NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F014095

Metagenome / Metatranscriptome Family F014095

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F014095
Family Type Metagenome / Metatranscriptome
Number of Sequences 265
Average Sequence Length 48 residues
Representative Sequence MLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Number of Associated Samples 125
Number of Associated Scaffolds 265

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 1.52 %
% of genes near scaffold ends (potentially truncated) 87.92 %
% of genes from short scaffolds (< 2000 bps) 99.25 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (70.943 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(83.019 % of family members)
Environment Ontology (ENVO) Unclassified
(94.340 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(70.943 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 41.56%    β-sheet: 0.00%    Coil/Unstructured: 58.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 265 Family Scaffolds
PF00290Trp_syntA 6.04
PF13456RVT_3 1.51
PF00078RVT_1 0.75
PF07727RVT_2 0.75
PF10551MULE 0.38
PF16363GDP_Man_Dehyd 0.38
PF00076RRM_1 0.38
PF00665rve 0.38
PF13960DUF4218 0.38
PF03732Retrotrans_gag 0.38
PF13966zf-RVT 0.38
PF08059SEP 0.38

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 265 Family Scaffolds
COG0159Tryptophan synthase alpha chainAmino acid transport and metabolism [E] 6.04
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.38
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.38
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.38
COG4584TransposaseMobilome: prophages, transposons [X] 0.38


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A70.94 %
All OrganismsrootAll Organisms29.06 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005331|Ga0070670_101628509Not Available593Open in IMG/M
3300005445|Ga0070708_102070326Not Available526Open in IMG/M
3300005466|Ga0070685_11330491Not Available549Open in IMG/M
3300005548|Ga0070665_102119746Not Available567Open in IMG/M
3300005617|Ga0068859_102428177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae577Open in IMG/M
3300005844|Ga0068862_101720698Not Available635Open in IMG/M
3300009972|Ga0105137_109992Not Available519Open in IMG/M
3300009977|Ga0105141_116967Not Available637Open in IMG/M
3300009989|Ga0105131_101112Not Available1750Open in IMG/M
3300009989|Ga0105131_127171Not Available596Open in IMG/M
3300009990|Ga0105132_114690Not Available712Open in IMG/M
3300009990|Ga0105132_129019All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum585Open in IMG/M
3300009992|Ga0105120_1019721Not Available736Open in IMG/M
3300009995|Ga0105139_1035683All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum823Open in IMG/M
3300009995|Ga0105139_1079950All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum615Open in IMG/M
3300009995|Ga0105139_1086784Not Available594Open in IMG/M
3300009995|Ga0105139_1097948Not Available563Open in IMG/M
3300009995|Ga0105139_1114161Not Available523Open in IMG/M
3300010399|Ga0134127_12755581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis571Open in IMG/M
3300010399|Ga0134127_12993881Not Available551Open in IMG/M
3300010400|Ga0134122_12546723Not Available561Open in IMG/M
3300010401|Ga0134121_11466106Not Available696Open in IMG/M
3300014968|Ga0157379_11874678Not Available590Open in IMG/M
3300014968|Ga0157379_11888055Not Available588Open in IMG/M
3300015270|Ga0182183_1012644Not Available911Open in IMG/M
3300015280|Ga0182100_1011374Not Available995Open in IMG/M
3300015280|Ga0182100_1034968All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum716Open in IMG/M
3300015280|Ga0182100_1094094Not Available512Open in IMG/M
3300015284|Ga0182101_1043902Not Available666Open in IMG/M
3300015293|Ga0182103_1040836Not Available680Open in IMG/M
3300015293|Ga0182103_1097396Not Available514Open in IMG/M
3300015293|Ga0182103_1104233Not Available500Open in IMG/M
3300015297|Ga0182104_1009348Not Available1132Open in IMG/M
3300015297|Ga0182104_1035337Not Available766Open in IMG/M
3300015297|Ga0182104_1058066Not Available652Open in IMG/M
3300015301|Ga0182184_1024608All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum804Open in IMG/M
3300015301|Ga0182184_1092788Not Available518Open in IMG/M
3300015306|Ga0182180_1051287Not Available627Open in IMG/M
3300015306|Ga0182180_1068316Not Available566Open in IMG/M
3300015309|Ga0182098_1062582All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes647Open in IMG/M
3300015309|Ga0182098_1089858Not Available572Open in IMG/M
3300015309|Ga0182098_1107312All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum536Open in IMG/M
3300015309|Ga0182098_1124241Not Available508Open in IMG/M
3300015310|Ga0182162_1015417All Organisms → Viruses → Predicted Viral1024Open in IMG/M
3300015311|Ga0182182_1019802Not Available925Open in IMG/M
3300015311|Ga0182182_1028820Not Available824Open in IMG/M
3300015311|Ga0182182_1036814Not Available762Open in IMG/M
3300015311|Ga0182182_1105578Not Available531Open in IMG/M
3300015312|Ga0182168_1004563All Organisms → Viruses → Predicted Viral1486Open in IMG/M
3300015312|Ga0182168_1070685Not Available649Open in IMG/M
3300015312|Ga0182168_1080540Not Available619Open in IMG/M
3300015313|Ga0182164_1096036Not Available579Open in IMG/M
3300015315|Ga0182120_1052177Not Available728Open in IMG/M
3300015315|Ga0182120_1114723All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum543Open in IMG/M
3300015315|Ga0182120_1139973Not Available501Open in IMG/M
3300015316|Ga0182121_1101796Not Available584Open in IMG/M
3300015317|Ga0182136_1113615Not Available548Open in IMG/M
3300015317|Ga0182136_1125882Not Available526Open in IMG/M
3300015318|Ga0182181_1053095Not Available658Open in IMG/M
3300015318|Ga0182181_1086832Not Available557Open in IMG/M
3300015318|Ga0182181_1090565Not Available549Open in IMG/M
3300015319|Ga0182130_1006114All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1333Open in IMG/M
3300015319|Ga0182130_1071505Not Available640Open in IMG/M
3300015319|Ga0182130_1116163Not Available536Open in IMG/M
3300015319|Ga0182130_1135379Not Available505Open in IMG/M
3300015320|Ga0182165_1022138Not Available994Open in IMG/M
3300015320|Ga0182165_1063630All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum696Open in IMG/M
3300015324|Ga0182134_1137500Not Available518Open in IMG/M
3300015325|Ga0182148_1086821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum614Open in IMG/M
3300015325|Ga0182148_1113266Not Available556Open in IMG/M
3300015326|Ga0182166_1040519Not Available795Open in IMG/M
3300015326|Ga0182166_1057908Not Available706Open in IMG/M
3300015326|Ga0182166_1076196Not Available642Open in IMG/M
3300015327|Ga0182114_1045377Not Available824Open in IMG/M
3300015327|Ga0182114_1095597Not Available626Open in IMG/M
3300015328|Ga0182153_1009311Not Available1268Open in IMG/M
3300015328|Ga0182153_1074403Not Available664Open in IMG/M
3300015328|Ga0182153_1086512Not Available629Open in IMG/M
3300015328|Ga0182153_1094371Not Available608Open in IMG/M
3300015328|Ga0182153_1120500Not Available553Open in IMG/M
3300015329|Ga0182135_1113491Not Available570Open in IMG/M
3300015329|Ga0182135_1146027All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes515Open in IMG/M
3300015330|Ga0182152_1068462Not Available691Open in IMG/M
3300015330|Ga0182152_1083972Not Available641Open in IMG/M
3300015331|Ga0182131_1057241All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum740Open in IMG/M
3300015331|Ga0182131_1072030Not Available682Open in IMG/M
3300015331|Ga0182131_1075095Not Available671Open in IMG/M
3300015332|Ga0182117_1002914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1915Open in IMG/M
3300015332|Ga0182117_1058196Not Available779Open in IMG/M
3300015332|Ga0182117_1120372All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae584Open in IMG/M
3300015333|Ga0182147_1143396All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300015334|Ga0182132_1090920Not Available651Open in IMG/M
3300015334|Ga0182132_1092495Not Available647Open in IMG/M
3300015334|Ga0182132_1102855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum620Open in IMG/M
3300015334|Ga0182132_1125400Not Available572Open in IMG/M
3300015334|Ga0182132_1149035Not Available531Open in IMG/M
3300015334|Ga0182132_1163076Not Available511Open in IMG/M
3300015335|Ga0182116_1042385Not Available897Open in IMG/M
3300015335|Ga0182116_1104100Not Available637Open in IMG/M
3300015335|Ga0182116_1131747Not Available577Open in IMG/M
3300015336|Ga0182150_1007529All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae1401Open in IMG/M
3300015336|Ga0182150_1012489Not Available1221Open in IMG/M
3300015336|Ga0182150_1083663All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum661Open in IMG/M
3300015337|Ga0182151_1103441Not Available610Open in IMG/M
3300015338|Ga0182137_1014743All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1256Open in IMG/M
3300015338|Ga0182137_1111985All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor617Open in IMG/M
3300015338|Ga0182137_1126700All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum585Open in IMG/M
3300015338|Ga0182137_1147152Not Available548Open in IMG/M
3300015339|Ga0182149_1036228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum919Open in IMG/M
3300015339|Ga0182149_1152464All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae532Open in IMG/M
3300015339|Ga0182149_1160987Not Available520Open in IMG/M
3300015339|Ga0182149_1175158Not Available501Open in IMG/M
3300015340|Ga0182133_1034090All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii987Open in IMG/M
3300015340|Ga0182133_1095761All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax676Open in IMG/M
3300015340|Ga0182133_1120261Not Available616Open in IMG/M
3300015348|Ga0182115_1088643All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum962Open in IMG/M
3300015348|Ga0182115_1121405Not Available829Open in IMG/M
3300015348|Ga0182115_1174096Not Available690Open in IMG/M
3300015348|Ga0182115_1199898All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta640Open in IMG/M
3300015348|Ga0182115_1201425Not Available638Open in IMG/M
3300015349|Ga0182185_1044231Not Available1149Open in IMG/M
3300015349|Ga0182185_1207028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae594Open in IMG/M
3300015350|Ga0182163_1033805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1363Open in IMG/M
3300015350|Ga0182163_1154496Not Available714Open in IMG/M
3300015350|Ga0182163_1177083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum667Open in IMG/M
3300015350|Ga0182163_1228287All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum583Open in IMG/M
3300015350|Ga0182163_1249032Not Available557Open in IMG/M
3300015350|Ga0182163_1298820Not Available503Open in IMG/M
3300015352|Ga0182169_1015770All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae1886Open in IMG/M
3300015352|Ga0182169_1119459All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis852Open in IMG/M
3300015352|Ga0182169_1132241Not Available810Open in IMG/M
3300015352|Ga0182169_1143305Not Available778Open in IMG/M
3300015352|Ga0182169_1196504Not Available659Open in IMG/M
3300015352|Ga0182169_1206231Not Available642Open in IMG/M
3300015352|Ga0182169_1247507Not Available580Open in IMG/M
3300015352|Ga0182169_1296623Not Available522Open in IMG/M
3300015352|Ga0182169_1302039Not Available516Open in IMG/M
3300015352|Ga0182169_1307403Not Available510Open in IMG/M
3300015353|Ga0182179_1084739Not Available927Open in IMG/M
3300015353|Ga0182179_1155096Not Available715Open in IMG/M
3300015353|Ga0182179_1234246Not Available590Open in IMG/M
3300015353|Ga0182179_1277050Not Available543Open in IMG/M
3300015353|Ga0182179_1282038Not Available539Open in IMG/M
3300015354|Ga0182167_1019668Not Available1992Open in IMG/M
3300015354|Ga0182167_1127425Not Available938Open in IMG/M
3300015354|Ga0182167_1159327Not Available832Open in IMG/M
3300015354|Ga0182167_1190123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii753Open in IMG/M
3300015354|Ga0182167_1262154Not Available621Open in IMG/M
3300015354|Ga0182167_1286529Not Available587Open in IMG/M
3300015354|Ga0182167_1310596Not Available558Open in IMG/M
3300015354|Ga0182167_1319784Not Available547Open in IMG/M
3300017408|Ga0182197_1146975Not Available509Open in IMG/M
3300017412|Ga0182199_1082271All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae715Open in IMG/M
3300017412|Ga0182199_1098023Not Available671Open in IMG/M
3300017414|Ga0182195_1044211Not Available924Open in IMG/M
3300017414|Ga0182195_1080237Not Available750Open in IMG/M
3300017414|Ga0182195_1154880Not Available583Open in IMG/M
3300017414|Ga0182195_1186375All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300017414|Ga0182195_1189180Not Available537Open in IMG/M
3300017414|Ga0182195_1215709Not Available508Open in IMG/M
3300017421|Ga0182213_1081656Not Available892Open in IMG/M
3300017421|Ga0182213_1154250Not Available647Open in IMG/M
3300017421|Ga0182213_1200615Not Available568Open in IMG/M
3300017422|Ga0182201_1071965Not Available641Open in IMG/M
3300017432|Ga0182196_1010166All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1244Open in IMG/M
3300017432|Ga0182196_1107215Not Available574Open in IMG/M
3300017432|Ga0182196_1152624Not Available507Open in IMG/M
3300017439|Ga0182200_1088265All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax626Open in IMG/M
3300017439|Ga0182200_1132696Not Available543Open in IMG/M
3300017439|Ga0182200_1163232Not Available503Open in IMG/M
3300017445|Ga0182198_1007139Not Available1565Open in IMG/M
3300017445|Ga0182198_1115998Not Available626Open in IMG/M
3300017445|Ga0182198_1116266All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum625Open in IMG/M
3300017445|Ga0182198_1172524Not Available537Open in IMG/M
3300017446|Ga0182217_1171902Not Available510Open in IMG/M
3300017447|Ga0182215_1088475All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes683Open in IMG/M
3300017447|Ga0182215_1158843Not Available524Open in IMG/M
3300017692|Ga0182210_1115288Not Available585Open in IMG/M
3300017693|Ga0182216_1191667Not Available536Open in IMG/M
3300017694|Ga0182211_1082436Not Available747Open in IMG/M
3300017694|Ga0182211_1173896Not Available515Open in IMG/M
3300020023|Ga0182178_1018797Not Available539Open in IMG/M
3300025972|Ga0207668_10992660Not Available750Open in IMG/M
3300026035|Ga0207703_10731305Not Available942Open in IMG/M
3300028049|Ga0268322_1038580Not Available575Open in IMG/M
3300028050|Ga0268328_1066799Not Available516Open in IMG/M
3300028053|Ga0268346_1000636Not Available1692Open in IMG/M
3300028055|Ga0268338_1044488Not Available503Open in IMG/M
3300028058|Ga0268332_1026101Not Available746Open in IMG/M
3300028064|Ga0268340_1001855Not Available1608Open in IMG/M
3300028064|Ga0268340_1075111Not Available530Open in IMG/M
3300028064|Ga0268340_1084988Not Available506Open in IMG/M
3300028141|Ga0268326_1010944Not Available546Open in IMG/M
3300028142|Ga0268347_1012019Not Available697Open in IMG/M
3300028142|Ga0268347_1017859All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum619Open in IMG/M
3300028143|Ga0268348_1008812Not Available704Open in IMG/M
3300028151|Ga0268308_1029572Not Available526Open in IMG/M
3300028381|Ga0268264_11477311Not Available690Open in IMG/M
3300028471|Ga0268323_1013139Not Available588Open in IMG/M
3300028475|Ga0268327_1013382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum625Open in IMG/M
3300028523|Ga0268313_1005633Not Available724Open in IMG/M
3300028529|Ga0268311_1018036Not Available590Open in IMG/M
3300032464|Ga0214492_1016575Not Available1332Open in IMG/M
3300032465|Ga0214493_1001476All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum3152Open in IMG/M
3300032465|Ga0214493_1046279All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis1019Open in IMG/M
3300032465|Ga0214493_1102126Not Available680Open in IMG/M
3300032465|Ga0214493_1127298All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes598Open in IMG/M
3300032465|Ga0214493_1141435Not Available560Open in IMG/M
3300032465|Ga0214493_1150868Not Available538Open in IMG/M
3300032465|Ga0214493_1160894Not Available517Open in IMG/M
3300032466|Ga0214503_1083988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta983Open in IMG/M
3300032466|Ga0214503_1235829Not Available567Open in IMG/M
3300032467|Ga0214488_1134184Not Available519Open in IMG/M
3300032468|Ga0214482_1019056Not Available1240Open in IMG/M
3300032468|Ga0214482_1049350Not Available813Open in IMG/M
3300032469|Ga0214491_1042742Not Available1080Open in IMG/M
3300032469|Ga0214491_1067257Not Available866Open in IMG/M
3300032490|Ga0214495_1097519All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes678Open in IMG/M
3300032490|Ga0214495_1121507Not Available591Open in IMG/M
3300032502|Ga0214490_1010505All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1735Open in IMG/M
3300032502|Ga0214490_1042801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1016Open in IMG/M
3300032502|Ga0214490_1102757Not Available653Open in IMG/M
3300032514|Ga0214502_1259409Not Available662Open in IMG/M
3300032550|Ga0321340_1004531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1639Open in IMG/M
3300032550|Ga0321340_1040262Not Available658Open in IMG/M
3300032550|Ga0321340_1056138Not Available542Open in IMG/M
3300032589|Ga0214500_1196657Not Available570Open in IMG/M
3300032590|Ga0214489_1010710Not Available1262Open in IMG/M
3300032590|Ga0214489_1033027All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes777Open in IMG/M
3300032591|Ga0214484_1061646Not Available794Open in IMG/M
3300032592|Ga0214504_1092429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes590Open in IMG/M
3300032592|Ga0214504_1096324All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum576Open in IMG/M
3300032625|Ga0214501_1238612All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes577Open in IMG/M
3300032697|Ga0214499_1111732All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta841Open in IMG/M
3300032697|Ga0214499_1183655All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes647Open in IMG/M
3300032699|Ga0214494_1055549Not Available761Open in IMG/M
3300032758|Ga0314746_1139400Not Available544Open in IMG/M
3300032781|Ga0314742_1052330Not Available718Open in IMG/M
3300032781|Ga0314742_1082643All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae544Open in IMG/M
3300032789|Ga0314725_1036930All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae583Open in IMG/M
3300032789|Ga0314725_1037115Not Available582Open in IMG/M
3300032791|Ga0314748_1126994Not Available529Open in IMG/M
3300032812|Ga0314745_1107864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum575Open in IMG/M
3300032821|Ga0314719_1007035All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1345Open in IMG/M
3300032821|Ga0314719_1018828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes874Open in IMG/M
3300032827|Ga0314730_122617Not Available677Open in IMG/M
3300032875|Ga0314737_1013526All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1303Open in IMG/M
3300032875|Ga0314737_1020747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1101Open in IMG/M
3300032889|Ga0314751_1069240All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum717Open in IMG/M
3300032917|Ga0314721_125045All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes628Open in IMG/M
3300032932|Ga0314717_138815Not Available501Open in IMG/M
3300032934|Ga0314741_1094922All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii690Open in IMG/M
3300032934|Ga0314741_1134380All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum558Open in IMG/M
3300032959|Ga0314738_1041206Not Available841Open in IMG/M
3300033525|Ga0314758_1015712All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1920Open in IMG/M
3300033525|Ga0314758_1152117All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum634Open in IMG/M
3300033526|Ga0314761_1006986All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1976Open in IMG/M
3300033526|Ga0314761_1056005Not Available872Open in IMG/M
3300033530|Ga0314760_1080621Not Available807Open in IMG/M
3300033530|Ga0314760_1186415Not Available502Open in IMG/M
3300033532|Ga0314767_1112534All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum681Open in IMG/M
3300033535|Ga0314759_1127798Not Available805Open in IMG/M
3300033535|Ga0314759_1152596Not Available735Open in IMG/M
3300033539|Ga0314762_1101997All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax530Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere83.02%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere6.42%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated4.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.13%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.38%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.38%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300009972Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaGHost-AssociatedOpen in IMG/M
3300009973Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaGHost-AssociatedOpen in IMG/M
3300009977Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017446Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020023Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028049Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028050Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028053Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028055Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028058Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028141Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028142Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028143Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028151Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028471Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028475Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028523Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028529Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032464Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032467Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032468Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032469Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032514Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032550Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032589Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032590Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032592Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032758Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032781Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032789Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032812Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032821Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032827Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032875Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032889Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032917Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032932Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032934Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032959Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033525Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033526Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033530Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033532Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033535Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033539Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070670_10162850923300005331Switchgrass RhizosphereMIIQFHTMCYKICGMLHALNCFVDPVLSGLIGILPDSTAELLRFKCVLTLIVVLMMVSALKPD*
Ga0070708_10207032613300005445Corn, Switchgrass And Miscanthus RhizosphereMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKLD*
Ga0070685_1133049113300005466Switchgrass RhizosphereSLDCFVDPVSSGLIGILPDSTAGLLHFKCVLTLVAISVMVSALKPD*
Ga0070665_10211974613300005548Switchgrass RhizosphereSLDCFVDPVSSGLIGILPDSTAGLLHFKCGLTLIVVLMMVSALKPD*
Ga0068859_10242817713300005617Switchgrass RhizosphereNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD*
Ga0068862_10172069813300005844Switchgrass RhizosphereMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTL
Ga0105137_10999213300009972Switchgrass AssociatedMLHALNCFVDPVSSGLIGILPDNTAGLFRFKCVLTLVAVSVMV
Ga0105136_10475013300009973Switchgrass AssociatedLFDPGSSGFIGILPDSTAGLLRFKYVLTLIVVLMMVS
Ga0105141_11696713300009977Switchgrass AssociatedCRSCSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD*
Ga0105131_10111213300009989Switchgrass AssociatedSLYCFVDPVSSGLIGILPDSTTGLLRFKCVLTLVTVSVMVSALKPD*
Ga0105131_12717113300009989Switchgrass AssociatedLDCFVDPVSSGLIGILPDSTAGLFRFKCVLTLVTVSVMVSVLKPD*
Ga0105132_11469023300009990Switchgrass AssociatedGLIGILPDSTTGLLHFKCVLTLVTVSVMVSALKPD*
Ga0105132_12901913300009990Switchgrass AssociatedSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD*
Ga0105120_101972113300009992Switchgrass AssociatedHSLYSKNCGMLYYLNCFVDPISSGLIGILPDSTAGLLRFKCVLTLVTVSVIVSALKPD*
Ga0105139_103568333300009995Switchgrass AssociatedCGMLHTLDCFVDPVSSGLIGILPDSTAGLLRLKCVLTYNAFMETVSALEPD*
Ga0105139_107995013300009995Switchgrass AssociatedKICGMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCALTLVVVSVMVSALKPD*
Ga0105139_108678423300009995Switchgrass AssociatedMIQFHTLYNKICGMLYALDYFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD*
Ga0105139_109794813300009995Switchgrass AssociatedPVSSGLIGILPDSTAGLLRFKCVLTLIAVLMMVSALKPD*
Ga0105139_111416113300009995Switchgrass AssociatedSGLIGILPDSTAGLLRFKCMLTLVTVSVMISALKPD*
Ga0134127_1275558123300010399Terrestrial SoilLIGILPDSTAGLLRFKCVLTLIVVLMMISALKPD*
Ga0134127_1299388113300010399Terrestrial SoilIQFHPLCCKICGMLHSLDCFADPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD*
Ga0134122_1254672313300010400Terrestrial SoilMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGA
Ga0134121_1146610613300010401Terrestrial SoilMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD*
Ga0157379_1187467813300014968Switchgrass RhizosphereLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD*
Ga0157379_1188805513300014968Switchgrass RhizosphereNQFHTLYCKICGMVHSLDCFVDLVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKLD*
Ga0182183_101264443300015270Switchgrass PhyllosphereNCFVDPDSSGLIGILPDSTAGLLHFKCVLILVAVSVMVSALKPD*
Ga0182100_101137413300015280Switchgrass PhyllospherePVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKLD*
Ga0182100_103496813300015280Switchgrass PhyllosphereKICGILHSLDCFVDPVSSGLIGILPDSTAGLLCFKCVLTLVAVSVMTSALKPD*
Ga0182100_109409433300015280Switchgrass PhyllosphereHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD*
Ga0182101_104390213300015284Switchgrass PhyllosphereVIIIQFHTLCCKICGMLYTLDCFVDPISSGLIRILPDSTAGLLRLKCVLSCIAFMDMVRVLEPD*
Ga0182103_104083613300015293Switchgrass PhyllosphereGLIGILPDSTAGLLCFKCVLTLVAVSVMVSTFKPD*
Ga0182103_109739613300015293Switchgrass PhyllosphereSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD*
Ga0182103_110423313300015293Switchgrass PhyllosphereLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD*
Ga0182104_100934833300015297Switchgrass PhyllosphereYFYKIQTQYLIIVHFHTLYCKICGMLYSLNCFVDPVSSGLIGILPDSTAGLLHLKCVLTIVTVSVMVSVLKPD*
Ga0182104_103533713300015297Switchgrass PhyllosphereMIIQFHTLCYKICGMLHALNCFVDPVLSGLIGILPDSTAGLLRFKCVLTLIVILMMVSALKPD*
Ga0182104_105806613300015297Switchgrass PhyllosphereICGMLHTLNCFVDPISSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD*
Ga0182184_102460823300015301Switchgrass PhyllosphereLCCKIYGMLHALNCFIDPVSSGLIGILPDSTAGLLRFKCVLTLSVVLMMVSALKPD*
Ga0182184_109278813300015301Switchgrass PhyllosphereSSGLIGILPDGTAGLFRFKCMLTLVTVSVMVSALKPD*
Ga0182180_105128713300015306Switchgrass PhyllosphereQIRFVITIHFQTLYCKICGMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD*
Ga0182180_106831613300015306Switchgrass PhyllosphereMLYALYCFVNPILSDLIGILPDSTAGLLRLKCMLT
Ga0182098_106258233300015309Switchgrass PhyllosphereVIITIQFYTLYCKICGMLHSLDCFVDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD*
Ga0182098_108985813300015309Switchgrass PhyllosphereVDPVSSGLIGSLPDSTAGLLRFKCVLTLVTVSMMVSALKPD*
Ga0182098_110731213300015309Switchgrass PhyllosphereGVLHSLDYFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD*
Ga0182098_112424113300015309Switchgrass PhyllosphereSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD*
Ga0182162_101541723300015310Switchgrass PhyllosphereDCFVDPVSSGLIGILPDSTAGLLRFKCMLTLVTVSVMVSALKPD*
Ga0182182_101980213300015311Switchgrass PhyllosphereMLHALNCFVDHVLSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD*
Ga0182182_102882013300015311Switchgrass PhyllosphereMIHTLCCKICGMLYSLNCFVDPDSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0182182_103681413300015311Switchgrass PhyllosphereLSCKICGMLHSLDSFVDPVSSGLIGILLDNTAGLLRFKCVLTLVAVSVMVSALKPD*
Ga0182182_110557813300015311Switchgrass PhyllosphereMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTL
Ga0182168_100456313300015312Switchgrass PhyllosphereFHTLYCKICGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSAFKPD*
Ga0182168_107068513300015312Switchgrass PhyllosphereICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVILMMVSALKPD*
Ga0182168_108054013300015312Switchgrass PhyllosphereMLHSLDSFVDPVSSGLIGILPDSTVGLLRFKCVLTLIAVSVMVSALKPD*
Ga0182164_109603623300015313Switchgrass PhyllosphereDPVSSGLTGILPDSTAGLFRFKCVLTLVAVSVMVSALKLD*
Ga0182120_105217713300015315Switchgrass PhyllosphereFVDPVSSGLIGILPDSIAGLLRFKCVLTLIVVLMMVSALKPD*
Ga0182120_111472313300015315Switchgrass PhyllosphereMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSTLKPD*
Ga0182120_113997313300015315Switchgrass PhyllosphereKIYGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD*
Ga0182121_110179613300015316Switchgrass PhyllosphereSSGLIGILPDSTAGLLRFKCVLTLIVVLMMISALKPD*
Ga0182136_111361513300015317Switchgrass PhyllosphereQFYTLYSKICGMLYSLNCFVDSVSSGLIGILPDSTPGLLRFKCVLTLVAVSVMVSVLKPD
Ga0182136_112588213300015317Switchgrass PhyllosphereCFVDPVSSGLIGILPDSTAGLLRFKCMLTLVTVSVMVSTLKPD*
Ga0182181_105309513300015318Switchgrass PhyllosphereGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD*
Ga0182181_108683213300015318Switchgrass PhyllosphereSSGLIGILPDSTARLLHFKCVLTLIIVLMMVSALKPD*
Ga0182181_109056513300015318Switchgrass PhyllosphereCKICGMLHSLYCFVDPVSSGLIGILPDSTTGLLRFKCVLTLVTVSVMVSALKPD*
Ga0182130_100611413300015319Switchgrass PhyllosphereCCKICGMLHALNCFVDPVSSGLIRILPDSNAGLLRFKCVLTLVTVLVMVSVLKPD*
Ga0182130_107150513300015319Switchgrass PhyllosphereCFVDSVLSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD*
Ga0182130_111616323300015319Switchgrass PhyllosphereDPVSSGLIGILPDSTAGLLRFKCVLTLIVALMMVSALK*
Ga0182130_113537913300015319Switchgrass PhyllosphereLNYFVDPVSSGLIGILPDSTVGLLRFKCVLTPIAISVMVSALKPD*
Ga0182165_102213823300015320Switchgrass PhyllosphereKICGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKSD*
Ga0182165_106363023300015320Switchgrass PhyllosphereCSSGLLGILPDNTAGLLRFKCVLTLIVVLTMVSALKPD*
Ga0182134_113750013300015324Switchgrass PhyllosphereSSGLIGILPDSTAGLLRFKCVLILVAVSVMVSTLKPD*
Ga0182148_108682113300015325Switchgrass PhyllosphereSLDYFIDPVSNGLIRILPDSTAGLLCFKCVLTLVAVSAMVSALKLD*
Ga0182148_111326613300015325Switchgrass PhyllosphereGMLHSLDCFVDPVSSGLIGILPDSTVGLLRFKCVLTLIAVSVMVSALKPN*
Ga0182166_104051913300015326Switchgrass PhyllosphereMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD*
Ga0182166_105790813300015326Switchgrass PhyllosphereVFVARLTFVFRHIKTLYFFCKIQTRFVIIIQFHTLYCKICGMLYFLNCFVDPVLSCLIGILPDSTAGLLRFKCVLTLIVVLMIVSALKPD*
Ga0182166_107619613300015326Switchgrass PhyllosphereFHILCCKICGMLHSMDCFVDPVLSGLIGILPDSTAGLLYFKCVLTLVAVSMMVSLLKPD*
Ga0182114_104537713300015327Switchgrass PhyllosphereCGMLHSLDCFVDPVSSGLIGILPDSTVRLLRFKCVLTLVTVSVMVSVLKPD*
Ga0182114_109559713300015327Switchgrass PhyllosphereIYGMLHSLDCFVDPVSSGLIGILPDSTAGLLCFKCVLTLVAVSVMVSALKPD*
Ga0182153_100931123300015328Switchgrass PhyllosphereVSSGLIGILPDSTAGLLRFKCVLTLVAISVMVSALKPD*
Ga0182153_107440313300015328Switchgrass PhyllosphereMLYSLNCFVDPVSSGLIGILPDSTAGLLRLKCVLTCIVFME
Ga0182153_108651223300015328Switchgrass PhyllospherePVSSGLIGILPDSTAGLFRFKCVLTLVAVSVMVSALKPD*
Ga0182153_109437113300015328Switchgrass PhyllosphereSKICGMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD*
Ga0182153_112050013300015328Switchgrass PhyllosphereMIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD*
Ga0182135_111349123300015329Switchgrass PhyllosphereLIGILPDSTAGLLGFKCVLTLVTVSEMVSALKPD*
Ga0182135_114602723300015329Switchgrass PhyllosphereDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD*
Ga0182152_106846213300015330Switchgrass PhyllospherePVSSGLIGILLDSNAGLLRFKCVLTMVAISVMVSALKPV*
Ga0182152_108397213300015330Switchgrass PhyllosphereMLHSLDCFVDPVSSGLIGILPDSTAGLLCFKCVLILVAVFSVFKLD*
Ga0182131_105724123300015331Switchgrass PhyllospherePVSSGLIGILPDSTAGLLRFKCVLTLIVTLMMVSALKSD*
Ga0182131_107203013300015331Switchgrass PhyllosphereVSSGLIGILPDSTAELLRFKYVLTLVAVSVMVSALKPD*
Ga0182131_107509513300015331Switchgrass PhyllosphereQIRFVIIIIQFHTLCCKICGILYSLNSFVDPISSGLIGILPDSTARLLRFKYVLTLVAISVMVSALKSD*
Ga0182117_100291413300015332Switchgrass PhyllosphereSGLIGISPDSTAGLLRFKCVLTLGAVSVMVSALKLD*
Ga0182117_105819613300015332Switchgrass PhyllosphereMLHSLDCFVDPVSSGLIGNLPDSTAGLLHFKCVLALIAVSVMVSA
Ga0182117_112037223300015332Switchgrass PhyllosphereDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD*
Ga0182147_114339613300015333Switchgrass PhyllosphereICGMLHSLDCFVDPVSSGLIGILPDSTARLLRFKCVLTLVTVSGMVSALKPD*
Ga0182132_109092013300015334Switchgrass PhyllospherePISSGLIGILPDRTAGLLRFKCVLTLVAVLVMVSALKPD*
Ga0182132_109249513300015334Switchgrass PhyllosphereGMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLTMVSTLKPD*
Ga0182132_110285523300015334Switchgrass PhyllosphereLIGILSDSTAGLLRFKCVLTLIVVLMMVSALKPD*
Ga0182132_112540013300015334Switchgrass PhyllosphereMDYFVDPVLSDLIGILPDSTAELLCFKCVLTLVAVSVMISVLKLD*
Ga0182132_114903523300015334Switchgrass PhyllosphereYSLICFVDPVSSGLIGILPDNTAGLLRFKCVLTLFAVSVMVSALKPD*
Ga0182132_116307623300015334Switchgrass PhyllosphereCKICGMLHALNCFVDPVSSGLIGILPDSTAELLRFKCVLTLVTVSVMVSALKPD*
Ga0182116_104238513300015335Switchgrass PhyllosphereIRTRFVIIIQFHSLYCKICGMLHSLDCFVDPVLRGLIGILPDSTAGLLRFKCVLTLIIVLMMVSALKPD*
Ga0182116_110410013300015335Switchgrass PhyllosphereTRFVIIFQFHTLRCKICGMLYALDCFVDPVSRGLIGILPDSAAGLIRLKCVLTCIAFIEMVSALEPD*
Ga0182116_113174713300015335Switchgrass PhyllosphereSLDCFVDPVSSGLIGILPDSTSGLLRFKCVLTLVTVSVLVSTLKTD*
Ga0182150_100752923300015336Switchgrass PhyllosphereQTQFLIIVHFHTLYCKICGMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD*
Ga0182150_101248913300015336Switchgrass PhyllosphereSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD*
Ga0182150_108366323300015336Switchgrass PhyllosphereICGMLYSLNCFVDPILSGLIGILPDSTAGLLRFKCALTLVAVSRMVSALKPD*
Ga0182151_110344113300015337Switchgrass PhyllosphereCKICGMLQSLDCFVDPVSSGLIEILPDSTAGLLHLKCVLTCNAFMEMVSALEPD*
Ga0182137_101474313300015338Switchgrass PhyllosphereGLIGILPDSTAGLLRFKYVLTLIVVLMIVSALKPD*
Ga0182137_111198523300015338Switchgrass PhyllosphereFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTISVLVSALKPD*
Ga0182137_112670013300015338Switchgrass PhyllosphereTLYSKICGMLYSLNCFVDPVSSGLIGILLDSTAGFLRFKCVLTLGAVSVMVSTLKLD*
Ga0182137_114715223300015338Switchgrass PhyllosphereLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD*
Ga0182149_103622823300015339Switchgrass PhyllosphereLIGILPDSTAGLLHFKCVLTLVVVLVIVSALKPD*
Ga0182149_115246423300015339Switchgrass PhyllosphereMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD*
Ga0182149_116098723300015339Switchgrass PhyllospherePVLSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD*
Ga0182149_117515813300015339Switchgrass PhyllosphereIQFHSLYSKIYGMLYSLNCFVDPVSSGLIGVLPDSTAGLLRFKCVLTLVAVSVMVSALKPD*
Ga0182133_103409023300015340Switchgrass PhyllosphereLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD*
Ga0182133_109576133300015340Switchgrass PhyllosphereSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALEPD*
Ga0182133_112026113300015340Switchgrass PhyllosphereGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKLD*
Ga0182115_108864333300015348Switchgrass PhyllosphereFVILIQFHTLYCKIWGMLHSLDCFVDPVSSGLIGILPDSAAGLLCFKCVLTLVTVSVMVSAFKPD*
Ga0182115_112140513300015348Switchgrass PhyllosphereMDCFVDPVLNDLIGILPDSTAELLCFKYVLTLVAVSVMISVLKLD*
Ga0182115_117409623300015348Switchgrass PhyllosphereLDCFVDPVSSGLIGILPDSTAGLFRFKCVLTLITVSVMVSALKPD*
Ga0182115_119989813300015348Switchgrass PhyllosphereVSSGLIGILPDSIAGLLRFKCVLTLVTVSVLVSTLKTD*
Ga0182115_120142513300015348Switchgrass PhyllosphereMCCKICGMLYALDYFADPVSSGLIGILPDSTAGLLRLKCVLTC
Ga0182185_104423123300015349Switchgrass PhyllosphereCKICGMLHSLDCFVDPISSGLIGILPDSTARLLRFKCVLTVVAVSVMVSTLKPD*
Ga0182185_120702813300015349Switchgrass PhyllosphereVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD*
Ga0182163_103380513300015350Switchgrass PhyllosphereKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD*
Ga0182163_115449613300015350Switchgrass PhyllosphereSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD*
Ga0182163_117708323300015350Switchgrass PhyllosphereGMLHSLDCFVDPVSSGLIGILPDNTAGLLRFKCVLTLGAISVMVSALKPD*
Ga0182163_122828723300015350Switchgrass PhyllosphereKICGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSVLKLD*
Ga0182163_124903213300015350Switchgrass PhyllosphereFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKLD*
Ga0182163_129882013300015350Switchgrass PhyllosphereMLHSLDWFVDPVSSGLIGILPDSTAGLLRFKYVLTLVAVSVMISALKPD*
Ga0182169_101577013300015352Switchgrass PhyllosphereNNQFHTLYCKISGMLHSLDCFVDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD*
Ga0182169_111945913300015352Switchgrass PhyllosphereFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSTLKPD*
Ga0182169_113224113300015352Switchgrass PhyllosphereLNCFVDPVSSGLIGILPDSTAGLFRFKCVLTLIVVLMIISAFKPD*
Ga0182169_114330523300015352Switchgrass PhyllosphereCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSAFKPD*
Ga0182169_119650413300015352Switchgrass PhyllosphereNSFVDPISSGLIGILPDSTARLLRFKYVLTLVAISVMVSAL*
Ga0182169_120623113300015352Switchgrass PhyllosphereRYKICGMLYSLDCFVDPVSSGLIGILPDSTTGLLRLKCVLTCVMFMEMVSALEPD*
Ga0182169_124750713300015352Switchgrass PhyllosphereLCCKICGMLHSLDCFVDPVSSGLIGILPDSTAGLFRFKCVLTLVAVSVMVSALKLD*
Ga0182169_129662313300015352Switchgrass PhyllosphereDPVSSGLIGILPDSTAGLLRFKCMLTLIVVLIMVSALKPD*
Ga0182169_130203913300015352Switchgrass PhyllosphereMLYSLNCFVDSVSSGLIGILPDSTAGLFRLKCVLTCIAFMEMVSAL*
Ga0182169_130740323300015352Switchgrass PhyllosphereCKICGMLHSLNCFVDPVSSGLIEILPDSTAGLLRFKCGLTLVVVSVMVSALKPD*
Ga0182179_108473923300015353Switchgrass PhyllosphereSSGLIGILPDSTAGLLRFKCVIILVVVSVMVSALKLD*
Ga0182179_115509613300015353Switchgrass PhyllosphereLNCFVDPVSSGLIGILPDSIARLLRFKCALTLVAVSVMVSTLELD*
Ga0182179_123424623300015353Switchgrass PhyllosphereGLIGILPDNTAGLLRFKCVLTLIVVLVMVSALKSD*
Ga0182179_127705023300015353Switchgrass PhyllosphereGMLHSLDCFVDPVSSGLIGILHDNTAGLLRFKCVLTLIVILMMVSALKPD*
Ga0182179_128203823300015353Switchgrass PhyllosphereLIGILPDSTAGLLCFKCVLTLVVVSVMVSALKPD*
Ga0182167_101966833300015354Switchgrass PhyllosphereMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLTMVSTLKPD*
Ga0182167_112742513300015354Switchgrass PhyllosphereNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIIVLMMVSALKPD*
Ga0182167_115932713300015354Switchgrass PhyllosphereSGLIGILPDSTAGLLRFKCVLILIVVLMMVSALKPD*
Ga0182167_119012313300015354Switchgrass PhyllosphereLIGILPDSSAGLLRFKCVLTLIVVLMMVSVLKPD*
Ga0182167_126215423300015354Switchgrass PhyllosphereFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVRALNPD*
Ga0182167_128652913300015354Switchgrass PhyllosphereDPVSSGLIGILPDSTTELLRFMCVLTLVAVSLVVSALKPD*
Ga0182167_131059613300015354Switchgrass PhyllosphereMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVILM
Ga0182167_131978413300015354Switchgrass PhyllosphereLYCKICGMLYSLNCFADPVLSGLIGILPDSAAGLLRFKCVLTLIVVLMMVSALKPD*
Ga0182197_114697513300017408Switchgrass PhyllosphereMLHSLDCFVDPVSSGLIGILPDSTVGLLRFKYVLTPIAISVMVSALK
Ga0182199_108227113300017412Switchgrass PhyllosphereKICGMLYSLNCFVDPVSSGLIGILPDSTAGLLRLKCVLTCIAFMEMVSALEPD
Ga0182199_109802313300017412Switchgrass PhyllosphereMLHSLDCFVDHVLSGLIGILPDSTAGLLRFKCVLTLVA
Ga0182195_104421113300017414Switchgrass PhyllosphereMDCFVDPVLNDLIGILPDSTAELLCFKCVLTLVVVSVIISILKLD
Ga0182195_108023733300017414Switchgrass PhyllosphereIQFHTLYCKICGMLYSLNCFVDPVSSGLIGILHDSTAGLLCFKCVLILVAVSVMVSAFKP
Ga0182195_115488023300017414Switchgrass PhyllosphereGMLYSLDCFVDPISSGLIGILPDSTAGLLRFKCVLTLIFTLMMVSALKPG
Ga0182195_118637523300017414Switchgrass PhyllosphereMLHALDCFVDPVSIGLIGILPDNTAGLLHLKCVLTYNAFMETVSALEPD
Ga0182195_118918023300017414Switchgrass PhyllosphereMLHSLDCFVDPVSSGLIGILPDSTVGLLRFKCVLTLVTVS
Ga0182195_121570913300017414Switchgrass PhyllosphereVIIIHFQTLYCKICGMLYYLNCFVDPVSRGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPG
Ga0182213_108165613300017421Switchgrass PhyllosphereMLHSLDWFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD
Ga0182213_115425013300017421Switchgrass PhyllosphereTLYCKICEMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD
Ga0182213_120061513300017421Switchgrass PhyllosphereNCFVDPVSSGLIGILPDSTAGLLCFKCVLILVAVSVMVSALKPD
Ga0182201_107196513300017422Switchgrass PhyllosphereMLYSLNCFVNPVSSGLIGILPDSTAGLLRFKCVLTLV
Ga0182196_101016613300017432Switchgrass PhyllosphereSKICGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKRVLTLVTVSVMVSTLKPD
Ga0182196_110721513300017432Switchgrass PhyllosphereSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD
Ga0182196_115262423300017432Switchgrass PhyllosphereSLDCFVDRVSSVLIGILPDSTAGLLHLKCVLTIVTVSVMVSVLKPD
Ga0182200_108826513300017439Switchgrass PhyllosphereHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAELLRFKCVLTLIIVLMMVSALKPD
Ga0182200_113269613300017439Switchgrass PhyllosphereGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD
Ga0182200_116323213300017439Switchgrass PhyllosphereLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSTLKLD
Ga0182198_100713913300017445Switchgrass PhyllosphereMLHSLDCFVDPVSSGLIGSLPDSTAGLLRFKCVLTLIVVLIMVSALKPD
Ga0182198_111599823300017445Switchgrass PhyllosphereVLSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0182198_111626613300017445Switchgrass PhyllosphereIIQFHTLCYKICGMLHALNCFVDPVSSGLIGILPDSTTGLLRFKCVLTLIVILMMVSALKPD
Ga0182198_117252413300017445Switchgrass PhyllosphereTIIQFHTLFCKICEMLQSLDCFVDPVSSGLIGILPDSTARLLRFKCVLTLVTVSVMVSALKPN
Ga0182217_117190213300017446Switchgrass PhyllosphereMLYSLDGFVDPVSSGLIGILPDSTAGFLRFKCVLTLIVVLMMVSALKPD
Ga0182215_108847523300017447Switchgrass PhyllosphereLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0182215_115884313300017447Switchgrass PhyllosphereGFIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD
Ga0182210_111528813300017692Switchgrass PhyllosphereTLNCFVDPVLSGLIGILPDSTAGLLHFKCVLTLVTVSVMVSALKPD
Ga0182216_119166713300017693Switchgrass PhyllosphereMLHSLDCFVDPVSSGLIGILPDSTAGLFRFECVLTLVAVSVMVSALKLD
Ga0182211_108243613300017694Switchgrass PhyllosphereSGLIKILPDSTAGLLRFKCVLTLVTVSVMVSALKPD
Ga0182211_117389613300017694Switchgrass PhyllosphereMLHSLDCFVDPVSSGLIGILPDSTARLLRFKCVLTLVTVS
Ga0182178_101879723300020023Switchgrass PhyllosphereVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD
Ga0207668_1099266013300025972Switchgrass RhizosphereMIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSAL
Ga0207703_1073130523300026035Switchgrass RhizosphereLYCKIYEMLYSLNCFVDPVSSGLIRILPDSTVRLLRLKCVLTILAVIGDG
Ga0268322_103858023300028049PhyllosphereMLHSLDCFADPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVS
Ga0268328_106679913300028050PhyllospherePVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSAFKPD
Ga0268346_100063613300028053PhyllosphereFSFILCSVKFCGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAISVMVSALKP
Ga0268338_104448813300028055PhyllosphereMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIV
Ga0268332_102610123300028058PhyllosphereLDCFVDHVSSGLIGILPDSTAGLLHLKCVLTIVTVSVMVSVLKPD
Ga0268340_100185523300028064PhyllosphereMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKLD
Ga0268340_107511113300028064PhyllosphereMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLIMVSALKP
Ga0268340_108498813300028064PhyllosphereVIIIQFYTQCCKICGMLHALDCFVDPVSSGLIGILPDSTAGLLRFKCVLILVAISVMISALKPN
Ga0268326_101094413300028141PhyllosphereSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSAFKPD
Ga0268347_101201913300028142PhyllosphereMLHSLDCFVDPVSSDLIGILPDSTAGLLCFKCVLTLIVVLMMVSTL
Ga0268347_101785923300028142PhyllosphereMLHALNCFVDPVASGLIGILPDNIAGLLHFKCVLTLIVVLMMVTALKPD
Ga0268348_100881213300028143PhyllosphereMLHSLDCFVDPVSSGLIGILPDSTAGLFRFKCVLTLITISVMVRALK
Ga0268308_102957213300028151PhyllosphereMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLT
Ga0268264_1147731113300028381Switchgrass RhizosphereMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLV
Ga0268323_101313913300028471PhyllosphereSVKFCGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAISVMVSALKPD
Ga0268327_101338213300028475PhyllosphereLFDPGVSGFIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD
Ga0268313_100563313300028523PhyllosphereGMLYSLNCFVDPDSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0268311_101803613300028529PhyllosphereMIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD
Ga0214492_101657523300032464Switchgrass PhyllosphereMIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD
Ga0214493_100147653300032465Switchgrass PhyllosphereVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSVLKLD
Ga0214493_104627923300032465Switchgrass PhyllosphereSGLIGILPDSTAGLLRFKCMLTLIVVLMMVSALKPD
Ga0214493_110212613300032465Switchgrass PhyllosphereIIQFYTLYCKICGMLHSLDWFVDPVSSGLIGILPDSTAGLLRFKCVLTLFAISVMVSALKPD
Ga0214493_112729823300032465Switchgrass PhyllosphereDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0214493_114143513300032465Switchgrass PhyllosphereCKICGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD
Ga0214493_115086813300032465Switchgrass PhyllosphereVVLIGILPDSTAGLLRFKCVLTLVTISVLVSALKLD
Ga0214493_116089413300032465Switchgrass PhyllosphereCKICGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD
Ga0214503_108398813300032466Switchgrass PhyllosphereGMLHALNCFVDPVLSGLIGILPDSTAGLLRFKCALTLIVVLMMVSALKPD
Ga0214503_123582913300032466Switchgrass PhyllosphereMLHALNCFVDPVLSGLIGILLDSTAGLLRFKCVLTLIVVLMMVSALKPD
Ga0214488_113418413300032467Switchgrass PhyllospherePVSSGLIGILPDSTAGLLRFKCVLTLVTVSVLVSTLKMD
Ga0214482_101905613300032468Switchgrass PhyllosphereMLHALNCFVDPVLSGLIGILPDNTAGLLRFKCVLTLVTVSVMVSALKPD
Ga0214482_104935013300032468Switchgrass PhyllosphereLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD
Ga0214491_104274213300032469Switchgrass PhyllosphereLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMIVSALNPD
Ga0214491_106725723300032469Switchgrass PhyllosphereSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD
Ga0214495_109751913300032490Switchgrass PhyllosphereSVCNNNNQFHTLYCKICGILHPLDCFVDPISSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0214495_112150713300032490Switchgrass PhyllosphereMLHALNCFVDPVLSGLIGILPDSTAELLRFKCVLTLIVVLMMVSALKPD
Ga0214490_101050513300032502Switchgrass PhyllosphereCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0214490_104280113300032502Switchgrass PhyllosphereICGMLYFLNCFVDPVSSGLIGILPDNTAGLLHFKCVLTLVAVLVMVSTLKPD
Ga0214490_110275713300032502Switchgrass PhyllosphereCSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKPD
Ga0214502_125940913300032514Switchgrass PhyllosphereMLYSLNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVSALKP
Ga0321340_100453123300032550Switchgrass PhyllosphereCNNNNQFHTLYCKICEMLHSLDCFVDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0321340_104026213300032550Switchgrass PhyllosphereMIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIV
Ga0321340_105613823300032550Switchgrass PhyllosphereMLHALNCFVDPVLSGLIGILPDNTAGLLRFKCVLTLVTVS
Ga0214500_119665723300032589Switchgrass PhyllosphereLHALNCFVDPVLSGLIGILPDSTAGLFRFKCVLTQVTVSVMVSALKPD
Ga0214489_101071013300032590Switchgrass PhyllosphereSSGLIGILPDSTAELLRFKCVLTLIVVLMMVSALKPD
Ga0214489_103302723300032590Switchgrass PhyllosphereVCNNNNQFHTLYCKICGMLHSLDCFVDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0214484_106164613300032591Switchgrass PhyllosphereMIIQFHTLCCKICGMLYALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD
Ga0214504_109242913300032592Switchgrass PhyllosphereKICGILHPLDCFVDPISSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0214504_109632413300032592Switchgrass PhyllosphereMLHSLDCFVDPISSGLIGILPDSTAGLLRFKCVLT
Ga0214501_123861223300032625Switchgrass PhyllosphereFVDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0214499_111173223300032697Switchgrass PhyllosphereNCFVDPVLSGLIGILPDSTAGLLRFKCALTLIVVLMMVSALKPD
Ga0214499_118365513300032697Switchgrass PhyllosphereALYCKICEMLHSLDCFVDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0214494_105554913300032699Switchgrass PhyllosphereLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLSAVSVMVSALKPD
Ga0314746_113940013300032758Switchgrass PhyllosphereMIFQFYTLYCKICGMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCILTLVIISVMVSAFKLD
Ga0314742_105233013300032781Switchgrass PhyllospherePISSGLIGILPDSTAGLLRFKCVLTLSAVSVMVSALKPD
Ga0314742_108264313300032781Switchgrass PhyllosphereRFVIIIQFHTMCCKICGMLYALDYFVDPVSSGLIGILPDNTAGLLRLKCMLTCIVFMEMVSALEPD
Ga0314725_103693013300032789Switchgrass PhyllosphereCKICEMLHSLDCFVDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0314725_103711513300032789Switchgrass PhyllosphereMLHSLDCFVDPVSSGLIGSLPDSTAGLLRFKCVLTLIVVL
Ga0314748_112699413300032791Switchgrass PhyllosphereMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMV
Ga0314745_110786423300032812Switchgrass PhyllosphereIIQFHILCCKICGMLHALNCFVDPVLSGLIGILPDNTAGLLRFKCVLTLVTVSVMVSALKPD
Ga0314719_100703533300032821Switchgrass PhyllosphereQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLGAVSVMVSALKPD
Ga0314719_101882813300032821Switchgrass PhyllosphereLDCFVDPISSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0314730_12261713300032827Switchgrass PhyllosphereMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLT
Ga0314737_101352613300032875Switchgrass PhyllosphereMLYALDYFVDPVSSGLIRILPDSTAGLLRFKCVLTLV
Ga0314737_102074713300032875Switchgrass PhyllosphereMIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTGGLLRFKCVLTLGAVSVMVSALKPD
Ga0314751_106924013300032889Switchgrass PhyllosphereMLYSLNCFVDPVSSGLIGILPDSTAGLFRFKCVLTLIVV
Ga0314721_12504513300032917Switchgrass PhyllosphereVCNNNNQFHTLYCKICGILHPLDCFVDPISSGLIGILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0314717_13881513300032932Switchgrass PhyllosphereMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVA
Ga0314741_109492223300032934Switchgrass PhyllospherePVSSGLIGILPDSTAGLLRFKCVLTLVAVSVMISALKPD
Ga0314741_113438013300032934Switchgrass PhyllosphereMIIQFHTLCCKICGMLHALNCFVDPVLSGLIGILPDNTAGLLRFKCVLTLVTVSVMVSALKPD
Ga0314738_104120613300032959Switchgrass PhyllosphereMLHSLDCFVDPVSSGLIGILPDSTAGLLRFKCVLTLIVVLMMVNALNP
Ga0314758_101571223300033525Switchgrass PhyllosphereQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLHFKCALTLIVVLMMVSALKPD
Ga0314758_115211723300033525Switchgrass PhyllosphereVLSGLIGILPDNTAGLLRFKCVLTLVTVSVMVSALKPD
Ga0314761_100698613300033526Switchgrass PhyllosphereFHTLCCKICGMLHSLDCFVDPISSGLIGILPDSTAGLLRFKCVLTLVTVSMMVSALKPN
Ga0314761_105600513300033526Switchgrass PhyllosphereMLHALNCFVDPVLSGLIGILLDSTAGLLRFKCVLTLIV
Ga0314760_108062113300033530Switchgrass PhyllosphereICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLSAVSVMVSALKPD
Ga0314760_118641513300033530Switchgrass PhyllosphereMWYSLNCFVDPVSSGLIGILPDSTAGLLRFKCMLTLIVVLM
Ga0314767_111253413300033532Switchgrass PhyllosphereMIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLVTVSVMVSALKPD
Ga0314759_112779823300033535Switchgrass PhyllosphereMIIQFHTLCCKICGMLHALNCFVDPVSSGLIGILPDSTAGLLRFKCVLTLSAVSVMVSALKPD
Ga0314759_115259613300033535Switchgrass PhyllosphereMLHSLDCFVDPVSSGLIGILPDSTAELLHFKCVLT
Ga0314762_110199713300033539Switchgrass PhyllosphereMLHSLDCFVDPVSSGLIGILPDNTAGLLRFKFVLTLIAVSVMVSALKPD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.