NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F017555

Metagenome / Metatranscriptome Family F017555

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F017555
Family Type Metagenome / Metatranscriptome
Number of Sequences 240
Average Sequence Length 128 residues
Representative Sequence MVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFKFSNTITIKLAYQVKPIPKKLETIW
Number of Associated Samples 151
Number of Associated Scaffolds 240

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.83 %
% of genes near scaffold ends (potentially truncated) 22.08 %
% of genes from short scaffolds (< 2000 bps) 59.58 %
Associated GOLD sequencing projects 137
AlphaFold2 3D model prediction Yes
3D model pTM-score0.65

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.417 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(35.417 % of family members)
Environment Ontology (ENVO) Unclassified
(60.417 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(87.083 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.93%    β-sheet: 25.79%    Coil/Unstructured: 45.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.65
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 240 Family Scaffolds
PF00203Ribosomal_S19 29.58
PF00237Ribosomal_L22 15.42
PF03947Ribosomal_L2_C 11.67
PF00252Ribosomal_L16 5.42
PF07650KH_2 3.75
PF00276Ribosomal_L23 3.75
PF00297Ribosomal_L3 2.08
PF00366Ribosomal_S17 2.08
PF00831Ribosomal_L29 2.08
PF00573Ribosomal_L4 1.67
PF00238Ribosomal_L14 1.25
PF00673Ribosomal_L5_C 0.83
PF00177Ribosomal_S7 0.83
PF05690ThiG 0.83
PF00118Cpn60_TCP1 0.83
PF00012HSP70 0.83
PF03118RNA_pol_A_CTD 0.83
PF00004AAA 0.83
PF03144GTP_EFTU_D2 0.83
PF00164Ribosom_S12_S23 0.42
PF00347Ribosomal_L6 0.42
PF00410Ribosomal_S8 0.42
PF00416Ribosomal_S13 0.42
PF03719Ribosomal_S5_C 0.42
PF17136ribosomal_L24 0.42
PF01578Cytochrom_C_asm 0.42
PF06298PsbY 0.42
PF01479S4 0.42
PF00468Ribosomal_L34 0.42
PF10431ClpB_D2-small 0.42
PF03466LysR_substrate 0.42
PF06868DUF1257 0.42
PF13710ACT_5 0.42

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 240 Family Scaffolds
COG0185Ribosomal protein S19Translation, ribosomal structure and biogenesis [J] 29.58
COG0091Ribosomal protein L22Translation, ribosomal structure and biogenesis [J] 15.42
COG0090Ribosomal protein L2Translation, ribosomal structure and biogenesis [J] 11.67
COG0197Ribosomal protein L16/L10AETranslation, ribosomal structure and biogenesis [J] 5.42
COG0089Ribosomal protein L23Translation, ribosomal structure and biogenesis [J] 3.75
COG0087Ribosomal protein L3Translation, ribosomal structure and biogenesis [J] 2.08
COG0186Ribosomal protein S17Translation, ribosomal structure and biogenesis [J] 2.08
COG0255Ribosomal protein L29Translation, ribosomal structure and biogenesis [J] 2.08
COG0088Ribosomal protein L4Translation, ribosomal structure and biogenesis [J] 1.67
COG0093Ribosomal protein L14Translation, ribosomal structure and biogenesis [J] 1.25
COG0049Ribosomal protein S7Translation, ribosomal structure and biogenesis [J] 0.83
COG0094Ribosomal protein L5Translation, ribosomal structure and biogenesis [J] 0.83
COG0202DNA-directed RNA polymerase, alpha subunit/40 kD subunitTranscription [K] 0.83
COG0214Pyridoxal 5'-phosphate synthase subunit PdxSCoenzyme transport and metabolism [H] 0.83
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 0.83
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.83
COG2022Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis)Coenzyme transport and metabolism [H] 0.83
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.83
COG0096Ribosomal protein S8Translation, ribosomal structure and biogenesis [J] 0.42
COG0097Ribosomal protein L6P/L9ETranslation, ribosomal structure and biogenesis [J] 0.42
COG0098Ribosomal protein S5Translation, ribosomal structure and biogenesis [J] 0.42
COG0099Ribosomal protein S13Translation, ribosomal structure and biogenesis [J] 0.42
COG0230Ribosomal protein L34Translation, ribosomal structure and biogenesis [J] 0.42

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2100351011|ASMM170b_contig00001__length_39566___numreads_3766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria39566Open in IMG/M
3300000124|BS_KBA_SWE12_21mDRAFT_c10000077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria31061Open in IMG/M
3300000124|BS_KBA_SWE12_21mDRAFT_c10001600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus8291Open in IMG/M
3300001827|ACM21_1012798All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens812Open in IMG/M
3300002154|JGI24538J26636_10140846All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300003621|JGI26083J51738_10024051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1927Open in IMG/M
3300003621|JGI26083J51738_10059160All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta893Open in IMG/M
3300003621|JGI26083J51738_10107809All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300003682|Ga0008456_1006714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria15798Open in IMG/M
3300003683|Ga0008459J53047_1004206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales15879Open in IMG/M
3300005590|Ga0070727_10061556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2223Open in IMG/M
3300006165|Ga0075443_10000109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria32861Open in IMG/M
3300006374|Ga0075512_1051638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria16765Open in IMG/M
3300006379|Ga0075513_1389564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales10033Open in IMG/M
3300006384|Ga0075516_1432790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3211Open in IMG/M
3300006394|Ga0075492_1003535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1448Open in IMG/M
3300006394|Ga0075492_1019921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1995Open in IMG/M
3300006394|Ga0075492_1473334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1023Open in IMG/M
3300006396|Ga0075493_1076396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3734Open in IMG/M
3300006397|Ga0075488_1419304All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300006562|Ga0101390_1000436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1065Open in IMG/M
3300006571|Ga0075505_1510453All Organisms → cellular organisms → Bacteria1878Open in IMG/M
3300006803|Ga0075467_10067035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2197Open in IMG/M
3300006803|Ga0075467_10316086All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta828Open in IMG/M
3300006803|Ga0075467_10586258All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta570Open in IMG/M
3300007169|Ga0102976_1185304All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300007202|Ga0103274_1069699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales3633Open in IMG/M
3300007543|Ga0102853_1100638All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta544Open in IMG/M
3300007551|Ga0102881_1079045All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta915Open in IMG/M
3300007552|Ga0102818_1000615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria8246Open in IMG/M
3300007555|Ga0102817_1040226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1026Open in IMG/M
3300007655|Ga0102825_1008043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2207Open in IMG/M
3300007655|Ga0102825_1108964All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta569Open in IMG/M
3300007665|Ga0102908_1046427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria840Open in IMG/M
3300007667|Ga0102910_1156861All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta537Open in IMG/M
3300007716|Ga0102867_1165621All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta601Open in IMG/M
3300007955|Ga0105740_1037164All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta735Open in IMG/M
3300007958|Ga0105743_1027365All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta602Open in IMG/M
3300007981|Ga0102904_1005100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2793Open in IMG/M
3300007981|Ga0102904_1005619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2673Open in IMG/M
3300007981|Ga0102904_1006353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2535Open in IMG/M
3300008470|Ga0115371_10142590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria15279Open in IMG/M
3300008930|Ga0103733_1000119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5276Open in IMG/M
3300008958|Ga0104259_1025214All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta607Open in IMG/M
3300008995|Ga0102888_1006945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2098Open in IMG/M
3300009054|Ga0102826_1145007All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta566Open in IMG/M
3300009074|Ga0115549_1068281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1230Open in IMG/M
3300009079|Ga0102814_10670534All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta569Open in IMG/M
3300009080|Ga0102815_10096210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1619Open in IMG/M
3300009181|Ga0114969_10331701All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta889Open in IMG/M
3300009225|Ga0103851_1104908All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta517Open in IMG/M
3300009265|Ga0103873_1063939All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta724Open in IMG/M
3300009327|Ga0103843_100093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3304Open in IMG/M
3300009353|Ga0103847_1008139All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta557Open in IMG/M
3300009432|Ga0115005_10002537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria14533Open in IMG/M
3300009432|Ga0115005_10005673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria9870Open in IMG/M
3300009432|Ga0115005_10704446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria811Open in IMG/M
3300009436|Ga0115008_10000423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria31234Open in IMG/M
3300009436|Ga0115008_10024597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4848Open in IMG/M
3300009436|Ga0115008_10151312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1688Open in IMG/M
3300009436|Ga0115008_10163519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1612Open in IMG/M
3300009436|Ga0115008_10308345All Organisms → cellular organisms → Eukaryota → Sar1123Open in IMG/M
3300009443|Ga0115557_1261363All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta660Open in IMG/M
3300009447|Ga0115560_1418741All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta506Open in IMG/M
3300009543|Ga0115099_10181765All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300009543|Ga0115099_10196527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales1221Open in IMG/M
3300009543|Ga0115099_10277590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria16716Open in IMG/M
3300009543|Ga0115099_10347958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5491Open in IMG/M
3300009543|Ga0115099_10577665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria10467Open in IMG/M
3300009543|Ga0115099_10590445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya4494Open in IMG/M
3300009543|Ga0115099_10626582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria18505Open in IMG/M
3300009592|Ga0115101_1350233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya4052Open in IMG/M
3300009593|Ga0115011_10010518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales6150Open in IMG/M
3300009599|Ga0115103_1322454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales14527Open in IMG/M
3300009599|Ga0115103_1677016All Organisms → cellular organisms → Bacteria1401Open in IMG/M
3300009599|Ga0115103_1862870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1123Open in IMG/M
3300009606|Ga0115102_10046236All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300009606|Ga0115102_10098355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2889Open in IMG/M
3300009606|Ga0115102_10269411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria10470Open in IMG/M
3300009606|Ga0115102_10371327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3667Open in IMG/M
3300009606|Ga0115102_10394660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1613Open in IMG/M
3300009606|Ga0115102_10889699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1910Open in IMG/M
3300009735|Ga0123377_1017468All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta505Open in IMG/M
3300009911|Ga0132221_1000958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1445Open in IMG/M
3300010306|Ga0129322_1057242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1816Open in IMG/M
3300011186|Ga0136553_1000053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria39213Open in IMG/M
3300012370|Ga0123369_1003977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6464Open in IMG/M
3300012370|Ga0123369_1067746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria906Open in IMG/M
3300012370|Ga0123369_1078420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1872Open in IMG/M
3300012416|Ga0138259_1553672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1268Open in IMG/M
3300012418|Ga0138261_1385934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1229Open in IMG/M
3300012419|Ga0138260_10217386All Organisms → cellular organisms → Eukaryota → Sar534Open in IMG/M
3300012504|Ga0129347_1159127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria13006Open in IMG/M
3300012504|Ga0129347_1238240All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta637Open in IMG/M
3300012516|Ga0129325_1131806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3202Open in IMG/M
3300012769|Ga0138279_1083720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria16695Open in IMG/M
3300013109|Ga0171649_155677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1018Open in IMG/M
(restricted) 3300013126|Ga0172367_10034408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4339Open in IMG/M
3300013295|Ga0170791_10243827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria16746Open in IMG/M
3300016916|Ga0186073_100018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria8897Open in IMG/M
3300017728|Ga0181419_1111910All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta667Open in IMG/M
3300017731|Ga0181416_1019738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1582Open in IMG/M
3300017740|Ga0181418_1000138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria22500Open in IMG/M
3300017772|Ga0181430_1046954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1346Open in IMG/M
3300017772|Ga0181430_1214651All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta547Open in IMG/M
3300017773|Ga0181386_1000117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria28429Open in IMG/M
3300017773|Ga0181386_1012583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae2855Open in IMG/M
3300017782|Ga0181380_1000073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria39836Open in IMG/M
3300017788|Ga0169931_10001421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria39552Open in IMG/M
3300017788|Ga0169931_10001441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria39285Open in IMG/M
3300017990|Ga0180436_10251236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1283Open in IMG/M
3300018515|Ga0192960_100003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria15437Open in IMG/M
3300018515|Ga0192960_100005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria12057Open in IMG/M
3300018515|Ga0192960_100036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4452Open in IMG/M
3300018515|Ga0192960_100054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae3405Open in IMG/M
3300018515|Ga0192960_104472All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta666Open in IMG/M
3300018515|Ga0192960_105091All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta627Open in IMG/M
3300018597|Ga0193035_1008152All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta783Open in IMG/M
3300018603|Ga0192881_1016398All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta716Open in IMG/M
3300018629|Ga0188875_1000053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6492Open in IMG/M
3300018632|Ga0188873_1000158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4915Open in IMG/M
3300018649|Ga0192969_1053293All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta550Open in IMG/M
3300018662|Ga0192848_1018500All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta798Open in IMG/M
3300018676|Ga0193137_1024186All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta822Open in IMG/M
3300018684|Ga0192983_1000386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2564Open in IMG/M
3300018684|Ga0192983_1005193All Organisms → cellular organisms → Eukaryota → Sar1382Open in IMG/M
3300018690|Ga0192917_1055094All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta593Open in IMG/M
3300018698|Ga0193236_1013688All Organisms → cellular organisms → Eukaryota → Sar1043Open in IMG/M
3300018699|Ga0193195_1035382All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta594Open in IMG/M
3300018711|Ga0193069_1000109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2436Open in IMG/M
3300018711|Ga0193069_1000707All Organisms → cellular organisms → Eukaryota → Sar1737Open in IMG/M
3300018711|Ga0193069_1041634All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta556Open in IMG/M
3300018723|Ga0193038_1008605All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300018791|Ga0192950_1000313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2566Open in IMG/M
3300018813|Ga0192872_1039746All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta852Open in IMG/M
3300018927|Ga0193083_10008824All Organisms → cellular organisms → Eukaryota → Sar1099Open in IMG/M
3300018927|Ga0193083_10022058All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta830Open in IMG/M
3300018927|Ga0193083_10066306All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta548Open in IMG/M
3300018934|Ga0193552_10162563All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta636Open in IMG/M
3300018942|Ga0193426_10064926All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta797Open in IMG/M
3300018964|Ga0193087_10247063All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta563Open in IMG/M
3300018980|Ga0192961_10000474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya4423Open in IMG/M
3300018980|Ga0192961_10000479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4412Open in IMG/M
3300018980|Ga0192961_10000480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4411Open in IMG/M
3300018980|Ga0192961_10000491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4398Open in IMG/M
3300018980|Ga0192961_10000495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya4392Open in IMG/M
3300018980|Ga0192961_10000496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya4390Open in IMG/M
3300018980|Ga0192961_10001082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3637Open in IMG/M
3300018980|Ga0192961_10004567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2521Open in IMG/M
3300018980|Ga0192961_10019820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1666Open in IMG/M
3300018980|Ga0192961_10186244All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta626Open in IMG/M
3300018985|Ga0193136_10008824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1818Open in IMG/M
3300018996|Ga0192916_10124577All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta773Open in IMG/M
3300018999|Ga0193514_10031513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1663Open in IMG/M
3300018999|Ga0193514_10142787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria876Open in IMG/M
3300018999|Ga0193514_10177075All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta774Open in IMG/M
3300019007|Ga0193196_10028614All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1784Open in IMG/M
3300019007|Ga0193196_10127178All Organisms → cellular organisms → Eukaryota → Sar1060Open in IMG/M
3300019007|Ga0193196_10261565All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta747Open in IMG/M
3300019009|Ga0192880_10006296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2185Open in IMG/M
3300019009|Ga0192880_10019083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1536Open in IMG/M
3300019021|Ga0192982_10036242All Organisms → cellular organisms → Eukaryota → Sar1373Open in IMG/M
3300019032|Ga0192869_10326989All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta670Open in IMG/M
3300019040|Ga0192857_10008469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1472Open in IMG/M
3300019040|Ga0192857_10008936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1457Open in IMG/M
3300019040|Ga0192857_10010758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1404Open in IMG/M
3300019040|Ga0192857_10011036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1397Open in IMG/M
3300019040|Ga0192857_10156651All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta699Open in IMG/M
3300019040|Ga0192857_10174010All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta674Open in IMG/M
3300019040|Ga0192857_10279910All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta564Open in IMG/M
3300019049|Ga0193082_10066747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1290Open in IMG/M
3300019049|Ga0193082_10075693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1252Open in IMG/M
3300019049|Ga0193082_10417907All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta730Open in IMG/M
3300019049|Ga0193082_10547133All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta647Open in IMG/M
3300019133|Ga0193089_1000250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4560Open in IMG/M
3300019133|Ga0193089_1013768All Organisms → cellular organisms → Eukaryota → Sar1760Open in IMG/M
3300019133|Ga0193089_1128510All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta576Open in IMG/M
3300019143|Ga0192856_1027615All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta742Open in IMG/M
3300019143|Ga0192856_1045979All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta617Open in IMG/M
3300019143|Ga0192856_1050448All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta594Open in IMG/M
3300019146|Ga0188881_10001059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2872Open in IMG/M
3300019214|Ga0180037_1084735All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta520Open in IMG/M
3300019214|Ga0180037_1088362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1809Open in IMG/M
3300019214|Ga0180037_1166802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5112Open in IMG/M
3300021169|Ga0206687_1110614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria14291Open in IMG/M
3300021169|Ga0206687_1679753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria8553Open in IMG/M
3300021305|Ga0210296_1123355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales5479Open in IMG/M
3300021317|Ga0210309_1046204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales10010Open in IMG/M
3300021335|Ga0213867_1134612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria859Open in IMG/M
3300021336|Ga0210307_1181885All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta625Open in IMG/M
3300021356|Ga0213858_10000163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria31218Open in IMG/M
3300021356|Ga0213858_10032592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2510Open in IMG/M
3300021356|Ga0213858_10042992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2181Open in IMG/M
3300021356|Ga0213858_10293427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria777Open in IMG/M
3300021364|Ga0213859_10006652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales5168Open in IMG/M
3300021368|Ga0213860_10067354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1544Open in IMG/M
3300021371|Ga0213863_10114081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1274Open in IMG/M
3300021373|Ga0213865_10273382All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens799Open in IMG/M
3300021378|Ga0213861_10033185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3467Open in IMG/M
3300021378|Ga0213861_10123077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1511Open in IMG/M
3300021379|Ga0213864_10046897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2058Open in IMG/M
3300021379|Ga0213864_10273350All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens858Open in IMG/M
3300021389|Ga0213868_10617446All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta564Open in IMG/M
3300021425|Ga0213866_10571473All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta531Open in IMG/M
3300021961|Ga0222714_10000586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria41860Open in IMG/M
3300022202|Ga0224498_10000067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria23132Open in IMG/M
3300022367|Ga0210312_112506All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta656Open in IMG/M
(restricted) 3300022913|Ga0233404_10012420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1930Open in IMG/M
(restricted) 3300023114|Ga0233405_10011028All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1197Open in IMG/M
(restricted) 3300023114|Ga0233405_10111066All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta507Open in IMG/M
(restricted) 3300023210|Ga0233412_10025026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2379Open in IMG/M
(restricted) 3300023276|Ga0233410_10022853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1779Open in IMG/M
(restricted) 3300024059|Ga0255040_10072650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1304Open in IMG/M
(restricted) 3300024062|Ga0255039_10291336All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta695Open in IMG/M
(restricted) 3300024264|Ga0233444_10000678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria42129Open in IMG/M
(restricted) 3300024338|Ga0255043_10021926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1770Open in IMG/M
(restricted) 3300024338|Ga0255043_10303041All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta554Open in IMG/M
3300024343|Ga0244777_10000479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria31289Open in IMG/M
3300024343|Ga0244777_10007230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya7140Open in IMG/M
3300024343|Ga0244777_10018791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4359Open in IMG/M
3300024343|Ga0244777_10242223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1149Open in IMG/M
(restricted) 3300024528|Ga0255045_10202504All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta774Open in IMG/M
3300025879|Ga0209555_10000632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria29329Open in IMG/M
3300025879|Ga0209555_10002865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria11912Open in IMG/M
3300025879|Ga0209555_10137246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1025Open in IMG/M
3300025887|Ga0208544_10240720All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta728Open in IMG/M
3300027196|Ga0208438_1042271All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta759Open in IMG/M
3300027228|Ga0208308_1005233All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1720Open in IMG/M
3300027230|Ga0208171_1006895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1186Open in IMG/M
3300027243|Ga0208174_1018222All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta886Open in IMG/M
3300027308|Ga0208796_1103825All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta579Open in IMG/M
3300027582|Ga0208971_1095611All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta702Open in IMG/M
3300027810|Ga0209302_10000178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria39734Open in IMG/M
3300027833|Ga0209092_10015090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5429Open in IMG/M
3300027833|Ga0209092_10287490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria893Open in IMG/M
3300027849|Ga0209712_10482880All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta695Open in IMG/M
(restricted) 3300028045|Ga0233414_10007177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4244Open in IMG/M
3300031539|Ga0307380_10001135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria39967Open in IMG/M
3300031539|Ga0307380_10001653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria32483Open in IMG/M
3300034019|Ga0334998_0055576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2742Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine35.42%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine13.33%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine7.50%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.08%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.25%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater5.42%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.92%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.67%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.67%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.25%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.25%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.25%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.25%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.83%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.83%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.83%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.83%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.42%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.42%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.42%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.42%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.42%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.42%
Coastal Water And SedimentEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment0.42%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.42%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.42%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.42%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.42%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.42%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.42%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.42%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.42%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.42%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2100351011Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from medium methane PC12-240-170cmEnvironmentalOpen in IMG/M
3300000124Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21mEnvironmentalOpen in IMG/M
3300001827Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM21, ROCA_DNA110_2.0um_23kEnvironmentalOpen in IMG/M
3300002154Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 MetagenomeEnvironmentalOpen in IMG/M
3300003621Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNAEnvironmentalOpen in IMG/M
3300003682Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_03_M0_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006562Marine microbial communities from the Black Sea in Odessa region - Od_2EnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007169Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007202Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300007543Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007655Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579EnvironmentalOpen in IMG/M
3300007665Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300007958Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459BC_3.0umEnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008470Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563EnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008995Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009225Microbial communities of water from Amazon river, Brazil - RCM4EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009327Microbial communities of water from the North Atlantic ocean - ACM30EnvironmentalOpen in IMG/M
3300009353Microbial communities of water from the North Atlantic ocean - ACM49EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009735Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_240_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009911Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, surface; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010306Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011186Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E5 #430EnvironmentalOpen in IMG/M
3300012370Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_209_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012769Freshwater microbial communities from Lake Montjoie, Canada - M_140205_X_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013109Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 198m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016916Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium w/o silicate, at 20 C, 30 psu salinity and 483 ?mol photons light - Chaetoceros neogracile CCMP 1317 (MMETSP0752)Host-AssociatedOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017990Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaGEnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018597Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782201-ERR1712206)EnvironmentalOpen in IMG/M
3300018603Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782239-ERR1711906)EnvironmentalOpen in IMG/M
3300018629Metatranscriptome of marine microbial communities from Baltic Sea - GS852_ls4EnvironmentalOpen in IMG/M
3300018632Metatranscriptome of marine microbial communities from Baltic Sea - GS848_ls3EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018662Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000526 (ERX1782276-ERR1711878)EnvironmentalOpen in IMG/M
3300018676Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782202-ERR1711913)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018690Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782228-ERR1712109)EnvironmentalOpen in IMG/M
3300018698Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001473 (ERX1809465-ERR1739846)EnvironmentalOpen in IMG/M
3300018699Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000008 (ERX1782338-ERR1712211)EnvironmentalOpen in IMG/M
3300018711Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099)EnvironmentalOpen in IMG/M
3300018723Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000268 (ERX1782137-ERR1712170)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018813Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019143Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782306-ERR1712244)EnvironmentalOpen in IMG/M
3300019146Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5EnvironmentalOpen in IMG/M
3300019214Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021305Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021317Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022202Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022367Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1161 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022913 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MGEnvironmentalOpen in IMG/M
3300023114 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_3_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024338 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024528 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027196Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes)EnvironmentalOpen in IMG/M
3300027228Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027230Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027243Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027308Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)EnvironmentalOpen in IMG/M
3300027582Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ASMM170b_000004402100351011Coastal Water And SedimentMVQKIVDPNFHIKTFNVKCDSKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPNERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNEQSELFKLSNTITIKLAYQVKVVPKKLETIW
BS_KBA_SWE12_21mDRAFT_10000077333300000124MarineMVPKIVDPNFNIKTFNIKCDSELSSLAKIVLKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKFNRFVNTHSESFKVSNMITIKLAYQVKPVTKKLETTW*
BS_KBA_SWE12_21mDRAFT_1000160093300000124MarineMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKYKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFKISNTITIKLAYQVKPVPKKLETIW*
ACM21_101279823300001827Marine PlanktonSELSSLAKTILKSFKFKLYYYTVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLCVNFFDIYIYDISIKDISKFNRFVNEQSESFKVSNMITIKLAYQVKPVTKKLETTW*
JGI24538J26636_1014084623300002154MarineLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQLLNSSVIFLQNNLYVNFFDIYIYDITINEVSKFNRFVNEQSKSFKVSNTLTVKLAYQVKPVQKKLETIW*
JGI26083J51738_1002405143300003621MarineMVQKVVDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEVSKFNRFVNEQSNSFKVSNIITVKLAYQVKPVQKKLETIW*
JGI26083J51738_1005916013300003621MarineMVPKINDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKSNQKEANQLLQILHSTVIYLQNNLYVNFFDIYVYEVSISEKSNSNKFVKNSTDYFESLNYLTIKLAYQVKPISKKLESIW*
JGI26083J51738_1010780923300003621MarineMVQKIVDPNFHIKTFNVKCDAKLSPLAKTILSSFKFKLYYYVIDDLLYLLKSNLEERDYLLQILNSSVIFLQNNLYVNFFDIYIYDISINEISKINRFVNEQPESFKLSN
Ga0008456_100671463300003682SeawaterMVQKIMDPNFHIKTFNVKCDKKLSSLAITILQSFKFKLYYYVMDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNEQSELFKVSNTITIKLAYQIKPVPKKLETIW*
Ga0008459J53047_100420663300003683SeawaterMVQKIVDPNFHIKTFNVKCDAKLSPLAKTILSSFKFKLYYYVIDDLLYLLKSNLEERDYLLQILNSSVIFLQNNLYVNFFDIYIYDISINEISKINRFVNEQPESFKLSNTITIKLAYQVTAVPKKLETIW*
Ga0070727_1006155653300005590Marine SedimentMVQKIVDPNFHIKTFNVKCDSKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPNERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNEQSELFKLSNTITIKLAYQVKVVPKKLETIW*
Ga0075443_10000109383300006165MarineMVPKLNDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKSNQKEGNQLLQTLHSTVIYLQNNLYVNFFDIYVYEVSISEKQNSNKFIKNSSDYFESLNYLTIKLAYQVKPISKKLESIW*
Ga0075512_105163863300006374AqueousMVPKINDTKFNIKTFNIRYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKSNQKEANQLLQILHSTVIYLQNNLYVNFFDIYVYEVNISEKSNSNKFVKNSTDYFESLNYLTIKLAYQVKPISKKLESIW*
Ga0075513_1389564143300006379AqueousMVQKIIDPNFHIKTFNVKCDKALSPLLKTILKSFKFKLYYYVIDDLLYLLKSNPDECDSILQTLNSSVLFLQNNFHVNFFDIYLYEINIIERSKSNRFINEELNYFQNSIYLNIKFAYQVKSVQKKFETIW*
Ga0075516_143279013300006384AqueousMVPKVNDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKTNQTEANQLLQILHSTVIYLQNNLHVNFFDIYVYEISITEKQNMNKFIQNSSDYFESLN
Ga0075492_100353523300006394AqueousMVPKIIDPNFNIKTFNIKCDSELSPLAKVILKSFKFKLYYYIVDDLLYLLKSNPDERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKFNRFVNEQSESFKVSNMITIKLAYQVKPVTKKLETTW*
Ga0075492_101992143300006394AqueousMVPKIIDPNFNIKTFNVKCDMELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIYLQNNLYVNFFDIYIYDIKITEISKFNRFVNEQSEAFKASNMITIKLAYQVKPITKNLKLLGNKS*
Ga0075492_147333423300006394AqueousMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKTNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISNFNRFVNEQSESFELSNTITIKLAYQVKPVPKKLETIW*
Ga0075493_107639693300006396AqueousMVQKIMDPNFHIKTFNVKCDKKLSSLAITILQSFKFKLYYYVMDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDISINEISKFNRFVNTQSESFKVSTTITIKLAYQVKPVTKKLETTW*
Ga0075488_141930423300006397AqueousMVQKIIDPNFHIKTFNVKYENKLSPLSKIILQSFKFKFYYYVIDDLLYLLKSNPDERNYLLKILHSSAIYLQNNLYVNFFDIYIYDITINEVSNQNRFIKNKSDQFKVFNNITIKLGYQVKPITKKLETNW*
Ga0101390_100043623300006562MarineMVQKIIDPNFHIRTFNVKCDKALSPLLKTILKSFNFKLYYYVIDDLLYLLKSNPDECDSILKILNSSVLFLQNNFHVNFFDIYLYEINIIERSKSNRFINEEPKNFQNSTYLNIKLAYQVKSIQKKFETIW*
Ga0075505_151045343300006571AqueousMVPKVNDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKTNQTEANQLLQILHSTVIYLQNNLHVNFFDIYVYEISITEKQNMNKFIQNSSDYFESLNYLTIKLAY
Ga0075467_1006703523300006803AqueousMVPKVNDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKTNQTEANQLLQILHSTVIYLQNNLHVNFFDIYVYEISITEKQNMNKFIQNSSDYFESLNYLTIKLAYQVKPISKKLELVW*
Ga0075467_1031608613300006803AqueousMVQKIVDPNFNIKTFNVKCDNELSSLAKTIIKSFKFKLYYYVMDDLVYLLKSNPTERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKFNRFVNTQSESFKVSTTITIKLAYQVKPVTKKLETTW*
Ga0075467_1058625813300006803AqueousMVPKIIDPNFNIKTFNVKCDMELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIYLQNNLYVNFFDIYIYDIKITEISKFNRFVNEQSEAFKASNMITIKLAYQVKPITKKLETTW*
Ga0102976_118530413300007169Freshwater LakeMVQKIVDPKFNIKSFNIKYDTQLSPLAKTILKSFKFKLYYYVIDDLFYLLKSNIQERDYLLKILHSSVIFLHNNLYVNFFDIYIYEITINEVAKLNRFVDQQSKEYKVSNDITIKLAYQVKPITKKLETIW*
Ga0103274_106969923300007202Freshwater LakeMVQKIVDPNFKIKSFNIKYDNQISAVAKTVLQSFKFKLYYYVIDDFLYLLKSNIQERDYFLQILHSSAIFLHNNLYVNFFDIYIYEIGINEVKNFNRFVDPQSDKDQISNYITIKFAYQVKPVTKKFETVW*
Ga0102853_110063823300007543EstuarineMVQKIMDPNFHIKTFNVKCDKKLSSLAITILQSFKFKLYYYVMDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNEQSELFKVSNNITIKLD
Ga0102881_107904523300007551EstuarineMVQKIMDPNFHIKTFNVKCDKKLSSLAITILQSFKFKLYYYVMDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFKFSNTITIKLAYQVKPIPKKLETIW*
Ga0102818_100061523300007552EstuarineMVQKIIDPNLHIKTFNVKCDKKLSPFTKTILQSFKCKLYYYVIDDLLYLLKSNPDERDYLLQILHSTVIFLQNNLYVNFFDIYVYDIAINEVSNFNRFVNDQTGQFKVSNNIIIKFAYQIKPITKKLETVW*
Ga0102817_104022623300007555EstuarineMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKTNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFELSNTITIKLAYQVKPVPKKLETIW*
Ga0102825_100804323300007655EstuarineMVQKVVDPKFNIRTFNIKCDKNLSPLAKIIIKSFKFKLYYYVIDDLLYLLKSNPEERDYLLQTLHSTVLFLQNSLYINFFDIYIYDISIDEVSNSNRFINRKSEQFQISNNITIKLAYQVKSVTKKLETTW*
Ga0102825_110896413300007655EstuarineVAQKVIDPNYQIKTFTVQYDKQLSTLTKTLIQSFKLKLYYYVIDDILYFLKSNETERDYLLQLLHSSVIFLQNNLHASFFDIYIYDIHINENFKENRFVKDKLKQFKASNTITIKLAYQVKPITRKVETIW*
Ga0102908_104642733300007665EstuarineMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFKFSNTITIKLAY
Ga0102910_115686113300007667EstuarineGKFSMVQKVVDPKFNIRTFNIKCDKNLSPLAKIIIKSFKFKLYYYVIDDLLYLLKSNPEERDYLLQTLHSTVLFLQNSLYINFFDIYIYDISIDEVSNSNRFINRKSEQFQISNNITIKLAYQVKSVTKKLETTW*
Ga0102867_116562113300007716EstuarineMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNLEELDNLLQLLNSSVIFLQNNLYVNFFDIYIYDISINEISKINRFVNEQPESFKLSNTITIKLAYQVTAVPKKLETIW*
Ga0105740_103716423300007955Estuary WaterMKNIKGFEGNNIKTFNVKCDNELSSLAKVILKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKVNRFVKEQSESFKVSNMITIKLAYQVKPVTKKLETTW*
Ga0105743_102736523300007958Estuary WaterMVSKIVDPNFNIKTFNVKCDNELSSLAKVILKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKVNRFVKEQSESFKVSNMITIKLAYQVKPVTKKLETTW*
Ga0102904_100510023300007981EstuarineMVQKIVDPNFHIKTFNVKCDAKLSPLAKTILSSFKFKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFKFSNTITIKLAYQVKPIPKKLETIW*
Ga0102904_100561933300007981EstuarineMVQKVIDPTYHIKTFSVQYDKQLSPLTKNLIQSFKLKLYYYVIDDILYLLKSNQTERDYLLQLLHSSVILLQNNLHVNFFDIYIYDININEKFKENRFVKDESKQFKASNIITIKLAYQVKPITRKVETIW*
Ga0102904_100635333300007981EstuarineMVPKINDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKSNQKEANQLLQILHSTVIYLQNNLYVNFFDIYVYEVSISEKSNSNKFVKNSTDYFESLNYLTIKMAYQVKPISKKLESIW*
Ga0115371_10142590163300008470SedimentMVQKIMDPNFHIKTFNVKCDKKLSPLAITILQSFKFKLYYYVMDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNEQSELFKVSNTITIKLAYQIKPVPKKLETIW*
Ga0103733_100011943300008930Ice Edge, Mcmurdo Sound, AntarcticaMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKYKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFKTSNTITIKLAYQVKPVPKKLETIW*
Ga0104259_102521413300008958Ocean WaterMVPKIVDPNFNIKTFNVKCDSQLSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKFNRFVNTQSESFKVSTTITIKLAYQVKPVTKKLETTW*
Ga0102888_100694533300008995EstuarineMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFKFSNTITIKLAYQVKPIPKKLETIW*
Ga0102826_114500713300009054EstuarineMVQKIVDPNFSIKTFNVKCDNKLSPLAKIILKSFKFKLYYYVIDDLLYLLKSNPNERDYLLQILNASVIFLQNNLYVNFFDIYIYDISINEASKFNRFVNEQSESFKVSNTITIKLAYQVKPVTKKLETTW*
Ga0115549_106828113300009074Pelagic MarineMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFNFKLYYYVIDDLLYLLKSNPKERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNEQSESFKFSNTITIKLAYQVKPVPKKLETIW*
Ga0102814_1067053423300009079EstuarineVKYDNKISILAKTVLQSFKFKLYYYVIDDLLYLLKSNIQERDYFLQILNSSAIFLHNNLYVNFFDIYIYEIGINEVKNLNRFIDSESDKYQISNYITIKFAYQVKPVIKKFETIW*
Ga0102815_1009621033300009080EstuarineMELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIYLQNNLYVNFFDIYIYDIKITEISKFNRFVNEQSEAFKASNMITIKLAYQVKPITKKLETTW*
Ga0114969_1033170113300009181Freshwater LakeGNFSMVQKIADPNFNIKSFNIKYDNSISILSKTVLQSFKFKLYYYVIDDLSYLLKSNIQERDSFLQILHSSAIFLHNTLYVNFFDIYIYEIVINEVKNLNRFVDRQSNKDQISNYITIKFAYQLKPVTKKYETVW*
Ga0103851_110490813300009225River WaterMVQKIVDPNFNIKSFTVKYDNKISLLAKTILQSFKFKLYYYVIDDLLYLLKSNIQERDYFLQIFHSSAIFLHNNLYVNFFDIYIYEIVINEVKNLNRFVDPQSDKCQISNYITIKFAYQVKSIAKKIETVW*
Ga0103873_106393923300009265Surface Ocean WaterMVQKIVDPSFHIKTFNVKCDTKLSPIAKTILQSFKYKLYYYVIDDLFYLLKSNPEERDYLLQILNSSAIFLHNNLYVNFFDIYIYDITINEISKCNRFVNDTSESFKVSNSLTIKLAYQVKPVPKKLESIW*
Ga0103843_10009313300009327River WaterMVQKIVDPNFHIKTFNVKCDTKLSPIAKTILQSFKYKLYYYVIDDLFYLLKSNPEERDYLLQILNSSAIFLHNNLYVNFFDIYIYDITINEISKCNRFVNDTSESFKVSNSLTIKLAYQVKPVPKKLESIW*
Ga0103847_100813913300009353River WaterVDPNFYIKTFNVKCDDKLSPLAKTILQSFKFKLYYYVIDDLFYLLKSNPEERDYLLQILNSSAIFLHNNLYVNFFDIYIYDITINEISKCNRFVNDTSESFKVSNSLTIKLAYQVKPVPKKLESIW*
Ga0115005_1000253753300009432MarineMVPKFNDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKTNQNEANQLLQILHSTVIYLQNNLYVNFFDIYVYEINITEKQNLNKFIQNSSDYFESLNYLTIKLAYQVKPISKKLESVW*
Ga0115005_1000567353300009432MarineMVQKIVDPNFHIKTFNVKCDSKLSPLAKPILQSFKFKLYYYVIDDLLYLLKSNPNERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNEQSELFKLSNTITIKLAYQVKVVPKKLETIW*
Ga0115005_1070444633300009432MarineMVPKIVDPNFNIKTFNVKCDSELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPKERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEVSNFNRFVNEQSESFKVSNTITIKLAYQVKP
Ga0115008_10000423343300009436MarineMVSKIIDPNFNIKTFNVKCDNELSSLAKVILKSFKFKLYYYIVDDLLYLLKSNPQERDYLLQMLHSSVIFLQNNLYVNFFDIYIYDISINEISKYNRFVNEQSEPFKVSNTITIKLAYQVKPVTKKLETTW*
Ga0115008_1002459773300009436MarineMVQKIMDPNFHIKTFNVKCDKKLSSLAITILQSFKFKLYYYVMDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDISINEISKFNRFVNEQSELFKVSNTITIKLAYQIKPVPKKLETIW*
Ga0115008_1015131223300009436MarineMVPKINDTKFNIKTFNIRYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKSNQKEANQLLQILHSTVIYLQNNLYVNFFDIYVYEVSISEKSNSNKFVKNSTDYFESLNYLTIKLAYQVKPISKKLESIW*
Ga0115008_1016351913300009436MarineMVQKIIDPNFHIKTFNVKCDDKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQLLNSSVIFLQNNLYVNFFDIYIYDITINEVSKFNRFVNEQSKSFKVSNTLTVKLAYQVKPVQKKLETIW*
Ga0115008_1030834523300009436MarineMVQKVIDPTYHIKTFSVQYDKQLSPLTKSLIQSFKLKLYYYVIDDILYLLKSNQTERDYLLQLLHSSVIFLQNNLHVNFFDIYIYDININEKFKENRFVKDESKQFKASNIITIKLAYQVKPITRKVETIW*
Ga0115557_126136323300009443Pelagic MarineVVSKIIDPNFNIKTFNVKCNHELSSFAKVILQSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKINRFVNEQPESFKLSNTITIKLAYQVTAVPKKLETIW*
Ga0115560_141874113300009447Pelagic MarineLAKTILQSFNFKLYYYVIDDLLYLLKSNPKERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNEQSESFKFSNTITIKLAYQVKPVPKKLETIW*
Ga0115099_1018176523300009543MarineMVSKIVDPNFNIKTFNFKCDNELSSLAKVILKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKVNRFVKEQSESFKVSNMITIKLAYQVKPVTKKLETTW*
Ga0115099_1019652723300009543MarineMIQKIIDPNFHIRSFNVRCDKKLSSRTKIIIESFKFKLYYYVIDDLLYLLKSNPDERDYFLKVLHSIVIFIQNNLYVNFFDIYIYDITINEAPKFNRFIANQKNPFKVSNNIIIKFAYQIKPVPKKLETIW*
Ga0115099_10277590283300009543MarineMVQKIVDPNLHIKTFNVKCDKKLSPLAKIIIQSFKCKLYYYVIDDLLYLLKSNPDERDYLLQILHSTVIFLQNNLYVNFFDVYIYDITINEVSNFNRFVNDQTEQIKVSNNIIIKLAYQIKPVTKKLETIW*
Ga0115099_1034795813300009543MarineMVQKIIDPNYHIKTFSVKCDSKLSPLAKTILQSFNFKLYYYVIDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEVSKFNRFVSKQSNSFKVSNIITIKLAYQIKPVQKKLETIW*
Ga0115099_10577665173300009543MarineMELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIYLQNNLYVNFFDIYIYDIKITEISKFNRFVNEQSEAFKASNMITIKLAYQVKPITKNLKLLGNKS*
Ga0115099_1059044573300009543MarineMVQKIIDPNFHIKTFNVECDDKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQLLNSSVIFLQNNLYVNFFDIYIYDITINEVSKFNRFVNEQSKSFKVSNTLTVKLAYQVKPVQKKLETIW*
Ga0115099_10626582303300009543MarineMVQKIINPNFNIKTFNIKCENKLSPLAKTIIKSFKFKLYYYVVDDLLYLLKSNPTELNYLLQILHSTVIFLQNNLYVNFFDIYVYDISINEVSKFNRLVNHQSDYFKVSNDITIKLAYQVKPITKKLETIW*
Ga0115101_135023363300009592MarineMVQKIVDPNFHIKTFNVKCDDKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDISVNQISKFNRFVNEQSESFKISNTITIKLAYQVKSVPKKLETIW*
Ga0115011_1001051833300009593MarineMVPKINDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKSNQKEANHLLQILHSTVIYLQNNLYVNFFDIYVYEVSISEKSNSNKFVKNSTDYFDSLNYLTIKLAYQVKPISKKLESVW*
Ga0115103_132245463300009599MarineMVPKINDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKTNQTEANQLLQILHSTVIYLQNNLHVNFFDIYVYEISITEKQNMNKFIQNSSDYFESLNYLTIKLAYQVKPISKKLELVW*
Ga0115103_167701633300009599MarineMVSKIIDPNFNIKTFNVKCNHELSSFAKVILQSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLHVNFFDIYIYDISISEISKFNRFVNEQSKSFNVSNTITIKLAYQVKPVTKKLETTW*
Ga0115103_186287023300009599MarineMVSKIVDPNFNIQTFNIKCDNELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSKPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNDQSKSFKVSTMITIKLAYQVKPVRKKLETTW*
Ga0115102_1004623623300009606MarineMVPKIVDPNFNIKTFNVKCDSELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPKERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEVSNFNRFVNEQSESFKVSNTITIKLAYQVKPVTKKLETTW*
Ga0115102_1009835523300009606MarineMVSKIIDPNFNIKTFNVKCDNELSSLAKVILKSFKFKLYYYIVDDLLYLLKSNPQERDYLLQMLHSSVIFLQNNLYVNFFDIYIYDISINEISKYNRFVNEQSEPFKVTNTITIKLAYQVKPVTKKLETTW*
Ga0115102_10269411183300009606MarineMVQKIIDPNLHIKTFNVKCDKKLSPFTKIILQSFKCKLYYYVIDDLLYLLKSNPDERDYLLQILHSTVIFLQNNLYVNFFDIYIYDIAINEVSNFNRFVNDQTGQFKVSNNIIIKFAYQIKPITKKLETVW*
Ga0115102_1037132743300009606MarineMVSKIVDPNFNIKTFNVKCDKELSSLAKAILKSFKFKLYYYVVDDLLYLLNSNPDERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKFNRFVHEQSESFKVSNTITIKLAYQIKPITKKLETTW*
Ga0115102_1039466033300009606MarineIKTFNVECDDKLSPLAKTILQSFKFKLYYYVIDDFLYFLKLNLDECDYLLQLLNSSVIFLQNNLYVNFFDIYIYDITINEVSKFNRFVNEQSKSFKVSNTLTVKLAYQVKPVQKKLETIW
Ga0115102_1088969933300009606MarineMVQKIINPNFNIKTFNIKCENKLSPLAKTIIKSFKFKLYYYVVDDLLYLLKSNPTELNYLLQILHSTVIFLQNNLYVNFFDIYVYDISINEVSQFNRLVNHQSDYFKVSNDITIKLAYQVKPITKKLETIW*
Ga0123377_101746823300009735MarineMVQKIIDPNFHIKTFNVKCDKALSPLLKTILKSFKFKLYYYVIDDLLYLLKSNPNECDSILKILNSSVLFLQNNFHVNFFDIYLYEINIIERSNSNRFINEEPKNF
Ga0132221_100095833300009911Meromictic PondMVQKIFDPNFNIKTFNIKSENKLSPLAKTIIKSFKFKLYYYGVDDLLYLLKGNPQEVDYLLRILHSSAIFLQNNLHVNYFDIYIYEITINEVEKVNRFVNAKSEQFKVSNYITIKLAYQLKPITKKLEAVW*
Ga0129322_105724233300010306AqueousVVSKIIDPNFNIKTFNVKCNHELSSFAKVILQSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLHVNFFDIYIYDISISEISKFNRFVNEQSKSFNVSNTITIKLAYQVKPVTKKLETTW*
Ga0136553_1000053433300011186Saline LakeMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKYKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFKVSNTITIKLAYQVKPVPKKLETIW*
Ga0123369_100397733300012370MarineMVPKIVDPNFNIKTFNVKCDSELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPKERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISNFNRFVNEQSESFKVSNTITIKLAYQVKPVTKKLETTW*
Ga0123369_106774623300012370MarineMVSKIVDPNFNIKTFNVKCNHELSSFAKVILQSFKFKLYYYIVDDLLYLLKSNPEERDYLLEILHSSVIFLQNNLHVNFFDIYIYDISINEISKFNRFVNEQAKSVNVSNTITIKLAYQVKPITKKLESAW*
Ga0123369_107842023300012370MarineMVSKIVDPNFNIKTFNVKCNTELSSFAKVILQSFKFKLYYYIIDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLHVNFFDIYVYDISINEISKFNRFVNEQSKSFNVSNTITIKLAYQVKPVTKKLETTW*
Ga0138259_155367233300012416Polar MarineMVPKLNDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKSNQKEGNQLLQTLHSTVIYLQNNLYVNFFDIYVYEVSISEKQNSNKFIKNSSDYF*
Ga0138261_138593433300012418Polar MarineMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKYKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFKTSNTITIKLAYQVKPVPKKIRNNMVTRSV*
Ga0138260_1021738623300012419Polar MarineMVQKIVDPNFHIKTYNVKCDNKLSPLAKTILQSFKYKLYYYVIDDLLYLLKSYPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFK
Ga0129347_1159127253300012504AqueousMVPKIMDPNFNIKTFNVECHSELSSFTKVILKNFKFKLYYYIVDDLLYLLKSNPEERDYILQILHSSVIFLQNNLHVNFFDIYIYDITINEISKFNRFVNEQSNSFKVSNMITIKLAYQVKPITKKLETTW*
Ga0129347_123824013300012504AqueousPIAKTILQSFKYKLYYYVIDDLFYLLKSNPEERDYLLQILNSSAIFLHNNLYVNFFDIYIYDITINEMSKCNRFVNDTSESFKVSNSLTIKLAYQVKPVPKKLESIW*
Ga0129325_113180613300012516AqueousMVPKINDTKFNIKTFNIRYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKSNQKEANQLLQILHSTVIYLQNNLYVNFFDIYVYEVNISEKSNSNKFVKNSTDYFES
Ga0138279_108372063300012769Freshwater LakeMIQKIVDPTFNIKSFNVKYDNKISILAKTVLQSFKFKLYYYVIDDLLYLLKSNIQERDYFLQILHSSAIFLHNNLYVNFFDIYIYEIGINEVKNLNRFVDPQSDNYQTSNYITIKFAYQVKPLTKKFETVW*
Ga0171649_15567713300013109MarineMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFNFKLYYYVIDDLLYLLKSNPKERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNEQSESFKFSNTITIKLAYQVKPVPKKL
(restricted) Ga0172367_10034408103300013126FreshwaterMVQKIIDPTFKIKSFNIKYDDKISMLAKTVLQSFKFKLYYYVIDDLLYLLKSNIQERDYFLQILHSSAIFLHNNLYVNFFDIYIYEIVINEVKNLNKFVNPESAKSQISNCITVKFAYQVKPITKKFETIW*
Ga0170791_1024382763300013295FreshwaterMVQKIADPNFNIKSFNIKYDNSISILSKTVLQSFKFKLYYYVIDDLSYLLKSNIQERDSFLQILHSSANFLHNNLYVNFFDIYIYEIVINEVKNLNRFVDRQSNKDQISNYITIKFAYQLKPVTKKYETVW*
Ga0186073_10001863300016916Host-AssociatedLFLHELLKRILKQIEKQNDKENCSMVQKIVDPNFNIKTFNVKCDNELSSLAKTIIKSFKFKLYYYVMDDLVYLLKSNPTERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISLNEKSKFNRFITEQSTSFKVSNTITIKLAYQVKPVTKKLETTW
Ga0181419_111191023300017728SeawaterKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKTNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISNFNRFVNEQSESFELSNTITIKLAYQVKPVPKKLETIW
Ga0181416_101973833300017731SeawaterMVQKIMDPNFHIKTFNVKCDKKLSSLAITILQSFKFKLYYYVMDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNEQSELFKVSNTITIKLAFIQIGR
Ga0181418_100013863300017740SeawaterMVQKVVDPNFHVKTFNVKCDKKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSRIDERDYLLQILNSTVIFLQNNLYVNFFDIYIYDISINEVSKFNRFVNEQSKLFKVSNTITIKLAYQIKPVPKKLETIW
Ga0181430_104695433300017772SeawaterMVSKIVDPNFNIKTFNVKCDNELSSLAKVILKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKVNRFVKEQSESFKVSNMITIKLAYQVKPVTKKLETT
Ga0181430_121465113300017772SeawaterNLSMVQKIVDPNLHIKTFNVKCDKKLSPLAKIIIQSFKCKLYYYVIDDLLYLLKSNPDERDYLLQILHSTVIFLQNNLYVNFFDVYIYDITINEVSNFNRFVNDQTEQIKVSNNIIIKLAYQIKPVTKKLETIW
Ga0181386_1000117123300017773SeawaterMVPKIVDPNFNIKTFNVKCESELSPLAKVVLKSFKFKLYYYIVDDLLYLLKSNSKERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISNFNRFVKEQSESFKVSNMITIKLAYQVKPITKKLETTW
Ga0181386_101258363300017773SeawaterMVQKIVDPNFHIKTFNVKCDDKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDISVNQISKFNRFVNEQSESFKISNTITIKLAYQVKSVPKKLETIW
Ga0181380_1000073173300017782SeawaterMVSKIVDPNFNIKTFNVKCDNELSSLAKIVLKSFKFKLYYYTVDDLLYLLKSKPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNDQSKSFKVSTIITIKLAYQVKPVRKKLETSW
Ga0169931_10001421433300017788FreshwaterMVQKIVDPYFHIQTFNVKVDKQLSPIAETILKSFKYKLYYYVIDDLLYLLKSDPNERDYLLNILHSSVIFLQNNLYVNFFDIYVYEININEISKFNRFINEDSKSYQKSTEITIKLAYQVKTISKKLETIW
Ga0169931_10001441433300017788FreshwaterMVQKIIDPTFKIKSFNIKYDDKISMLAKTVLQSFKFKLYYYVIDDLLYLLKSNIQERDYFLQILHSSAIFLHNNLYVNFFDIYIYEIVINEVKNLNKFVNPESAKSQISNCITVKFAYQVKPITKKFETIW
Ga0180436_1025123633300017990Hypersaline Lake SedimentMVQKIVDPNFHIQTFNVKSDIQLSPVSIILLKSFNYKLYYHVIDDLFYLLKSYPNERDYLLKILHSSVIFLQNNLYVNFFDVYVYQINIERISNFNRFLNQQSQSYKNTIHITIQLAYQVKPISKKLEAIW
Ga0192960_100003233300018515MarineMVQKIIDPNLHIKTFNVKCDKKLSPFTKTILQSFKCKLYYYVIDDLLYLLKSNPDERDYLLQILHSTVIFLQNNLYVNFFDIYIYDIAINEVSNFNRFVNDQTGQFKVSNNIIIKFAYQIKPVTKKLETVW
Ga0192960_10000563300018515MarineMVPKVNDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKTNQTEANQLLQILHSTVIYLQNNLHVNFFDIYVYEISITEKQNMNKFIQNSSDYFESLNYLTIKLAYQVKPISKKLELVW
Ga0192960_10003663300018515MarineMVPKINDTKFNIKTFNIRYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKSNQKEANQLLQILHSTVIYLQNNLYVNFFDIYVYEVNISEKSNSNKFVKNSTDYFESLNYLTIKLAYQVKPISKKLESIW
Ga0192960_10005493300018515MarineMVQKIIDPNFHIKTFNVKCDDKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQLLNSSVIFLQNNLYVNFFDIYIYDITINEVSKFNRFVNEQSKSFKVSNTLTVKLAYQVKPVQKKLETIW
Ga0192960_10447213300018515MarineMVQKIVDPNFHIKTFNVKCDDKLSPLAKTILSSFKFKLYYYVIDDLLYLLKSNLEERDYLLQILNSSVIFLQNNLYVNFFDIYIYDISINEISKINRFVNEQPESFKLSNTITIKLAYQVTAVPKKLETIW
Ga0192960_10509123300018515MarineMVPKLNDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKTNQNEANQLLQILHSTVIYLQNNLYVNFFDIYVYEISITEKQNLNKFIQNSSDYFESLNYLTIKLAYQVKPVSKKLESVW
Ga0193035_100815213300018597MarineMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFNFKLYYYVIDDLLYLLKSNPKERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNEQSESFKFSNTITIKLAYQVKPVPKKLETIW
Ga0192881_101639823300018603MarineMVQKIVDPNFHIKTFNVKCDTKLSPIAKTILQSFKYKLYYYVIDDLFYLLKSNPEERDYLLQILNSSAIFLHNNLYVNFFDIYIYDITINEISKCNRFVNDTSESFKVSNSLTIKLAYQVKPVPKKLESIW
Ga0188875_100005393300018629Freshwater LakeMVQKIIDPNFHIKTFNVKCDKALSPLLKTILKSFKFKLYYYVIDDLLYLLKSNPDECDSILQTLNSSVLFLQNNFHVNFFDIYLYEINIIEQSKSNRFINEELNYFQNSIYLNIKFAYQVKSVQKKFETIW
Ga0188873_100015853300018632Freshwater LakeMVQKIIDPNFHIKTFNVKCDKILSPLLKTILKSFKFKLYYYVIDDLFYLLKSNHDEREYILQLLNSSVVFLQNNLYVNYFDIYIYDINIIEKPKLNRFISEKEDSFQLSNYLTLKLAYQVKPVPKKLETIW
Ga0192969_105329323300018649MarineMVQKIMDPNFHIKTFNVKCDKKLSPLAITILQSFKFKLYYYVMDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNEQSELFKVSNTITIKLAYQIKPVPKKLETIW
Ga0192848_101850013300018662MarineMVQKIVDPKFNIRTFNIKCDKNLSPLAKIIIKSFKFKLYYYVIDDLLYLLKSNPEERDYLLQILHSTVLFLQNSLYINFFDIYIYDISIDEVSNSNRFINRNSQQFQVSNNITIKLAYQAKSVTKKLETTW
Ga0193137_102418613300018676MarineMVSKIVDPNFNIKTFNVKCNHELSSFAKVILQSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLHVNFFDIYIYDISINEISNFNRFVNNQSKSFNVSNTITIKLAYQVKPITKKLETTW
Ga0192983_100038643300018684MarineMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKYKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFKTSNTITIKLAYQVKPVPKKLETIW
Ga0192983_100519333300018684MarineMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKYKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFKVSNTITIKLAYQVKPVPKKLETIW
Ga0192917_105509413300018690MarineMVPKIVDPNFNIKTFNVKCESELSPLAKVVLKSFKFKLYYYIVDDLLYLLKSNPKERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISNFNRFVKEQSASFKVSNMITIKLAYQVKPITKKLETTW
Ga0193236_101368823300018698MarineMVQKIIDPNFHIKTFNVKCDDKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNLEERDYLLQLLNSSVIFLQNNLYVNFFDIYIYDITINEVSKFNRFVNEQSKSFKVSNTLTVKLAYQVKPVQKKLETIW
Ga0193195_103538213300018699MarineMVQKIVDPNFHIKTFNVKCDTKLSPIAKTILQSFKYKLYYYVIDDLFYLLKSNPEERDYLLQILNSSAIFLHNNLYVNFFDIYIYDININEISKCNRFVNETSESFKVSNSLTIKLAYQVKPVPKKLEIIW
Ga0193069_100010913300018711MarineMVPKINDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKSNQKEANHLLQILHSTVIYLQNNLYVNFFDIYVYEVSISEKSNSNKFVKNSTDYFDSLNYLTIKLAYQVKPISKKLESVW
Ga0193069_100070733300018711MarineMVSKIVDPNFNIQTFNVKCDNELSPLAKVVLKSFKFKLYYYIVDDLLYLLKSKPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNDQSKSFKVSTMITIKLAYQVKPLRKNLRLLGNKI
Ga0193069_104163413300018711MarineMVSKIVDPNFNIKTFNVKCNHELSSFAKVILQSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLHVNFFDIYIYDISINEISNFNRFVNNQSKSFNVSNTITIKLAYQVKPITKKLESTW
Ga0193038_100860533300018723MarineMVPKIIDPNFNVKTFNVKCNHEISSVAKVILKSFKFKLYYYVVDDLLYLLKSNPEERDYLLQMLHSSVIFLQNNLYVNFFDIYIYDISINEISKFNRFVNDKSKSFNVSNTITIKLAYQVKPITKKLETTW
Ga0192950_100031313300018791MarineMVPKLNDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKSNQKEGNQLLQTLHSTVIYLQNNLYVNFFDIYVYEVSISEKQNSNKFIKNSSDYFESLNYLTIKLAYQVKPISKKLESIW
Ga0192872_103974613300018813MarineMVQKIVDPNFHIKTFNVKCDTKLSPIAKTILQSFKYKLYYYVIDDLFYLLKSNPEERDYLLQILNSSAIFLHNNLYVNFFDIYIYDININEISKCNRFVNETSESFKVSNSLTIKLAYQVKPVPKKLESIW
Ga0193083_1000882433300018927MarineMVPKIVDPNFNIKTFNVKCDSELSSLTKVVLKSFKFKLYYYIVDDLLYLLKSNPKERDYLLQILHSSVIFLQNNLHVNFFDIYIYDISVNEISNFNRFVNEQSESFKVSNMITVKLAYQVKPVTKKLETTW
Ga0193083_1002205833300018927MarineMVQKIVDPKFNIRTFNIKCDKNLSPLAKIIIKSFEFKLYYYVIDDLLYLLKSNPDERDYLLQTLHSTVIFLQNSLYINYFDIYVYDISISEVSNFNRFINQKSEQFQISNNITIKLAYQVKPITKKLETTW
Ga0193083_1006630613300018927MarineMVQKIVDPNFHIKTFNVKCDTKLSPIAKTILQSFKYKLYYYVIDDLFYLLKSNPEERDYLLQILNSSAIFLHNNLYVNFFDIYIYDININEISKCNRFVNDTSESFKVSNSLTIKLAYQVKPVPKKLESIW
Ga0193552_1016256313300018934MarineMVSKIVDPNFNIQTFNVKCDKELSPLAKVVLKSFKFKLYYYIVDDLLYLLKSKPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISNFNRFVNEQSESFKVSNTITIKLAYQVKPVTKKLETTW
Ga0193426_1006492633300018942MarineMVQKIIDPKFNIRTFNIKYDKNLSPLVKILIKSFKFKLYYYVIDDLLYLLKSTPDERDYLLQTLHSTVIFLQNSLYINYFDIYVYDISINEVSKFNRFINQKSEHFQVSNNITIKLAYQV
Ga0193087_1024706313300018964MarineIVDPNFNIKTFNVKCDSELSSLTKVVLKSFKFKLYYYIVDDLLYLLKSNPKERDYLLQILHSSVIFLQNNLHVNFFDIYIYDISVNEISNFNRFVNEQSESFKVSNMITVKLAYQVKPVTKKLETTW
Ga0192961_1000047433300018980MarineMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKTNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISNFNRFVNEQSESFELSNTITIKLAYQVKPVPKKLETIW
Ga0192961_1000047933300018980MarineVAQKVIDPNYQIKTFTVQYDKQLSTLTKTLIQSFKLKLYYYVIDDILYFLKSNETERDYLLQLLHSSVIFLQNNLHASFFDIYIYDIHINENFKENRFVKDKLKQFKASNTITIKLAYQVKPITRKVETIW
Ga0192961_1000048033300018980MarineMVQKVIDPTYHIKTFSVQYDKQLSPLTKSLIQSFKLKLYYYVIDDILYLLKSNPTERDYLLQLLDSSVIFLQNNLHVNFFDIYIYDISINEKFKENRFVKDQSKQFKASNIITIKLAYQVKPITRKVETIW
Ga0192961_1000049163300018980MarineMIQKVSDPTYHIKTFRIDYDKQLSLFTKNILQSFKLKLYYYVIDDILYLLKSIPTERDYFLQLLHSSVIFLHNNFYVNFFDIYIYDINIHEKVKENRFIKDPSNQFKVSSIITIKLAYQVLPIRQKVETTW
Ga0192961_1000049553300018980MarineMVQKIIDPNYHIKTFSVKCDNKLSPLAKTILQSFNFKLYYYVIDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEVSEFNRFVNKQSNSFKVSNTITIKLAYQLKPVQKKLETIW
Ga0192961_1000049653300018980MarineMVQKIIDPNYHIKTFSVKCDNKLSPLAKTILQSFNFKLYYYVIDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEVSKFNRFVNEQSNSFKVSNIITIKLAYQIKPVQKKLETIW
Ga0192961_1000108233300018980MarineMVQKIVDPNFHIKTFNVKCDDKLSPLAKTILSSFKFKLYYYVIDDLLYLLKSNLEERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISKINRFVNEQPESFKLSNTITIKLAYQVTAVPKKLETIW
Ga0192961_1000456743300018980MarineMVQKIVDPNFNIKTFNVKCDNKLSPLAKIILKSFKFKLYYYVIDDLLYLLKSNPNERDYLLQILNASVIFLQNNLYVNFFDIYIYDISINEASKFNRFVNEQSESFKVSNTITIKLAYQVKPVTKKLETTW
Ga0192961_1001982013300018980MarineMVPKIIDPNFNIKTFNVKCDMELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIYLQNNLYVNFFDIYIYDIKITEISKFNRFVNEQSEAFKASNMITIKLAYQVKPITKKLETTW
Ga0192961_1018624423300018980MarineMVPKIVDPNFNIKTFNVKCDSQLSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPKERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKFNRFVNTQSESFKVSTTITIKLAYQVKPVTKKLETTW
Ga0193136_1000882413300018985MarineMVSKIVDPNFNIKTFNVKCNHELSSFSKVILQSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLHVNFFDIYIYDISINEISNFNRFVNNQSKSFNVSNTITIKLAYQVKPITKKLETTW
Ga0192916_1012457723300018996MarineMVQKIVDPKFNIKTFSIKCDKNLSPLAKILIKSFKFKLYYYVIDDLLYLLKSNPDERDYLLQTLHSTVIFLQNSLYINYFDIYVYDISISEVSKFNRFINEKSEQFQISNNITIKLAYQVKPVTKKLETTW
Ga0193514_1003151333300018999MarineMVPKIIDPNFNIKTFNVKCDKELSSLAKTILKSFKFKLYYYTVDDLLYLLKSNPEERDYLLQILHSSIIFLQNNLCVNFFDIYIYDISINEISKFNRFVKEQSESFQVSNMITIKLAYQLKPVTKKLETTW
Ga0193514_1014278733300018999MarineMVSKIVDPNFNIKTFNVKYDNELSSLAKVILKSFKFKLYYYIVDDLLYLLKSKPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNDQSKSFKVSTMITIKVAYQVKPVRKKLETTW
Ga0193514_1017707523300018999MarineMVQKVVDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYIIDDLFYLLKSNRDERDYLLQILNSTVIFLQNNLYVNFFDIYIYDISINEISKFNRFVNEESKLFKVSNTITIKLAYQIKPVPKKLETIW
Ga0193196_1002861433300019007MarineMVSKIIDPNFNIKTFNVKCNYELSSFAKVILQSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLHVNFFDIYIYDISISEISQFNRFVTEQSKSFNVSNTITIKLAYQVKPITKKLETTW
Ga0193196_1012717813300019007MarineMVSKIVDPNFNIKTFNVKCDNELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSKPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNDQSKSFKVSTMITIKLAYQVKPVRKKLETTW
Ga0193196_1026156523300019007MarineMVQKIVDPKFNIRTFNIKCDKNISPLAKIITKSFKFKLYYYVIDDLLYLLKSNPDECAYLLQTLHSTVLFLQNSLYINYFDIYIYDISIDEVSKVNRFINRKSDQFQVSTNITIKLAYQVKSVTKKFETTW
Ga0192880_1000629653300019009MarineMVPKIVDPNFNIKTFNVKCDSELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPKERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISNFNRFVNEQSESFKVSNMITVKLAYQVKPVTKKLETTW
Ga0192880_1001908323300019009MarineMVQKIIDPNFHIKTFNVKCDDKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQLLNSSVIFLQNNLYVNFFDIYIYDITINEVSKFNRFVNEQSKSFKVSNTLTIKLAYQVKPVQKKLETIW
Ga0192982_1003624213300019021MarineMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKYKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFK
Ga0192869_1032698913300019032MarineMVQKIVDPNFHIKTFNVKCDTKLSPIAKTILQSFKYKLYYYVIDDLFYLLKFNPEERDYLLQILNSSAIFLHNNLYVNFFDIYIYDININEISKCNRFVNDTSESFKVSNSLTIKLAYQVKPVPKKLESIW
Ga0192857_1000846933300019040MarineMVQKIVDPKFNIRTFNIKCDKNLSPLAKIIIKSFKFKLYYYVIDDLLYLLKSNQEERDYLLKTLHSTVIFLQNSLHINYFDIYVYDISINKVPRFNRFINQKSEQFQVSNNITIKLAYQVKPVAKKLETTW
Ga0192857_1000893613300019040MarineMVQKIVDPKFNIRTFNIKCDKNLSPLAKIIIKSFKFKLYYYVIDDLLYLLKSNPDERDYLLQTLHSTVIFLQNSLYINYFDIYVYDISISEVSNFNRFINQKSEQFQISNNITIKLAYQVKPITKKLETTW
Ga0192857_1001075813300019040MarineMVQKIIDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQLLNSSVIFLQNNLYVNFFDIYIYDITINEVSKFNRFVNEQSKSFKVSNNITVKLAYQVKPVQKKLETIW
Ga0192857_1001103613300019040MarineMVQKIVDPKFNIRTFNIKCDKNLSPLAKIIIKSFKFKLYYYVIDDLLYLLKSNPDERDYLLQTLHSTVIFLQNSLYINYFDIYIYDISIDEISKVNRFINRESEQFQVSNNITIKLAYQVKSVTKKLETTW
Ga0192857_1015665123300019040MarineMVQKIVDPKFNIRTFNIKCDKKLSPLTKILIKSFKFKLYYYVIDDLLYLLKSKPDERDYLLRTLHSTVIFLQNSLYINYFDIYVYDISINTVSKFNRFINQKSDDFQVSNTITIKLAYQVKPVTKKLETTW
Ga0192857_1017401023300019040MarineMVQKIIDPNFHIKTFNVKCDSNISPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERNYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEVSKFNRFVNEQSKSFKVSNIITVKLAYQVKPVQKKLETIW
Ga0192857_1027991023300019040MarineMVQKIADPKFNIRTFNVKCDKNLSPLTNIIIKNFKFKLYYYVIDDLLYFLKSNPDEPDYLLQILHSTVIFLQNSLYINYFDIYVYDISINEVPKFNRFINQKSEQFQVSNNIVIKLAYKVKPITKKREITW
Ga0193082_1006674713300019049MarineMIQKIIDPKFNIRTFNIKYDKNLSPLVKILIKSFKFKLYYYVIDDLLYLLKSTPDERDYLLQTLHSTVIFLQNSLHINYFDIYVYDINIDEVSKFNRFINQKSEHFQVSNNITIKLAYQVKPVTKKLETKW
Ga0193082_1007569333300019049MarineMVPKIVDPNFNIKTFNVKCDSELSSLTKVVLKSFKFKLYYYIVDDLLYLLKSNPKERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISNFNRFVNKQSESVKVSNMITIKLAYQVKPITKKLETTW
Ga0193082_1041790723300019049MarineMVSKIVDPNFNIKTFNVKCNHELSSFAKVILQSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLHVNFFDIYIYDISINEISNFNRFVNNQSKSFNVSNTITIKLAYRVKPITKKLESTW
Ga0193082_1054713323300019049MarineMVSKIVDPNFNIKTFNVKCNHELSSFAKVILQSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLHVNFFDIYIYDISISEISKFNRFVNDQSKSINVSNTITIKLAYQVKPVTKKLETTW
Ga0193089_100025063300019133MarineMVPKINDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKSNQKEANQLLQILHSTVIYLQNNLYVNFFDIYVYEVSISEKSNSNKFVKNSTDYFESLNYLTIKLAYQVKPISKKLESIW
Ga0193089_101376843300019133MarineMVPKIVDPNFNIKTFNVKCDSQLSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKFNRFVNTQSESFKVSTTITIKLAYQVKPVTKKLETTW
Ga0193089_112851013300019133MarineMVQKIIDPNLHIKTFNVKCDKKLSPFTKTILQSFKCKLYYYVIDDLLYLLKSNPDERDYLLQILHSTVIFLQNNLYVNFFDIYVYDIAINEVSNFNRFVNDQTGQFKVSNNIIIKFAYQIKPITKKLETVW
Ga0192856_102761513300019143MarineMVQKIIDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQLLNSSVIFLQNNLYVNFFDIYIYDITINEVSKFNRFVNEQSKSFKVSNIITVKLAYQVKPVQKKLETIW
Ga0192856_104597913300019143MarineGVSKIVDPNFNIKTFNVKCNHELSSFAKVILQSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLHVNFFDIYIYDISINEISNFNRFVNNQSKSFNVSNTITIKLAYQVKPITKKLESTW
Ga0192856_105044813300019143MarineTWVNIKTFNVKCNHELSSFAKVILQSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLHVNFFDIYIYDISINEISNFNRFVNNQSKSFNVSNTITIKLAYQVKPITKKLESTW
Ga0188881_1000105973300019146Freshwater LakeMIQKIIDPNFHIKTFNVKCDKALSPLLKTILKSFKFKLYYYVIDDLLYLLKSNPNECDSILKILNSSVLFLQNNFHVNFFDIYLYEINIIERSNSNRFINEEPKYFQNTIYLNIKLAYQVKSIQKKFETIW
Ga0180037_108473523300019214EstuarineFNIKTFNVKCDSELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPKERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEVSNFNRFVNEQSESFKVSNTITIKLAYQVKPVTKKLETTW
Ga0180037_108836233300019214EstuarineMVSKIVDPNFNIKTFNVKCDNELSSLAKVILKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKVNRFVKEQSESFKVSNMITIKLAYQVKPVTKKLETTW
Ga0180037_1166802113300019214EstuarineMVPKINDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKTNQTEANQLLQILHSTVIYLQNNLHVNFFDIYVYEISITEKQNMNKFIQNSSDYFESLNYLTIKLAYQVKPISKKLELVW
Ga0206687_111061463300021169SeawaterMVQKIVDPNFHIKTFNVKCDAKLSPLAKTILSSFKFKLYYYVIDDLLYLLKSNLEERDYLLQILNSSVIFLQNNLYVNFFDIYIYDISINEISKINRFVNEQPESFKLSNTITIKLAYQVTAVPKKLETIW
Ga0206687_167975313300021169SeawaterMIQKIIDPNFHIRSFNVRCDKKLSSRTKIIIESFKFKLYYYVIDDLLYLLKSNPDERDYFLKVLHSIVIFIQNNLYVNFFDIYIYDITINEAPKFNRFIANQKNPFKVSNNIIIKFAYQIKPVPKKLETIW
Ga0210296_112335563300021305EstuarineMVQKIMDPNFHIKTFNVKCDKKLSSLAITILQSFKFKLYYYVMDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNEQSELFKVSNTITIKLAYQIKPVPKKLETIW
Ga0210309_104620463300021317EstuarineMVQKIVDTNFNIKTFNIKYEKKLSPLVKTILQSCKFKLYYYVIDDLSYLLKSNPDELRRFLKLLHSTVIFLQNNLHVNFFDVYVYDIKIDEVSKTNRFISKQSERMKFSNNITIKLAYQVKPITKKLETTW
Ga0213867_113461223300021335SeawaterMVSKIVDPNFNIKTFNVECKHELSPFAKVILQSFKFKLYYYIVDDLLYLLKSNPKERDYLLQILNSSVIFLQNNLHVNFFDIYIYDISISEISKFNRFVKEQSTSFNISNTITIKLAYQVKPVTKKLETTW
Ga0210307_118188513300021336EstuarineMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEVSKFNRFVNEQSELFKVSNTITIKLAYQIKPVPKKLETIW
Ga0213858_10000163343300021356SeawaterMVPKIMDPNFNIKTFNVECHSELSSFTKVILKNFKFKLYYYIVDDLLYLLKSNPEERDYILQILHSSVIFLQNNLHVNFFDIYIYDITINEISKFNRFVNEQSNSFKVSNMITIKLAYQVKPITKKLETTW
Ga0213858_1003259253300021356SeawaterMVQKIVDPNFNIKTFNIKCDSELSALAKIVLKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKFNRFVNTHSESFNISTMITIKLAYQVKPVTKKLETTW
Ga0213858_1004299243300021356SeawaterMVPKIMDPNFNIKTFNVKCDIELSSFAKIILKSFKFKLYYYIVDDLLYLLKSNPEERDYILQMLHSSVIFLQNNLYVNFFDIYIYDIQINKLSKFNRFMNNQSAPSQVSNIITIKLAYQVKPITKKLETTW
Ga0213858_1029342713300021356SeawaterMVQKIVDPNFNIKTFNVKYDNELSSLAKTILKSFKFKLYYYVMDDLVYLLKSNPTERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISLNEKSKFNRFINKQPTSFKVSN
Ga0213859_1000665293300021364SeawaterMVQKIVDPNFHIKTFNVKCDTKLSPIAKTILQSFKYKLYYYVIDDLFYLLKSNPEERDYLLQILNSSAIFLHNNLYVNFFDIYIYDITINEMSKCNRFVNDTSESFKVSNSLTIKLAYQVKPVPKKLESIW
Ga0213860_1006735433300021368SeawaterFAKVILQSFKFKLYYYIVDDLLYLLKSNPKERDYLLQILNSSVIFLQNNLHVNFFDIYIYDISISEISKFNRFVKEQSTSFNISNTITIKLAYQVKPVTKKLETTW
Ga0213863_1011408133300021371SeawaterMVPKIIDPNFNIKTFNVKCDMELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIYLQNNLYVNFFDIYIYDIKITEISKFNRFVNEQSEAFKASNM
Ga0213865_1027338213300021373SeawaterGNLFMVPKLNDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKTNQNEANQLLQILHSTVIYLQNNLYVNFFDIYVYEISITEKQNLNKFIQNSSDYFESLNYLTIKLAYQVKPVSKKLESVW
Ga0213861_1003318573300021378SeawaterMVPKIVDPNFNIKTFNIKCDSELSSLAKIVLKSFKFKLYYYIVDDLLYFLKSNPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKFNRFVNTNSESFKVSNMITIKLAYQVKPVTKKLETTW
Ga0213861_1012307733300021378SeawaterVVSKIIDPNFNIKTFNVKCNHELSSFAKVILQSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLHVNFFDIYIYDISISEISKFNRFVNEQSKSFNVSNTITIKLAYQVKPVTKKLETTW
Ga0213864_1004689723300021379SeawaterMVPKVMDPNFNIKTFNVKCDIELSSFAKAIIKSFKFKLYYYIVDDLLYLLKSNPEERDYILQMLHSSVIFLQNNLSVNFFDIYIYDIHINELSKFNRFVTEESESFKVSNIITIKLAYQVKPITKKLETTW
Ga0213864_1027335023300021379SeawaterDPNFNIKTFNVECKHELSPFAKVILQSFKFKLYYYIVDDLLYLLKSNPKERDYLLQILNSSVIFLQNNLHVNFFDIYIYDISISEISKFNRFVKEQSTSFNISNTITIKLAYQVKPVTKKLETTW
Ga0213868_1061744613300021389SeawaterIIDPNFNIKTFNVKCDMELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIYLQNNLYVNFFDIYIYDIKITEISKFNRFVNEQSEAFKASNMITIKLAYQVKPITKKLETTW
Ga0213866_1057147323300021425SeawaterMVPKIMDPNFNIKTFNVKCDIELSSFAKIILKSFKFKLYYYIVDDLLYLLKSNPEERDYILQMLHSSVIFLQNNLYVNFFDIYIYDIQINKLSKFNRFMNNQSAPSQVSNII
Ga0222714_10000586433300021961Estuarine WaterMVQKVVDPNFNIKTFNIKYENSLSPLAKTILKSFRFKFYYYVIDDLLYLLKSNPEEHNKLLKILHSTAIYLQNNLYVNFFDIYVYDININEVSKINRFVNQQTKQVKTFNYLTIKLAYQLKPITKKLETNW
Ga0224498_1000006773300022202SedimentMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFKFSNTITIKLAYQVKPIPKKLETIW
Ga0210312_11250623300022367EstuarineMVPKIVDPNFNIKTFNVKCDSELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKVNRFVKEQSESFKVSNMITIKLAYQVKPVTKKLETTW
(restricted) Ga0233404_1001242033300022913SeawaterMVQKVIDPTYHIKTFSVQYDKQLSPLTKNLIQSFKLKLYYYVIDDILYLLKSNQTERDYLLQLLHSSVILLQNNLHVNFFDIYIYDININEKFKENRFVKDESKQFKASNIITIKLAYQVKPITRKVETIW
(restricted) Ga0233405_1001102843300023114SeawaterQYDKQLSPLTKNLIQSFKLKLYYYVIDDILYLLKSNQTERDYLLQLLHSSVILLQNNLHVNFFDIYIYDININEKFKENRFVKDESKQFKASNIITIKLAYQVKPITRKVETIW
(restricted) Ga0233405_1011106613300023114SeawaterMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKTNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISNFNRFVNEQSESFELSN
(restricted) Ga0233412_1002502623300023210SeawaterMVSKIVDPNFNIKTFNVKCDNELSSLAKVILKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKVNRFVKEQSKSFKVSNMITIKLAYQVKPVTKKLETTW
(restricted) Ga0233410_1002285343300023276SeawaterKIIDPNFNIKTFNVKCDNELSSLAKVILKSFKFKLYYYIVDDLLYLLKSNPQERDYLLQMLHSSVIFLQNNLYVNFFDIYIYDISINEISKYNRFVNEQSEPFKVSNTITIKLAYQVKPVTKKLETTW
(restricted) Ga0255040_1007265033300024059SeawaterMVQKIVDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFKFSNTITIKLAYQVKPI
(restricted) Ga0255039_1029133623300024062SeawaterMVSKIIDPNFNIKTFNVKCDNELSSLAKVILKSFKFKLYYYIVDDLLYLLKSNPQERDYLLQMLHSSVIFLQNNLYVNFFDIYIYDISINEISKYNRFVNEQSEPFKVSNTITIKLA
(restricted) Ga0233444_10000678453300024264SeawaterMVQKIINPNFNIKTFNIKCENKLSPLAKTIIKSFKFKLYYYVVDDLLYLLKSNPTELNYLLQILHSTVIFLQNNLYVNFFDIYVYDISINEVSKFNRLVNHQSDYFKVSNDITIKLAYQVKPITKKLETIW
(restricted) Ga0255043_1002192613300024338SeawaterTFNVKCDKKLSPFTKTILQSFKCKLYYYVIDDLLYLLKSNPDERDYLLQILHSTVIFLQNNLYVNFFDIYVYDIAINEVSNFNRFVNDQTGQFKVSNNIIIKFAYQIKPITKKLETVW
(restricted) Ga0255043_1030304113300024338SeawaterMVQKVIDPTYHIKTFSVQYDKQLSPLTKNLIQSFKLKLYYYVIDDILYLLKSNQTERDYLLQLLHSSVILLQNNLHVNFFDIYIYDININEKFKENRFVKDESKQFKASNIITIKLAYQVKPITRK
Ga0244777_10000479353300024343EstuarineMVQKVVDPKFNIRTFNIKCDKNLSPLAKIIIKSFKFKLYYYVIDDLLYLLKSNPEERDYLLQTLHSTVLFLQNSLYINFFDIYIYDISIDEVSNSNRFINRKSEQFQISNNITIKLAYQVKSVTKKLETTW
Ga0244777_1000723013300024343EstuarineMVQKIMDPNFHIKTFNVKCDKKLSSLAITILQSFKFKLYYYVMDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEISKFNRFVNEQSELFKVSNNI
Ga0244777_10018791103300024343EstuarineVIHPTYHIKTFSVQYDKQLSPLTKNLIQSFKLKLYYYVIDDILYLLKSNQTERDYLLQLLHSSVILLQNNLHVNFFDIYIYDININEKFKENRFVKDESKQFKASNIITIKLAYQVKPITRKVETIW
Ga0244777_1024222323300024343EstuarineMVSKIIDPNFNIKTFNVKCDNELSSLAKVILKSFKFKLYYYIVDDLLYLLKSNPQERDYLLQMLHSSVIFLQNNLYVNFFDIYIYDISINEISKYNRFVNEQSEPFKVSNTITIKLAYQVKPVTKKLETTW
(restricted) Ga0255045_1020250423300024528SeawaterPLTKNLIQSFKLKLYYYVIDDILYLLKSNQTERDYLLQLLHSSVILLQNNLHVNFFDIYIYDININEKFKENRFVKDESKQFKASNIITIKLAYQVKPITRKVETIW
Ga0209555_10000632143300025879MarineMVQKVVDPNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDITINEVSKFNRFVNEQSNSFKVSNIITVKLAYQVKPVQKKLETIW
Ga0209555_1000286513300025879MarineMVQKIVDPNFHIKTFNVKCDAKLSPLAKTILSSFKFKLYYYVIDDLLYLLKSNLEERDYLLQILNSSVIFLQNNLYVNFFDIYIYDISINEISKINRFVNEQPESFKLSNTIT
Ga0209555_1013724623300025879MarineMVQKIIDPNFHIKTFNVKCDKALSPLLKTILKSFKFKLYYYVIDDLLYLLKSNPDECDSILQTLNSSVLFLQNNFHVNFFDIYLYEINIIERSKSNRFINEELNSFQNSIYLNIKFAYQVKSVQKKFETIW
Ga0208544_1024072013300025887AqueousMVQKIVDPNFNIKTFNVKCDNELSSLAKTIIKSFKFKLYYYVMDDLVYLLKSNPTERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKFNRFVNTQSESFKVSTTITIKLAYQVKPVTKKLETTW
Ga0208438_104227113300027196EstuarineVSKIVDPNFNIKTFNVKCDNELSSLAKVILKSFKFKLYYYIVDDLLYLLKSNPEERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKVNRFVKEQSESFKVSNMITIKLAYQVKPVTKKLETTW
Ga0208308_100523313300027228EstuarineYHIKTFSVQYDKQLSPLTKNLIQSFKLKLYYYVIDDILYLLKSNQTERDYLLQLLHSSVILLQNNLHVNFFDIYIYDININEKFKENRFVKDESKQFKASNIITIKLAYQVKPITRKVETIW
Ga0208171_100689513300027230EstuarineYDKQLSPLTKNLIQSFKLKLYYYVIDDILYLLKSNQTERDYLLQLLHSSVILLQNNLHVNFFDIYIYDININEKFKENRFVKDESKQFKASNIITIKLAYQVKPITRKVETIW
Ga0208174_101822223300027243EstuarineMVPKINDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKSNQKEANQLLQILHSTVIYLQNNLYVNFFDIYVYEVSISEKSNSNKFVKNSTDYFESLNYLTIKMAYQVKPISKKLESIW
Ga0208796_110382523300027308EstuarineMVQKVIDPTYHIKTFSVQYDKQLSPLTKNLIQSFKLKLYYYVIDDILYLLKSNQTERDYLLQLLHSSVILLQNNLHVNFFDIYIYDININEKFKENRFVKDESKQFKASNIITIKLA
Ga0208971_109561123300027582MarineMVQKIMDPNFHIKTFNVKCDKKLSSLAITILQSFKFKLYYYVMDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDISINEISKINRFVNEQPESFKLSNTITIKLAYQVTAVPK
Ga0209302_10000178343300027810MarineMVPKFNDTKFNIKTFNIKYEKKLSPLAKTIIQSLKFKLYYYVVEDLLYLLKTNQNEANQLLQILHSTVIYLQNNLYVNFFDIYVYEINITEKQNLNKFIQNSSDYFESLNYLTIKLAYQVKPISKKLESVW
Ga0209092_1001509033300027833MarineMVQKIMDPNFHIKTFNVKCDKKLSSLAITILQSFKFKLYYYVMDDLLYLLKSNLDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDISINEISKFNRFVNEQSELFKVSNTITIKLAYQIKPVPKKLETIW
Ga0209092_1028749023300027833MarineMVPKIIDPNFNIKTFNIKCDSELSPLAKVILKSFKFKLYYYIVDDLLYLLKSNPDERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEISKFNRFVNEQSESFKVSNMITIKLAYQVKPVTKKLETTW
Ga0209712_1048288013300027849MarineMVPKIVDPNFNIKTFNVKCDSELSSLAKVVLKSFKFKLYYYIVDDLLYLLKSNPKERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISINEVSNFNRFVNEQSESF
(restricted) Ga0233414_1000717733300028045SeawaterMVQKVIDPTYHIKTFSVQYDKQLSPLTKSLIQSFKLKLYYYVIDDILYLLKSNQTERDYLLQLLHSSVIFLQNNLHVNFFDIYIYDININEKFKENRFVKDESKQFKASNIITIKLAYQVKPITRKVETIW
Ga0307380_10001135433300031539SoilMVQKIVDSNFHIKTFNVKCDNKLSPLAKTILQSFKFKLYYYVIDDLLYLLKSNPDERDYLLQILNSSVIFLQNNLYVNFFDIYIYDININEISKFNRFVNEQSESFKISNTITIKLAYQVKPVPKKLETIW
Ga0307380_10001653343300031539SoilMVPKVMDPNFNIKTFNVKCDIELSSFAKVIIKSFKFKLYYYIVDDLLYLLKSNPEECDYILKMLHSSVIFLQNNLSVNFFDIYIYDIQINELSKFNRFVTNQSESFKVSNIITIKLAYQVKPITKKLETTW
Ga0334998_0055576_2116_25113300034019FreshwaterMVQKIIDPTFNIKSFNIKYDNKISMLAKTVLQSFKFKLYYYVIDDLSYLLKSNIQERDYFLQILNSSAIFLHNNLYVNFFDIYIYEIGINEVKNLNRFIDSESDKYQISNYITIKFAYQVKPVTKKFETIW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.