Basic Information | |
---|---|
Family ID | F014095 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 265 |
Average Sequence Length | 48 residues |
Representative Sequence | MLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Number of Associated Samples | 125 |
Number of Associated Scaffolds | 265 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 1.52 % |
% of genes near scaffold ends (potentially truncated) | 87.92 % |
% of genes from short scaffolds (< 2000 bps) | 99.25 % |
Associated GOLD sequencing projects | 125 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (70.943 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (83.019 % of family members) |
Environment Ontology (ENVO) | Unclassified (94.340 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (70.943 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.56% β-sheet: 0.00% Coil/Unstructured: 58.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 265 Family Scaffolds |
---|---|---|
PF00290 | Trp_syntA | 6.04 |
PF13456 | RVT_3 | 1.51 |
PF00078 | RVT_1 | 0.75 |
PF07727 | RVT_2 | 0.75 |
PF10551 | MULE | 0.38 |
PF16363 | GDP_Man_Dehyd | 0.38 |
PF00076 | RRM_1 | 0.38 |
PF00665 | rve | 0.38 |
PF13960 | DUF4218 | 0.38 |
PF03732 | Retrotrans_gag | 0.38 |
PF13966 | zf-RVT | 0.38 |
PF08059 | SEP | 0.38 |
COG ID | Name | Functional Category | % Frequency in 265 Family Scaffolds |
---|---|---|---|
COG0159 | Tryptophan synthase alpha chain | Amino acid transport and metabolism [E] | 6.04 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.38 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.38 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.38 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.38 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 70.94 % |
All Organisms | root | All Organisms | 29.06 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005331|Ga0070670_101628509 | Not Available | 593 | Open in IMG/M |
3300005445|Ga0070708_102070326 | Not Available | 526 | Open in IMG/M |
3300005466|Ga0070685_11330491 | Not Available | 549 | Open in IMG/M |
3300005548|Ga0070665_102119746 | Not Available | 567 | Open in IMG/M |
3300005617|Ga0068859_102428177 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 577 | Open in IMG/M |
3300005844|Ga0068862_101720698 | Not Available | 635 | Open in IMG/M |
3300009972|Ga0105137_109992 | Not Available | 519 | Open in IMG/M |
3300009977|Ga0105141_116967 | Not Available | 637 | Open in IMG/M |
3300009989|Ga0105131_101112 | Not Available | 1750 | Open in IMG/M |
3300009989|Ga0105131_127171 | Not Available | 596 | Open in IMG/M |
3300009990|Ga0105132_114690 | Not Available | 712 | Open in IMG/M |
3300009990|Ga0105132_129019 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 585 | Open in IMG/M |
3300009992|Ga0105120_1019721 | Not Available | 736 | Open in IMG/M |
3300009995|Ga0105139_1035683 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 823 | Open in IMG/M |
3300009995|Ga0105139_1079950 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 615 | Open in IMG/M |
3300009995|Ga0105139_1086784 | Not Available | 594 | Open in IMG/M |
3300009995|Ga0105139_1097948 | Not Available | 563 | Open in IMG/M |
3300009995|Ga0105139_1114161 | Not Available | 523 | Open in IMG/M |
3300010399|Ga0134127_12755581 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis | 571 | Open in IMG/M |
3300010399|Ga0134127_12993881 | Not Available | 551 | Open in IMG/M |
3300010400|Ga0134122_12546723 | Not Available | 561 | Open in IMG/M |
3300010401|Ga0134121_11466106 | Not Available | 696 | Open in IMG/M |
3300014968|Ga0157379_11874678 | Not Available | 590 | Open in IMG/M |
3300014968|Ga0157379_11888055 | Not Available | 588 | Open in IMG/M |
3300015270|Ga0182183_1012644 | Not Available | 911 | Open in IMG/M |
3300015280|Ga0182100_1011374 | Not Available | 995 | Open in IMG/M |
3300015280|Ga0182100_1034968 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 716 | Open in IMG/M |
3300015280|Ga0182100_1094094 | Not Available | 512 | Open in IMG/M |
3300015284|Ga0182101_1043902 | Not Available | 666 | Open in IMG/M |
3300015293|Ga0182103_1040836 | Not Available | 680 | Open in IMG/M |
3300015293|Ga0182103_1097396 | Not Available | 514 | Open in IMG/M |
3300015293|Ga0182103_1104233 | Not Available | 500 | Open in IMG/M |
3300015297|Ga0182104_1009348 | Not Available | 1132 | Open in IMG/M |
3300015297|Ga0182104_1035337 | Not Available | 766 | Open in IMG/M |
3300015297|Ga0182104_1058066 | Not Available | 652 | Open in IMG/M |
3300015301|Ga0182184_1024608 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 804 | Open in IMG/M |
3300015301|Ga0182184_1092788 | Not Available | 518 | Open in IMG/M |
3300015306|Ga0182180_1051287 | Not Available | 627 | Open in IMG/M |
3300015306|Ga0182180_1068316 | Not Available | 566 | Open in IMG/M |
3300015309|Ga0182098_1062582 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes | 647 | Open in IMG/M |
3300015309|Ga0182098_1089858 | Not Available | 572 | Open in IMG/M |
3300015309|Ga0182098_1107312 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 536 | Open in IMG/M |
3300015309|Ga0182098_1124241 | Not Available | 508 | Open in IMG/M |
3300015310|Ga0182162_1015417 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
3300015311|Ga0182182_1019802 | Not Available | 925 | Open in IMG/M |
3300015311|Ga0182182_1028820 | Not Available | 824 | Open in IMG/M |
3300015311|Ga0182182_1036814 | Not Available | 762 | Open in IMG/M |
3300015311|Ga0182182_1105578 | Not Available | 531 | Open in IMG/M |
3300015312|Ga0182168_1004563 | All Organisms → Viruses → Predicted Viral | 1486 | Open in IMG/M |
3300015312|Ga0182168_1070685 | Not Available | 649 | Open in IMG/M |
3300015312|Ga0182168_1080540 | Not Available | 619 | Open in IMG/M |
3300015313|Ga0182164_1096036 | Not Available | 579 | Open in IMG/M |
3300015315|Ga0182120_1052177 | Not Available | 728 | Open in IMG/M |
3300015315|Ga0182120_1114723 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 543 | Open in IMG/M |
3300015315|Ga0182120_1139973 | Not Available | 501 | Open in IMG/M |
3300015316|Ga0182121_1101796 | Not Available | 584 | Open in IMG/M |
3300015317|Ga0182136_1113615 | Not Available | 548 | Open in IMG/M |
3300015317|Ga0182136_1125882 | Not Available | 526 | Open in IMG/M |
3300015318|Ga0182181_1053095 | Not Available | 658 | Open in IMG/M |
3300015318|Ga0182181_1086832 | Not Available | 557 | Open in IMG/M |
3300015318|Ga0182181_1090565 | Not Available | 549 | Open in IMG/M |
3300015319|Ga0182130_1006114 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 1333 | Open in IMG/M |
3300015319|Ga0182130_1071505 | Not Available | 640 | Open in IMG/M |
3300015319|Ga0182130_1116163 | Not Available | 536 | Open in IMG/M |
3300015319|Ga0182130_1135379 | Not Available | 505 | Open in IMG/M |
3300015320|Ga0182165_1022138 | Not Available | 994 | Open in IMG/M |
3300015320|Ga0182165_1063630 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 696 | Open in IMG/M |
3300015324|Ga0182134_1137500 | Not Available | 518 | Open in IMG/M |
3300015325|Ga0182148_1086821 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 614 | Open in IMG/M |
3300015325|Ga0182148_1113266 | Not Available | 556 | Open in IMG/M |
3300015326|Ga0182166_1040519 | Not Available | 795 | Open in IMG/M |
3300015326|Ga0182166_1057908 | Not Available | 706 | Open in IMG/M |
3300015326|Ga0182166_1076196 | Not Available | 642 | Open in IMG/M |
3300015327|Ga0182114_1045377 | Not Available | 824 | Open in IMG/M |
3300015327|Ga0182114_1095597 | Not Available | 626 | Open in IMG/M |
3300015328|Ga0182153_1009311 | Not Available | 1268 | Open in IMG/M |
3300015328|Ga0182153_1074403 | Not Available | 664 | Open in IMG/M |
3300015328|Ga0182153_1086512 | Not Available | 629 | Open in IMG/M |
3300015328|Ga0182153_1094371 | Not Available | 608 | Open in IMG/M |
3300015328|Ga0182153_1120500 | Not Available | 553 | Open in IMG/M |
3300015329|Ga0182135_1113491 | Not Available | 570 | Open in IMG/M |
3300015329|Ga0182135_1146027 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes | 515 | Open in IMG/M |
3300015330|Ga0182152_1068462 | Not Available | 691 | Open in IMG/M |
3300015330|Ga0182152_1083972 | Not Available | 641 | Open in IMG/M |
3300015331|Ga0182131_1057241 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 740 | Open in IMG/M |
3300015331|Ga0182131_1072030 | Not Available | 682 | Open in IMG/M |
3300015331|Ga0182131_1075095 | Not Available | 671 | Open in IMG/M |
3300015332|Ga0182117_1002914 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1915 | Open in IMG/M |
3300015332|Ga0182117_1058196 | Not Available | 779 | Open in IMG/M |
3300015332|Ga0182117_1120372 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 584 | Open in IMG/M |
3300015333|Ga0182147_1143396 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 540 | Open in IMG/M |
3300015334|Ga0182132_1090920 | Not Available | 651 | Open in IMG/M |
3300015334|Ga0182132_1092495 | Not Available | 647 | Open in IMG/M |
3300015334|Ga0182132_1102855 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 620 | Open in IMG/M |
3300015334|Ga0182132_1125400 | Not Available | 572 | Open in IMG/M |
3300015334|Ga0182132_1149035 | Not Available | 531 | Open in IMG/M |
3300015334|Ga0182132_1163076 | Not Available | 511 | Open in IMG/M |
3300015335|Ga0182116_1042385 | Not Available | 897 | Open in IMG/M |
3300015335|Ga0182116_1104100 | Not Available | 637 | Open in IMG/M |
3300015335|Ga0182116_1131747 | Not Available | 577 | Open in IMG/M |
3300015336|Ga0182150_1007529 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 1401 | Open in IMG/M |
3300015336|Ga0182150_1012489 | Not Available | 1221 | Open in IMG/M |
3300015336|Ga0182150_1083663 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 661 | Open in IMG/M |
3300015337|Ga0182151_1103441 | Not Available | 610 | Open in IMG/M |
3300015338|Ga0182137_1014743 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1256 | Open in IMG/M |
3300015338|Ga0182137_1111985 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 617 | Open in IMG/M |
3300015338|Ga0182137_1126700 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 585 | Open in IMG/M |
3300015338|Ga0182137_1147152 | Not Available | 548 | Open in IMG/M |
3300015339|Ga0182149_1036228 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 919 | Open in IMG/M |
3300015339|Ga0182149_1152464 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 532 | Open in IMG/M |
3300015339|Ga0182149_1160987 | Not Available | 520 | Open in IMG/M |
3300015339|Ga0182149_1175158 | Not Available | 501 | Open in IMG/M |
3300015340|Ga0182133_1034090 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 987 | Open in IMG/M |
3300015340|Ga0182133_1095761 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 676 | Open in IMG/M |
3300015340|Ga0182133_1120261 | Not Available | 616 | Open in IMG/M |
3300015348|Ga0182115_1088643 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 962 | Open in IMG/M |
3300015348|Ga0182115_1121405 | Not Available | 829 | Open in IMG/M |
3300015348|Ga0182115_1174096 | Not Available | 690 | Open in IMG/M |
3300015348|Ga0182115_1199898 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 640 | Open in IMG/M |
3300015348|Ga0182115_1201425 | Not Available | 638 | Open in IMG/M |
3300015349|Ga0182185_1044231 | Not Available | 1149 | Open in IMG/M |
3300015349|Ga0182185_1207028 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 594 | Open in IMG/M |
3300015350|Ga0182163_1033805 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1363 | Open in IMG/M |
3300015350|Ga0182163_1154496 | Not Available | 714 | Open in IMG/M |
3300015350|Ga0182163_1177083 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 667 | Open in IMG/M |
3300015350|Ga0182163_1228287 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 583 | Open in IMG/M |
3300015350|Ga0182163_1249032 | Not Available | 557 | Open in IMG/M |
3300015350|Ga0182163_1298820 | Not Available | 503 | Open in IMG/M |
3300015352|Ga0182169_1015770 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 1886 | Open in IMG/M |
3300015352|Ga0182169_1119459 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 852 | Open in IMG/M |
3300015352|Ga0182169_1132241 | Not Available | 810 | Open in IMG/M |
3300015352|Ga0182169_1143305 | Not Available | 778 | Open in IMG/M |
3300015352|Ga0182169_1196504 | Not Available | 659 | Open in IMG/M |
3300015352|Ga0182169_1206231 | Not Available | 642 | Open in IMG/M |
3300015352|Ga0182169_1247507 | Not Available | 580 | Open in IMG/M |
3300015352|Ga0182169_1296623 | Not Available | 522 | Open in IMG/M |
3300015352|Ga0182169_1302039 | Not Available | 516 | Open in IMG/M |
3300015352|Ga0182169_1307403 | Not Available | 510 | Open in IMG/M |
3300015353|Ga0182179_1084739 | Not Available | 927 | Open in IMG/M |
3300015353|Ga0182179_1155096 | Not Available | 715 | Open in IMG/M |
3300015353|Ga0182179_1234246 | Not Available | 590 | Open in IMG/M |
3300015353|Ga0182179_1277050 | Not Available | 543 | Open in IMG/M |
3300015353|Ga0182179_1282038 | Not Available | 539 | Open in IMG/M |
3300015354|Ga0182167_1019668 | Not Available | 1992 | Open in IMG/M |
3300015354|Ga0182167_1127425 | Not Available | 938 | Open in IMG/M |
3300015354|Ga0182167_1159327 | Not Available | 832 | Open in IMG/M |
3300015354|Ga0182167_1190123 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 753 | Open in IMG/M |
3300015354|Ga0182167_1262154 | Not Available | 621 | Open in IMG/M |
3300015354|Ga0182167_1286529 | Not Available | 587 | Open in IMG/M |
3300015354|Ga0182167_1310596 | Not Available | 558 | Open in IMG/M |
3300015354|Ga0182167_1319784 | Not Available | 547 | Open in IMG/M |
3300017408|Ga0182197_1146975 | Not Available | 509 | Open in IMG/M |
3300017412|Ga0182199_1082271 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae | 715 | Open in IMG/M |
3300017412|Ga0182199_1098023 | Not Available | 671 | Open in IMG/M |
3300017414|Ga0182195_1044211 | Not Available | 924 | Open in IMG/M |
3300017414|Ga0182195_1080237 | Not Available | 750 | Open in IMG/M |
3300017414|Ga0182195_1154880 | Not Available | 583 | Open in IMG/M |
3300017414|Ga0182195_1186375 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 540 | Open in IMG/M |
3300017414|Ga0182195_1189180 | Not Available | 537 | Open in IMG/M |
3300017414|Ga0182195_1215709 | Not Available | 508 | Open in IMG/M |
3300017421|Ga0182213_1081656 | Not Available | 892 | Open in IMG/M |
3300017421|Ga0182213_1154250 | Not Available | 647 | Open in IMG/M |
3300017421|Ga0182213_1200615 | Not Available | 568 | Open in IMG/M |
3300017422|Ga0182201_1071965 | Not Available | 641 | Open in IMG/M |
3300017432|Ga0182196_1010166 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 1244 | Open in IMG/M |
3300017432|Ga0182196_1107215 | Not Available | 574 | Open in IMG/M |
3300017432|Ga0182196_1152624 | Not Available | 507 | Open in IMG/M |
3300017439|Ga0182200_1088265 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 626 | Open in IMG/M |
3300017439|Ga0182200_1132696 | Not Available | 543 | Open in IMG/M |
3300017439|Ga0182200_1163232 | Not Available | 503 | Open in IMG/M |
3300017445|Ga0182198_1007139 | Not Available | 1565 | Open in IMG/M |
3300017445|Ga0182198_1115998 | Not Available | 626 | Open in IMG/M |
3300017445|Ga0182198_1116266 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 625 | Open in IMG/M |
3300017445|Ga0182198_1172524 | Not Available | 537 | Open in IMG/M |
3300017446|Ga0182217_1171902 | Not Available | 510 | Open in IMG/M |
3300017447|Ga0182215_1088475 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes | 683 | Open in IMG/M |
3300017447|Ga0182215_1158843 | Not Available | 524 | Open in IMG/M |
3300017692|Ga0182210_1115288 | Not Available | 585 | Open in IMG/M |
3300017693|Ga0182216_1191667 | Not Available | 536 | Open in IMG/M |
3300017694|Ga0182211_1082436 | Not Available | 747 | Open in IMG/M |
3300017694|Ga0182211_1173896 | Not Available | 515 | Open in IMG/M |
3300020023|Ga0182178_1018797 | Not Available | 539 | Open in IMG/M |
3300025972|Ga0207668_10992660 | Not Available | 750 | Open in IMG/M |
3300026035|Ga0207703_10731305 | Not Available | 942 | Open in IMG/M |
3300028049|Ga0268322_1038580 | Not Available | 575 | Open in IMG/M |
3300028050|Ga0268328_1066799 | Not Available | 516 | Open in IMG/M |
3300028053|Ga0268346_1000636 | Not Available | 1692 | Open in IMG/M |
3300028055|Ga0268338_1044488 | Not Available | 503 | Open in IMG/M |
3300028058|Ga0268332_1026101 | Not Available | 746 | Open in IMG/M |
3300028064|Ga0268340_1001855 | Not Available | 1608 | Open in IMG/M |
3300028064|Ga0268340_1075111 | Not Available | 530 | Open in IMG/M |
3300028064|Ga0268340_1084988 | Not Available | 506 | Open in IMG/M |
3300028141|Ga0268326_1010944 | Not Available | 546 | Open in IMG/M |
3300028142|Ga0268347_1012019 | Not Available | 697 | Open in IMG/M |
3300028142|Ga0268347_1017859 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 619 | Open in IMG/M |
3300028143|Ga0268348_1008812 | Not Available | 704 | Open in IMG/M |
3300028151|Ga0268308_1029572 | Not Available | 526 | Open in IMG/M |
3300028381|Ga0268264_11477311 | Not Available | 690 | Open in IMG/M |
3300028471|Ga0268323_1013139 | Not Available | 588 | Open in IMG/M |
3300028475|Ga0268327_1013382 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 625 | Open in IMG/M |
3300028523|Ga0268313_1005633 | Not Available | 724 | Open in IMG/M |
3300028529|Ga0268311_1018036 | Not Available | 590 | Open in IMG/M |
3300032464|Ga0214492_1016575 | Not Available | 1332 | Open in IMG/M |
3300032465|Ga0214493_1001476 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 3152 | Open in IMG/M |
3300032465|Ga0214493_1046279 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis | 1019 | Open in IMG/M |
3300032465|Ga0214493_1102126 | Not Available | 680 | Open in IMG/M |
3300032465|Ga0214493_1127298 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes | 598 | Open in IMG/M |
3300032465|Ga0214493_1141435 | Not Available | 560 | Open in IMG/M |
3300032465|Ga0214493_1150868 | Not Available | 538 | Open in IMG/M |
3300032465|Ga0214493_1160894 | Not Available | 517 | Open in IMG/M |
3300032466|Ga0214503_1083988 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 983 | Open in IMG/M |
3300032466|Ga0214503_1235829 | Not Available | 567 | Open in IMG/M |
3300032467|Ga0214488_1134184 | Not Available | 519 | Open in IMG/M |
3300032468|Ga0214482_1019056 | Not Available | 1240 | Open in IMG/M |
3300032468|Ga0214482_1049350 | Not Available | 813 | Open in IMG/M |
3300032469|Ga0214491_1042742 | Not Available | 1080 | Open in IMG/M |
3300032469|Ga0214491_1067257 | Not Available | 866 | Open in IMG/M |
3300032490|Ga0214495_1097519 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes | 678 | Open in IMG/M |
3300032490|Ga0214495_1121507 | Not Available | 591 | Open in IMG/M |
3300032502|Ga0214490_1010505 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1735 | Open in IMG/M |
3300032502|Ga0214490_1042801 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1016 | Open in IMG/M |
3300032502|Ga0214490_1102757 | Not Available | 653 | Open in IMG/M |
3300032514|Ga0214502_1259409 | Not Available | 662 | Open in IMG/M |
3300032550|Ga0321340_1004531 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 1639 | Open in IMG/M |
3300032550|Ga0321340_1040262 | Not Available | 658 | Open in IMG/M |
3300032550|Ga0321340_1056138 | Not Available | 542 | Open in IMG/M |
3300032589|Ga0214500_1196657 | Not Available | 570 | Open in IMG/M |
3300032590|Ga0214489_1010710 | Not Available | 1262 | Open in IMG/M |
3300032590|Ga0214489_1033027 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes | 777 | Open in IMG/M |
3300032591|Ga0214484_1061646 | Not Available | 794 | Open in IMG/M |
3300032592|Ga0214504_1092429 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes | 590 | Open in IMG/M |
3300032592|Ga0214504_1096324 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 576 | Open in IMG/M |
3300032625|Ga0214501_1238612 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes | 577 | Open in IMG/M |
3300032697|Ga0214499_1111732 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 841 | Open in IMG/M |
3300032697|Ga0214499_1183655 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes | 647 | Open in IMG/M |
3300032699|Ga0214494_1055549 | Not Available | 761 | Open in IMG/M |
3300032758|Ga0314746_1139400 | Not Available | 544 | Open in IMG/M |
3300032781|Ga0314742_1052330 | Not Available | 718 | Open in IMG/M |
3300032781|Ga0314742_1082643 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 544 | Open in IMG/M |
3300032789|Ga0314725_1036930 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 583 | Open in IMG/M |
3300032789|Ga0314725_1037115 | Not Available | 582 | Open in IMG/M |
3300032791|Ga0314748_1126994 | Not Available | 529 | Open in IMG/M |
3300032812|Ga0314745_1107864 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 575 | Open in IMG/M |
3300032821|Ga0314719_1007035 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1345 | Open in IMG/M |
3300032821|Ga0314719_1018828 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes | 874 | Open in IMG/M |
3300032827|Ga0314730_122617 | Not Available | 677 | Open in IMG/M |
3300032875|Ga0314737_1013526 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1303 | Open in IMG/M |
3300032875|Ga0314737_1020747 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1101 | Open in IMG/M |
3300032889|Ga0314751_1069240 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 717 | Open in IMG/M |
3300032917|Ga0314721_125045 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes | 628 | Open in IMG/M |
3300032932|Ga0314717_138815 | Not Available | 501 | Open in IMG/M |
3300032934|Ga0314741_1094922 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 690 | Open in IMG/M |
3300032934|Ga0314741_1134380 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 558 | Open in IMG/M |
3300032959|Ga0314738_1041206 | Not Available | 841 | Open in IMG/M |
3300033525|Ga0314758_1015712 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1920 | Open in IMG/M |
3300033525|Ga0314758_1152117 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 634 | Open in IMG/M |
3300033526|Ga0314761_1006986 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1976 | Open in IMG/M |
3300033526|Ga0314761_1056005 | Not Available | 872 | Open in IMG/M |
3300033530|Ga0314760_1080621 | Not Available | 807 | Open in IMG/M |
3300033530|Ga0314760_1186415 | Not Available | 502 | Open in IMG/M |
3300033532|Ga0314767_1112534 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 681 | Open in IMG/M |
3300033535|Ga0314759_1127798 | Not Available | 805 | Open in IMG/M |
3300033535|Ga0314759_1152596 | Not Available | 735 | Open in IMG/M |
3300033539|Ga0314762_1101997 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 530 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 83.02% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 6.42% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 4.91% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.13% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.38% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.38% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
3300009973 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG | Host-Associated | Open in IMG/M |
3300009977 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaG | Host-Associated | Open in IMG/M |
3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017446 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028141 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028471 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032468 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032550 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032589 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032590 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032592 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032699 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032781 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032789 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032791 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032812 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032821 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032827 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032875 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032889 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032917 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032932 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033525 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033532 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033539 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070670_1016285092 | 3300005331 | Switchgrass Rhizosphere | MIIQFHTMCYKICGMLHALNCFVDPVLSGLIGILPDSTAELLRFKCVLTLIVVLMMVSALKPD* |
Ga0070708_1020703261 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKLD* |
Ga0070685_113304911 | 3300005466 | Switchgrass Rhizosphere | SLDCFVDPVSSGLIGILPDSTAGLLHFKCVLTLVAISVMVSALKPD* |
Ga0070665_1021197461 | 3300005548 | Switchgrass Rhizosphere | SLDCFVDPVSSGLIGILPDSTAGLLHFKCGLTLIVVLMMVSALKPD* |
Ga0068859_1024281771 | 3300005617 | Switchgrass Rhizosphere | NCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD* |
Ga0068862_1017206981 | 3300005844 | Switchgrass Rhizosphere | MLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTL |
Ga0105137_1099921 | 3300009972 | Switchgrass Associated | MLHALNCFVDPVSSGLIGILPDNTAGLFRFKCVLTLVAVSVMV |
Ga0105136_1047501 | 3300009973 | Switchgrass Associated | LFDPGSSGFIGILPDSTAGLLRFKYVLTLIVVLMMVS |
Ga0105141_1169671 | 3300009977 | Switchgrass Associated | CRSCSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD* |
Ga0105131_1011121 | 3300009989 | Switchgrass Associated | SLYCFVDPVSSGLIGILPDSTTGLLRFKCVLTLVTVSVMVSALKPD* |
Ga0105131_1271711 | 3300009989 | Switchgrass Associated | LDCFVDPVSSGLIGILPDSTAGLFRFKCVLTLVTVSVMVSVLKPD* |
Ga0105132_1146902 | 3300009990 | Switchgrass Associated | GLIGILPDSTTGLLHFKCVLTLVTVSVMVSALKPD* |
Ga0105132_1290191 | 3300009990 | Switchgrass Associated | SGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD* |
Ga0105120_10197211 | 3300009992 | Switchgrass Associated | HSLYSKNCGMLYYLNCFVDPISSGLIGILPDSTAGLLRFKCVLTLVTVSVIVSALKPD* |
Ga0105139_10356833 | 3300009995 | Switchgrass Associated | CGMLHTLDCFVDPVSSGLIGILPDSTAGLLRLKCVLTYNAFMETVSALEPD* |
Ga0105139_10799501 | 3300009995 | Switchgrass Associated | KICGMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCALTLVVVSVMVSALKPD* |
Ga0105139_10867842 | 3300009995 | Switchgrass Associated | MIQFHTLYNKICGMLYALDYFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD* |
Ga0105139_10979481 | 3300009995 | Switchgrass Associated | PVSSGLIGILPDSTAGLLRFKCVLTLIAVLMMVSALKPD* |
Ga0105139_11141611 | 3300009995 | Switchgrass Associated | SGLIGILPDSTAGLLRFKCMLTLVTVSVMISALKPD* |
Ga0134127_127555812 | 3300010399 | Terrestrial Soil | LIGILPDSTAGLLRFKCVLTLIVVLMMISALKPD* |
Ga0134127_129938811 | 3300010399 | Terrestrial Soil | IQFHPLCCKICGMLHSLDCFADPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD* |
Ga0134122_125467231 | 3300010400 | Terrestrial Soil | MLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGA |
Ga0134121_114661061 | 3300010401 | Terrestrial Soil | MLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD* |
Ga0157379_118746781 | 3300014968 | Switchgrass Rhizosphere | LHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD* |
Ga0157379_118880551 | 3300014968 | Switchgrass Rhizosphere | NQFHTLYCKICGMVHSLDCFVDLVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKLD* |
Ga0182183_10126444 | 3300015270 | Switchgrass Phyllosphere | NCFVDPDSSGLIGILPDSTAGLLHFKCVLILVAVSVMVSALKPD* |
Ga0182100_10113741 | 3300015280 | Switchgrass Phyllosphere | PVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKLD* |
Ga0182100_10349681 | 3300015280 | Switchgrass Phyllosphere | KICGILHSLDCFVDPVSSGLIGILPDSTAGLLCFKCVLTLVAVSVMTSALKPD* |
Ga0182100_10940943 | 3300015280 | Switchgrass Phyllosphere | HSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD* |
Ga0182101_10439021 | 3300015284 | Switchgrass Phyllosphere | VIIIQFHTLCCKICGMLYTLDCFVDPISSGLIRILPDSTAGLLRLKCVLSCIAFMDMVRVLEPD* |
Ga0182103_10408361 | 3300015293 | Switchgrass Phyllosphere | GLIGILPDSTAGLLCFKCVLTLVAVSVMVSTFKPD* |
Ga0182103_10973961 | 3300015293 | Switchgrass Phyllosphere | SSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD* |
Ga0182103_11042331 | 3300015293 | Switchgrass Phyllosphere | LIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD* |
Ga0182104_10093483 | 3300015297 | Switchgrass Phyllosphere | YFYKIQTQYLIIVHFHTLYCKICGMLYSLNCFVDPVSSGLIGILPDSTAGLLHLKCVLTIVTVSVMVSVLKPD* |
Ga0182104_10353371 | 3300015297 | Switchgrass Phyllosphere | MIIQFHTLCYKICGMLHALNCFVDPVLSGLIGILPDSTAGLLRFKCVLTLIVILMMVSALKPD* |
Ga0182104_10580661 | 3300015297 | Switchgrass Phyllosphere | ICGMLHTLNCFVDPISSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD* |
Ga0182184_10246082 | 3300015301 | Switchgrass Phyllosphere | LCCKIYGMLHALNCFIDPVSSGLIGILPDSTAGLLRFKCVLTLSVVLMMVSALKPD* |
Ga0182184_10927881 | 3300015301 | Switchgrass Phyllosphere | SSGLIGILPDGTAGLFRFKCMLTLVTVSVMVSALKPD* |
Ga0182180_10512871 | 3300015306 | Switchgrass Phyllosphere | QIRFVITIHFQTLYCKICGMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD* |
Ga0182180_10683161 | 3300015306 | Switchgrass Phyllosphere | MLYALYCFVNPILSDLIGILPDSTAGLLRLKCMLT |
Ga0182098_10625823 | 3300015309 | Switchgrass Phyllosphere | VIITIQFYTLYCKICGMLHSLDCFVDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD* |
Ga0182098_10898581 | 3300015309 | Switchgrass Phyllosphere | VDPVSSGLIGSLPDSTAGLLRFKCVLTLVTVSMMVSALKPD* |
Ga0182098_11073121 | 3300015309 | Switchgrass Phyllosphere | GVLHSLDYFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD* |
Ga0182098_11242411 | 3300015309 | Switchgrass Phyllosphere | SSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD* |
Ga0182162_10154172 | 3300015310 | Switchgrass Phyllosphere | DCFVDPVSSGLIGILPDSTAGLLRFKCMLTLVTVSVMVSALKPD* |
Ga0182182_10198021 | 3300015311 | Switchgrass Phyllosphere | MLHALNCFVDHVLSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD* |
Ga0182182_10288201 | 3300015311 | Switchgrass Phyllosphere | MIHTLCCKICGMLYSLNCFVDPDSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Ga0182182_10368141 | 3300015311 | Switchgrass Phyllosphere | LSCKICGMLHSLDSFVDPVSSGLIGILLDNTAGLLRFKCVLTLVAVSVMVSALKPD* |
Ga0182182_11055781 | 3300015311 | Switchgrass Phyllosphere | MLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTL |
Ga0182168_10045631 | 3300015312 | Switchgrass Phyllosphere | FHTLYCKICGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSAFKPD* |
Ga0182168_10706851 | 3300015312 | Switchgrass Phyllosphere | ICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVILMMVSALKPD* |
Ga0182168_10805401 | 3300015312 | Switchgrass Phyllosphere | MLHSLDSFVDPVSSGLIGILPDSTVGLLRFKCVLTLIAVSVMVSALKPD* |
Ga0182164_10960362 | 3300015313 | Switchgrass Phyllosphere | DPVSSGLTGILPDSTAGLFRFKCVLTLVAVSVMVSALKLD* |
Ga0182120_10521771 | 3300015315 | Switchgrass Phyllosphere | FVDPVSSGLIGILPDSIAGLLRFKCVLTLIVVLMMVSALKPD* |
Ga0182120_11147231 | 3300015315 | Switchgrass Phyllosphere | MLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSTLKPD* |
Ga0182120_11399731 | 3300015315 | Switchgrass Phyllosphere | KIYGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD* |
Ga0182121_11017961 | 3300015316 | Switchgrass Phyllosphere | SSGLIGILPDSTAGLLRFKCVLTLIVVLMMISALKPD* |
Ga0182136_11136151 | 3300015317 | Switchgrass Phyllosphere | QFYTLYSKICGMLYSLNCFVDSVSSGLIGILPDSTPGLLRFKCVLTLVAVSVMVSVLKPD |
Ga0182136_11258821 | 3300015317 | Switchgrass Phyllosphere | CFVDPVSSGLIGILPDSTAGLLRFKCMLTLVTVSVMVSTLKPD* |
Ga0182181_10530951 | 3300015318 | Switchgrass Phyllosphere | GLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD* |
Ga0182181_10868321 | 3300015318 | Switchgrass Phyllosphere | SSGLIGILPDSTARLLHFKCVLTLIIVLMMVSALKPD* |
Ga0182181_10905651 | 3300015318 | Switchgrass Phyllosphere | CKICGMLHSLYCFVDPVSSGLIGILPDSTTGLLRFKCVLTLVTVSVMVSALKPD* |
Ga0182130_10061141 | 3300015319 | Switchgrass Phyllosphere | CCKICGMLHALNCFVDPVSSGLIRILPDSNAGLLRFKCVLTLVTVLVMVSVLKPD* |
Ga0182130_10715051 | 3300015319 | Switchgrass Phyllosphere | CFVDSVLSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD* |
Ga0182130_11161632 | 3300015319 | Switchgrass Phyllosphere | DPVSSGLIGILPDSTAGLLRFKCVLTLIVALMMVSALK* |
Ga0182130_11353791 | 3300015319 | Switchgrass Phyllosphere | LNYFVDPVSSGLIGILPDSTVGLLRFKCVLTPIAISVMVSALKPD* |
Ga0182165_10221382 | 3300015320 | Switchgrass Phyllosphere | KICGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKSD* |
Ga0182165_10636302 | 3300015320 | Switchgrass Phyllosphere | CSSGLLGILPDNTAGLLRFKCVLTLIVVLTMVSALKPD* |
Ga0182134_11375001 | 3300015324 | Switchgrass Phyllosphere | SSGLIGILPDSTAGLLRFKCVLILVAVSVMVSTLKPD* |
Ga0182148_10868211 | 3300015325 | Switchgrass Phyllosphere | SLDYFIDPVSNGLIRILPDSTAGLLCFKCVLTLVAVSAMVSALKLD* |
Ga0182148_11132661 | 3300015325 | Switchgrass Phyllosphere | GMLHSLDCFVDPVSSGLIGILPDSTVGLLRFKCVLTLIAVSVMVSALKPN* |
Ga0182166_10405191 | 3300015326 | Switchgrass Phyllosphere | MLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD* |
Ga0182166_10579081 | 3300015326 | Switchgrass Phyllosphere | VFVARLTFVFRHIKTLYFFCKIQTRFVIIIQFHTLYCKICGMLYFLNCFVDPVLSCLIGILPDSTAGLLRFKCVLTLIVVLMIVSALKPD* |
Ga0182166_10761961 | 3300015326 | Switchgrass Phyllosphere | FHILCCKICGMLHSMDCFVDPVLSGLIGILPDSTAGLLYFKCVLTLVAVSMMVSLLKPD* |
Ga0182114_10453771 | 3300015327 | Switchgrass Phyllosphere | CGMLHSLDCFVDPVSSGLIGILPDSTVRLLRFKCVLTLVTVSVMVSVLKPD* |
Ga0182114_10955971 | 3300015327 | Switchgrass Phyllosphere | IYGMLHSLDCFVDPVSSGLIGILPDSTAGLLCFKCVLTLVAVSVMVSALKPD* |
Ga0182153_10093112 | 3300015328 | Switchgrass Phyllosphere | VSSGLIGILPDSTAGLLRFKCVLTLVAISVMVSALKPD* |
Ga0182153_10744031 | 3300015328 | Switchgrass Phyllosphere | MLYSLNCFVDPVSSGLIGILPDSTAGLLRLKCVLTCIVFME |
Ga0182153_10865122 | 3300015328 | Switchgrass Phyllosphere | PVSSGLIGILPDSTAGLFRFKCVLTLVAVSVMVSALKPD* |
Ga0182153_10943711 | 3300015328 | Switchgrass Phyllosphere | SKICGMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD* |
Ga0182153_11205001 | 3300015328 | Switchgrass Phyllosphere | MIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD* |
Ga0182135_11134912 | 3300015329 | Switchgrass Phyllosphere | LIGILPDSTAGLLGFKCVLTLVTVSEMVSALKPD* |
Ga0182135_11460272 | 3300015329 | Switchgrass Phyllosphere | DPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD* |
Ga0182152_10684621 | 3300015330 | Switchgrass Phyllosphere | PVSSGLIGILLDSNAGLLRFKCVLTMVAISVMVSALKPV* |
Ga0182152_10839721 | 3300015330 | Switchgrass Phyllosphere | MLHSLDCFVDPVSSGLIGILPDSTAGLLCFKCVLILVAVFSVFKLD* |
Ga0182131_10572412 | 3300015331 | Switchgrass Phyllosphere | PVSSGLIGILPDSTAGLLRFKCVLTLIVTLMMVSALKSD* |
Ga0182131_10720301 | 3300015331 | Switchgrass Phyllosphere | VSSGLIGILPDSTAELLRFKYVLTLVAVSVMVSALKPD* |
Ga0182131_10750951 | 3300015331 | Switchgrass Phyllosphere | QIRFVIIIIQFHTLCCKICGILYSLNSFVDPISSGLIGILPDSTARLLRFKYVLTLVAISVMVSALKSD* |
Ga0182117_10029141 | 3300015332 | Switchgrass Phyllosphere | SGLIGISPDSTAGLLRFKCVLTLGAVSVMVSALKLD* |
Ga0182117_10581961 | 3300015332 | Switchgrass Phyllosphere | MLHSLDCFVDPVSSGLIGNLPDSTAGLLHFKCVLALIAVSVMVSA |
Ga0182117_11203722 | 3300015332 | Switchgrass Phyllosphere | DPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD* |
Ga0182147_11433961 | 3300015333 | Switchgrass Phyllosphere | ICGMLHSLDCFVDPVSSGLIGILPDSTARLLRFKCVLTLVTVSGMVSALKPD* |
Ga0182132_10909201 | 3300015334 | Switchgrass Phyllosphere | PISSGLIGILPDRTAGLLRFKCVLTLVAVLVMVSALKPD* |
Ga0182132_10924951 | 3300015334 | Switchgrass Phyllosphere | GMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLTMVSTLKPD* |
Ga0182132_11028552 | 3300015334 | Switchgrass Phyllosphere | LIGILSDSTAGLLRFKCVLTLIVVLMMVSALKPD* |
Ga0182132_11254001 | 3300015334 | Switchgrass Phyllosphere | MDYFVDPVLSDLIGILPDSTAELLCFKCVLTLVAVSVMISVLKLD* |
Ga0182132_11490352 | 3300015334 | Switchgrass Phyllosphere | YSLICFVDPVSSGLIGILPDNTAGLLRFKCVLTLFAVSVMVSALKPD* |
Ga0182132_11630762 | 3300015334 | Switchgrass Phyllosphere | CKICGMLHALNCFVDPVSSGLIGILPDSTAELLRFKCVLTLVTVSVMVSALKPD* |
Ga0182116_10423851 | 3300015335 | Switchgrass Phyllosphere | IRTRFVIIIQFHSLYCKICGMLHSLDCFVDPVLRGLIGILPDSTAGLLRFKCVLTLIIVLMMVSALKPD* |
Ga0182116_11041001 | 3300015335 | Switchgrass Phyllosphere | TRFVIIFQFHTLRCKICGMLYALDCFVDPVSRGLIGILPDSAAGLIRLKCVLTCIAFIEMVSALEPD* |
Ga0182116_11317471 | 3300015335 | Switchgrass Phyllosphere | SLDCFVDPVSSGLIGILPDSTSGLLRFKCVLTLVTVSVLVSTLKTD* |
Ga0182150_10075292 | 3300015336 | Switchgrass Phyllosphere | QTQFLIIVHFHTLYCKICGMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD* |
Ga0182150_10124891 | 3300015336 | Switchgrass Phyllosphere | SLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD* |
Ga0182150_10836632 | 3300015336 | Switchgrass Phyllosphere | ICGMLYSLNCFVDPILSGLIGILPDSTAGLLRFKCALTLVAVSRMVSALKPD* |
Ga0182151_11034411 | 3300015337 | Switchgrass Phyllosphere | CKICGMLQSLDCFVDPVSSGLIEILPDSTAGLLHLKCVLTCNAFMEMVSALEPD* |
Ga0182137_10147431 | 3300015338 | Switchgrass Phyllosphere | GLIGILPDSTAGLLRFKYVLTLIVVLMIVSALKPD* |
Ga0182137_11119852 | 3300015338 | Switchgrass Phyllosphere | FVDPVSSGLIGILPDSTAGLLRFKCVLTLVTISVLVSALKPD* |
Ga0182137_11267001 | 3300015338 | Switchgrass Phyllosphere | TLYSKICGMLYSLNCFVDPVSSGLIGILLDSTAGFLRFKCVLTLGAVSVMVSTLKLD* |
Ga0182137_11471522 | 3300015338 | Switchgrass Phyllosphere | LHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD* |
Ga0182149_10362282 | 3300015339 | Switchgrass Phyllosphere | LIGILPDSTAGLLHFKCVLTLVVVLVIVSALKPD* |
Ga0182149_11524642 | 3300015339 | Switchgrass Phyllosphere | MLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD* |
Ga0182149_11609872 | 3300015339 | Switchgrass Phyllosphere | PVLSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD* |
Ga0182149_11751581 | 3300015339 | Switchgrass Phyllosphere | IQFHSLYSKIYGMLYSLNCFVDPVSSGLIGVLPDSTAGLLRFKCVLTLVAVSVMVSALKPD* |
Ga0182133_10340902 | 3300015340 | Switchgrass Phyllosphere | LDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD* |
Ga0182133_10957613 | 3300015340 | Switchgrass Phyllosphere | SSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALEPD* |
Ga0182133_11202611 | 3300015340 | Switchgrass Phyllosphere | GLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKLD* |
Ga0182115_10886433 | 3300015348 | Switchgrass Phyllosphere | FVILIQFHTLYCKIWGMLHSLDCFVDPVSSGLIGILPDSAAGLLCFKCVLTLVTVSVMVSAFKPD* |
Ga0182115_11214051 | 3300015348 | Switchgrass Phyllosphere | MDCFVDPVLNDLIGILPDSTAELLCFKYVLTLVAVSVMISVLKLD* |
Ga0182115_11740962 | 3300015348 | Switchgrass Phyllosphere | LDCFVDPVSSGLIGILPDSTAGLFRFKCVLTLITVSVMVSALKPD* |
Ga0182115_11998981 | 3300015348 | Switchgrass Phyllosphere | VSSGLIGILPDSIAGLLRFKCVLTLVTVSVLVSTLKTD* |
Ga0182115_12014251 | 3300015348 | Switchgrass Phyllosphere | MCCKICGMLYALDYFADPVSSGLIGILPDSTAGLLRLKCVLTC |
Ga0182185_10442312 | 3300015349 | Switchgrass Phyllosphere | CKICGMLHSLDCFVDPISSGLIGILPDSTARLLRFKCVLTVVAVSVMVSTLKPD* |
Ga0182185_12070281 | 3300015349 | Switchgrass Phyllosphere | VSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD* |
Ga0182163_10338051 | 3300015350 | Switchgrass Phyllosphere | KICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD* |
Ga0182163_11544961 | 3300015350 | Switchgrass Phyllosphere | SGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD* |
Ga0182163_11770832 | 3300015350 | Switchgrass Phyllosphere | GMLHSLDCFVDPVSSGLIGILPDNTAGLLRFKCVLTLGAISVMVSALKPD* |
Ga0182163_12282872 | 3300015350 | Switchgrass Phyllosphere | KICGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSVLKLD* |
Ga0182163_12490321 | 3300015350 | Switchgrass Phyllosphere | FVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKLD* |
Ga0182163_12988201 | 3300015350 | Switchgrass Phyllosphere | MLHSLDWFVDPVSSGLIGILPDSTAGLLRFKYVLTLVAVSVMISALKPD* |
Ga0182169_10157701 | 3300015352 | Switchgrass Phyllosphere | NNQFHTLYCKISGMLHSLDCFVDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD* |
Ga0182169_11194591 | 3300015352 | Switchgrass Phyllosphere | FVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSTLKPD* |
Ga0182169_11322411 | 3300015352 | Switchgrass Phyllosphere | LNCFVDPVSSGLIGILPDSTAGLFRFKCVLTLIVVLMIISAFKPD* |
Ga0182169_11433052 | 3300015352 | Switchgrass Phyllosphere | CFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSAFKPD* |
Ga0182169_11965041 | 3300015352 | Switchgrass Phyllosphere | NSFVDPISSGLIGILPDSTARLLRFKYVLTLVAISVMVSAL* |
Ga0182169_12062311 | 3300015352 | Switchgrass Phyllosphere | RYKICGMLYSLDCFVDPVSSGLIGILPDSTTGLLRLKCVLTCVMFMEMVSALEPD* |
Ga0182169_12475071 | 3300015352 | Switchgrass Phyllosphere | LCCKICGMLHSLDCFVDPVSSGLIGILPDSTAGLFRFKCVLTLVAVSVMVSALKLD* |
Ga0182169_12966231 | 3300015352 | Switchgrass Phyllosphere | DPVSSGLIGILPDSTAGLLRFKCMLTLIVVLIMVSALKPD* |
Ga0182169_13020391 | 3300015352 | Switchgrass Phyllosphere | MLYSLNCFVDSVSSGLIGILPDSTAGLFRLKCVLTCIAFMEMVSAL* |
Ga0182169_13074032 | 3300015352 | Switchgrass Phyllosphere | CKICGMLHSLNCFVDPVSSGLIEILPDSTAGLLRFKCGLTLVVVSVMVSALKPD* |
Ga0182179_10847392 | 3300015353 | Switchgrass Phyllosphere | SSGLIGILPDSTAGLLRFKCVIILVVVSVMVSALKLD* |
Ga0182179_11550961 | 3300015353 | Switchgrass Phyllosphere | LNCFVDPVSSGLIGILPDSIARLLRFKCALTLVAVSVMVSTLELD* |
Ga0182179_12342462 | 3300015353 | Switchgrass Phyllosphere | GLIGILPDNTAGLLRFKCVLTLIVVLVMVSALKSD* |
Ga0182179_12770502 | 3300015353 | Switchgrass Phyllosphere | GMLHSLDCFVDPVSSGLIGILHDNTAGLLRFKCVLTLIVILMMVSALKPD* |
Ga0182179_12820382 | 3300015353 | Switchgrass Phyllosphere | LIGILPDSTAGLLCFKCVLTLVVVSVMVSALKPD* |
Ga0182167_10196683 | 3300015354 | Switchgrass Phyllosphere | MLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLTMVSTLKPD* |
Ga0182167_11274251 | 3300015354 | Switchgrass Phyllosphere | NCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIIVLMMVSALKPD* |
Ga0182167_11593271 | 3300015354 | Switchgrass Phyllosphere | SGLIGILPDSTAGLLRFKCVLILIVVLMMVSALKPD* |
Ga0182167_11901231 | 3300015354 | Switchgrass Phyllosphere | LIGILPDSSAGLLRFKCVLTLIVVLMMVSVLKPD* |
Ga0182167_12621542 | 3300015354 | Switchgrass Phyllosphere | FVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVRALNPD* |
Ga0182167_12865291 | 3300015354 | Switchgrass Phyllosphere | DPVSSGLIGILPDSTTELLRFMCVLTLVAVSLVVSALKPD* |
Ga0182167_13105961 | 3300015354 | Switchgrass Phyllosphere | MLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVILM |
Ga0182167_13197841 | 3300015354 | Switchgrass Phyllosphere | LYCKICGMLYSLNCFADPVLSGLIGILPDSAAGLLRFKCVLTLIVVLMMVSALKPD* |
Ga0182197_11469751 | 3300017408 | Switchgrass Phyllosphere | MLHSLDCFVDPVSSGLIGILPDSTVGLLRFKYVLTPIAISVMVSALK |
Ga0182199_10822711 | 3300017412 | Switchgrass Phyllosphere | KICGMLYSLNCFVDPVSSGLIGILPDSTAGLLRLKCVLTCIAFMEMVSALEPD |
Ga0182199_10980231 | 3300017412 | Switchgrass Phyllosphere | MLHSLDCFVDHVLSGLIGILPDSTAGLLRFKCVLTLVA |
Ga0182195_10442111 | 3300017414 | Switchgrass Phyllosphere | MDCFVDPVLNDLIGILPDSTAELLCFKCVLTLVVVSVIISILKLD |
Ga0182195_10802373 | 3300017414 | Switchgrass Phyllosphere | IQFHTLYCKICGMLYSLNCFVDPVSSGLIGILHDSTAGLLCFKCVLILVAVSVMVSAFKP |
Ga0182195_11548802 | 3300017414 | Switchgrass Phyllosphere | GMLYSLDCFVDPISSGLIGILPDSTAGLLRFKCVLTLIFTLMMVSALKPG |
Ga0182195_11863752 | 3300017414 | Switchgrass Phyllosphere | MLHALDCFVDPVSIGLIGILPDNTAGLLHLKCVLTYNAFMETVSALEPD |
Ga0182195_11891802 | 3300017414 | Switchgrass Phyllosphere | MLHSLDCFVDPVSSGLIGILPDSTVGLLRFKCVLTLVTVS |
Ga0182195_12157091 | 3300017414 | Switchgrass Phyllosphere | VIIIHFQTLYCKICGMLYYLNCFVDPVSRGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPG |
Ga0182213_10816561 | 3300017421 | Switchgrass Phyllosphere | MLHSLDWFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD |
Ga0182213_11542501 | 3300017421 | Switchgrass Phyllosphere | TLYCKICEMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD |
Ga0182213_12006151 | 3300017421 | Switchgrass Phyllosphere | NCFVDPVSSGLIGILPDSTAGLLCFKCVLILVAVSVMVSALKPD |
Ga0182201_10719651 | 3300017422 | Switchgrass Phyllosphere | MLYSLNCFVNPVSSGLIGILPDSTAGLLRFKCVLTLV |
Ga0182196_10101661 | 3300017432 | Switchgrass Phyllosphere | SKICGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKRVLTLVTVSVMVSTLKPD |
Ga0182196_11072151 | 3300017432 | Switchgrass Phyllosphere | SSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD |
Ga0182196_11526242 | 3300017432 | Switchgrass Phyllosphere | SLDCFVDRVSSVLIGILPDSTAGLLHLKCVLTIVTVSVMVSVLKPD |
Ga0182200_10882651 | 3300017439 | Switchgrass Phyllosphere | HTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAELLRFKCVLTLIIVLMMVSALKPD |
Ga0182200_11326961 | 3300017439 | Switchgrass Phyllosphere | GLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD |
Ga0182200_11632321 | 3300017439 | Switchgrass Phyllosphere | LHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSTLKLD |
Ga0182198_10071391 | 3300017445 | Switchgrass Phyllosphere | MLHSLDCFVDPVSSGLIGSLPDSTAGLLRFKCVLTLIVVLIMVSALKPD |
Ga0182198_11159982 | 3300017445 | Switchgrass Phyllosphere | VLSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Ga0182198_11162661 | 3300017445 | Switchgrass Phyllosphere | IIQFHTLCYKICGMLHALNCFVDPVSSGLIGILPDSTTGLLRFKCVLTLIVILMMVSALKPD |
Ga0182198_11725241 | 3300017445 | Switchgrass Phyllosphere | TIIQFHTLFCKICEMLQSLDCFVDPVSSGLIGILPDSTARLLRFKCVLTLVTVSVMVSALKPN |
Ga0182217_11719021 | 3300017446 | Switchgrass Phyllosphere | MLYSLDGFVDPVSSGLIGILPDSTAGFLRFKCVLTLIVVLMMVSALKPD |
Ga0182215_10884752 | 3300017447 | Switchgrass Phyllosphere | LNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Ga0182215_11588431 | 3300017447 | Switchgrass Phyllosphere | GFIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD |
Ga0182210_11152881 | 3300017692 | Switchgrass Phyllosphere | TLNCFVDPVLSGLIGILPDSTAGLLHFKCVLTLVTVSVMVSALKPD |
Ga0182216_11916671 | 3300017693 | Switchgrass Phyllosphere | MLHSLDCFVDPVSSGLIGILPDSTAGLFRFECVLTLVAVSVMVSALKLD |
Ga0182211_10824361 | 3300017694 | Switchgrass Phyllosphere | SGLIKILPDSTAGLLRFKCVLTLVTVSVMVSALKPD |
Ga0182211_11738961 | 3300017694 | Switchgrass Phyllosphere | MLHSLDCFVDPVSSGLIGILPDSTARLLRFKCVLTLVTVS |
Ga0182178_10187972 | 3300020023 | Switchgrass Phyllosphere | VSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD |
Ga0207668_109926601 | 3300025972 | Switchgrass Rhizosphere | MIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSAL |
Ga0207703_107313052 | 3300026035 | Switchgrass Rhizosphere | LYCKIYEMLYSLNCFVDPVSSGLIRILPDSTVRLLRLKCVLTILAVIGDG |
Ga0268322_10385802 | 3300028049 | Phyllosphere | MLHSLDCFADPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVS |
Ga0268328_10667991 | 3300028050 | Phyllosphere | PVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSAFKPD |
Ga0268346_10006361 | 3300028053 | Phyllosphere | FSFILCSVKFCGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAISVMVSALKP |
Ga0268338_10444881 | 3300028055 | Phyllosphere | MLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIV |
Ga0268332_10261012 | 3300028058 | Phyllosphere | LDCFVDHVSSGLIGILPDSTAGLLHLKCVLTIVTVSVMVSVLKPD |
Ga0268340_10018552 | 3300028064 | Phyllosphere | MLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKLD |
Ga0268340_10751111 | 3300028064 | Phyllosphere | MLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLIMVSALKP |
Ga0268340_10849881 | 3300028064 | Phyllosphere | VIIIQFYTQCCKICGMLHALDCFVDPVSSGLIGILPDSTAGLLRFKCVLILVAISVMISALKPN |
Ga0268326_10109441 | 3300028141 | Phyllosphere | SLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSAFKPD |
Ga0268347_10120191 | 3300028142 | Phyllosphere | MLHSLDCFVDPVSSDLIGILPDSTAGLLCFKCVLTLIVVLMMVSTL |
Ga0268347_10178592 | 3300028142 | Phyllosphere | MLHALNCFVDPVASGLIGILPDNIAGLLHFKCVLTLIVVLMMVTALKPD |
Ga0268348_10088121 | 3300028143 | Phyllosphere | MLHSLDCFVDPVSSGLIGILPDSTAGLFRFKCVLTLITISVMVRALK |
Ga0268308_10295721 | 3300028151 | Phyllosphere | MLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLT |
Ga0268264_114773111 | 3300028381 | Switchgrass Rhizosphere | MLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLV |
Ga0268323_10131391 | 3300028471 | Phyllosphere | SVKFCGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAISVMVSALKPD |
Ga0268327_10133821 | 3300028475 | Phyllosphere | LFDPGVSGFIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD |
Ga0268313_10056331 | 3300028523 | Phyllosphere | GMLYSLNCFVDPDSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Ga0268311_10180361 | 3300028529 | Phyllosphere | MIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD |
Ga0214492_10165752 | 3300032464 | Switchgrass Phyllosphere | MIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD |
Ga0214493_10014765 | 3300032465 | Switchgrass Phyllosphere | VSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSVLKLD |
Ga0214493_10462792 | 3300032465 | Switchgrass Phyllosphere | SGLIGILPDSTAGLLRFKCMLTLIVVLMMVSALKPD |
Ga0214493_11021261 | 3300032465 | Switchgrass Phyllosphere | IIQFYTLYCKICGMLHSLDWFVDPVSSGLIGILPDSTAGLLRFKCVLTLFAISVMVSALKPD |
Ga0214493_11272982 | 3300032465 | Switchgrass Phyllosphere | DPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Ga0214493_11414351 | 3300032465 | Switchgrass Phyllosphere | CKICGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD |
Ga0214493_11508681 | 3300032465 | Switchgrass Phyllosphere | VVLIGILPDSTAGLLRFKCVLTLVTISVLVSALKLD |
Ga0214493_11608941 | 3300032465 | Switchgrass Phyllosphere | CKICGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD |
Ga0214503_10839881 | 3300032466 | Switchgrass Phyllosphere | GMLHALNCFVDPVLSGLIGILPDSTAGLLRFKCALTLIVVLMMVSALKPD |
Ga0214503_12358291 | 3300032466 | Switchgrass Phyllosphere | MLHALNCFVDPVLSGLIGILLDSTAGLLRFKCVLTLIVVLMMVSALKPD |
Ga0214488_11341841 | 3300032467 | Switchgrass Phyllosphere | PVSSGLIGILPDSTAGLLRFKCVLTLVTVSVLVSTLKMD |
Ga0214482_10190561 | 3300032468 | Switchgrass Phyllosphere | MLHALNCFVDPVLSGLIGILPDNTAGLLRFKCVLTLVTVSVMVSALKPD |
Ga0214482_10493501 | 3300032468 | Switchgrass Phyllosphere | LCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD |
Ga0214491_10427421 | 3300032469 | Switchgrass Phyllosphere | LHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMIVSALNPD |
Ga0214491_10672572 | 3300032469 | Switchgrass Phyllosphere | SSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD |
Ga0214495_10975191 | 3300032490 | Switchgrass Phyllosphere | SVCNNNNQFHTLYCKICGILHPLDCFVDPISSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Ga0214495_11215071 | 3300032490 | Switchgrass Phyllosphere | MLHALNCFVDPVLSGLIGILPDSTAELLRFKCVLTLIVVLMMVSALKPD |
Ga0214490_10105051 | 3300032502 | Switchgrass Phyllosphere | CFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Ga0214490_10428011 | 3300032502 | Switchgrass Phyllosphere | ICGMLYFLNCFVDPVSSGLIGILPDNTAGLLHFKCVLTLVAVLVMVSTLKPD |
Ga0214490_11027571 | 3300032502 | Switchgrass Phyllosphere | CSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD |
Ga0214502_12594091 | 3300032514 | Switchgrass Phyllosphere | MLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKP |
Ga0321340_10045312 | 3300032550 | Switchgrass Phyllosphere | CNNNNQFHTLYCKICEMLHSLDCFVDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Ga0321340_10402621 | 3300032550 | Switchgrass Phyllosphere | MIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIV |
Ga0321340_10561382 | 3300032550 | Switchgrass Phyllosphere | MLHALNCFVDPVLSGLIGILPDNTAGLLRFKCVLTLVTVS |
Ga0214500_11966572 | 3300032589 | Switchgrass Phyllosphere | LHALNCFVDPVLSGLIGILPDSTAGLFRFKCVLTQVTVSVMVSALKPD |
Ga0214489_10107101 | 3300032590 | Switchgrass Phyllosphere | SSGLIGILPDSTAELLRFKCVLTLIVVLMMVSALKPD |
Ga0214489_10330272 | 3300032590 | Switchgrass Phyllosphere | VCNNNNQFHTLYCKICGMLHSLDCFVDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Ga0214484_10616461 | 3300032591 | Switchgrass Phyllosphere | MIIQFHTLCCKICGMLYALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD |
Ga0214504_10924291 | 3300032592 | Switchgrass Phyllosphere | KICGILHPLDCFVDPISSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Ga0214504_10963241 | 3300032592 | Switchgrass Phyllosphere | MLHSLDCFVDPISSGLIGILPDSTAGLLRFKCVLT |
Ga0214501_12386122 | 3300032625 | Switchgrass Phyllosphere | FVDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Ga0214499_11117322 | 3300032697 | Switchgrass Phyllosphere | NCFVDPVLSGLIGILPDSTAGLLRFKCALTLIVVLMMVSALKPD |
Ga0214499_11836551 | 3300032697 | Switchgrass Phyllosphere | ALYCKICEMLHSLDCFVDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Ga0214494_10555491 | 3300032699 | Switchgrass Phyllosphere | LHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLSAVSVMVSALKPD |
Ga0314746_11394001 | 3300032758 | Switchgrass Phyllosphere | MIFQFYTLYCKICGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCILTLVIISVMVSAFKLD |
Ga0314742_10523301 | 3300032781 | Switchgrass Phyllosphere | PISSGLIGILPDSTAGLLRFKCVLTLSAVSVMVSALKPD |
Ga0314742_10826431 | 3300032781 | Switchgrass Phyllosphere | RFVIIIQFHTMCCKICGMLYALDYFVDPVSSGLIGILPDNTAGLLRLKCMLTCIVFMEMVSALEPD |
Ga0314725_10369301 | 3300032789 | Switchgrass Phyllosphere | CKICEMLHSLDCFVDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Ga0314725_10371151 | 3300032789 | Switchgrass Phyllosphere | MLHSLDCFVDPVSSGLIGSLPDSTAGLLRFKCVLTLIVVL |
Ga0314748_11269941 | 3300032791 | Switchgrass Phyllosphere | MLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMV |
Ga0314745_11078642 | 3300032812 | Switchgrass Phyllosphere | IIQFHILCCKICGMLHALNCFVDPVLSGLIGILPDNTAGLLRFKCVLTLVTVSVMVSALKPD |
Ga0314719_10070353 | 3300032821 | Switchgrass Phyllosphere | QFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD |
Ga0314719_10188281 | 3300032821 | Switchgrass Phyllosphere | LDCFVDPISSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Ga0314730_1226171 | 3300032827 | Switchgrass Phyllosphere | MLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLT |
Ga0314737_10135261 | 3300032875 | Switchgrass Phyllosphere | MLYALDYFVDPVSSGLIRILPDSTAGLLRFKCVLTLV |
Ga0314737_10207471 | 3300032875 | Switchgrass Phyllosphere | MIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTGGLLRFKCVLTLGAVSVMVSALKPD |
Ga0314751_10692401 | 3300032889 | Switchgrass Phyllosphere | MLYSLNCFVDPVSSGLIGILPDSTAGLFRFKCVLTLIVV |
Ga0314721_1250451 | 3300032917 | Switchgrass Phyllosphere | VCNNNNQFHTLYCKICGILHPLDCFVDPISSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD |
Ga0314717_1388151 | 3300032932 | Switchgrass Phyllosphere | MLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVA |
Ga0314741_10949222 | 3300032934 | Switchgrass Phyllosphere | PVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMISALKPD |
Ga0314741_11343801 | 3300032934 | Switchgrass Phyllosphere | MIIQFHTLCCKICGMLHALNCFVDPVLSGLIGILPDNTAGLLRFKCVLTLVTVSVMVSALKPD |
Ga0314738_10412061 | 3300032959 | Switchgrass Phyllosphere | MLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVNALNP |
Ga0314758_10157122 | 3300033525 | Switchgrass Phyllosphere | QFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLHFKCALTLIVVLMMVSALKPD |
Ga0314758_11521172 | 3300033525 | Switchgrass Phyllosphere | VLSGLIGILPDNTAGLLRFKCVLTLVTVSVMVSALKPD |
Ga0314761_10069861 | 3300033526 | Switchgrass Phyllosphere | FHTLCCKICGMLHSLDCFVDPISSGLIGILPDSTAGLLRFKCVLTLVTVSMMVSALKPN |
Ga0314761_10560051 | 3300033526 | Switchgrass Phyllosphere | MLHALNCFVDPVLSGLIGILLDSTAGLLRFKCVLTLIV |
Ga0314760_10806211 | 3300033530 | Switchgrass Phyllosphere | ICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLSAVSVMVSALKPD |
Ga0314760_11864151 | 3300033530 | Switchgrass Phyllosphere | MWYSLNCFVDPVSSGLIGILPDSTAGLLRFKCMLTLIVVLM |
Ga0314767_11125341 | 3300033532 | Switchgrass Phyllosphere | MIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD |
Ga0314759_11277982 | 3300033535 | Switchgrass Phyllosphere | MIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLSAVSVMVSALKPD |
Ga0314759_11525961 | 3300033535 | Switchgrass Phyllosphere | MLHSLDCFVDPVSSGLIGILPDSTAELLHFKCVLT |
Ga0314762_11019971 | 3300033539 | Switchgrass Phyllosphere | MLHSLDCFVDPVSSGLIGILPDNTAGLLRFKFVLTLIAVSVMVSALKPD |
⦗Top⦘ |