 3300034082 | Freshwater | MMCQAVESYIYSKKGIPVKINRIAIISDARQMEMLAYAYAYANGDR |
Ga0335035_0156830_695_832 | 3300034105 | Freshwater | MCQAVEAYIYSKKGVPVKINRIAIISDSRQMEMLAYAYAYTNGDR |
Ga0335013_0473575_1_135 | 3300034284 | Freshwater | MMCQAVEAYIYSKKGVPVKINRIAIISDARQMEMLAYAYAYANGD |
⦗Top⦘ |