Basic Information | |
---|---|
Family ID | F013303 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 272 |
Average Sequence Length | 44 residues |
Representative Sequence | KRVDAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN |
Number of Associated Samples | 206 |
Number of Associated Scaffolds | 272 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.53 % |
% of genes from short scaffolds (< 2000 bps) | 93.75 % |
Associated GOLD sequencing projects | 196 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.15 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (90.441 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (23.529 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.485 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (68.015 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.56% β-sheet: 0.00% Coil/Unstructured: 94.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 272 Family Scaffolds |
---|---|---|
PF05065 | Phage_capsid | 79.04 |
PF10145 | PhageMin_Tail | 0.37 |
PF04860 | Phage_portal | 0.37 |
COG ID | Name | Functional Category | % Frequency in 272 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 79.04 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.43 % |
Unclassified | root | N/A | 2.57 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000882|FwDRAFT_10334829 | Not Available | 503 | Open in IMG/M |
3300002408|B570J29032_109886583 | All Organisms → Viruses → Predicted Viral | 1995 | Open in IMG/M |
3300002835|B570J40625_100056859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5439 | Open in IMG/M |
3300003394|JGI25907J50239_1096234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 578 | Open in IMG/M |
3300003430|JGI25921J50272_10020272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1802 | Open in IMG/M |
3300003497|JGI25925J51416_10075294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 841 | Open in IMG/M |
3300003499|JGI25930J51415_1018211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1340 | Open in IMG/M |
3300003684|Ga0005851_1012550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 645 | Open in IMG/M |
3300003754|Ga0005853_1063201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 556 | Open in IMG/M |
3300004112|Ga0065166_10354081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 607 | Open in IMG/M |
3300004126|Ga0066179_10180682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 583 | Open in IMG/M |
3300004128|Ga0066180_10321627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 610 | Open in IMG/M |
3300004765|Ga0007745_1015403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 637 | Open in IMG/M |
3300004768|Ga0007762_1599014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 852 | Open in IMG/M |
3300004769|Ga0007748_10063897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 679 | Open in IMG/M |
3300004769|Ga0007748_10077920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1194 | Open in IMG/M |
3300004769|Ga0007748_11585327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 540 | Open in IMG/M |
3300004794|Ga0007751_11484105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1198 | Open in IMG/M |
3300004795|Ga0007756_10145541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 656 | Open in IMG/M |
3300004795|Ga0007756_11584749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 699 | Open in IMG/M |
3300004810|Ga0007757_10042592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 786 | Open in IMG/M |
3300005416|Ga0068880_1001262 | All Organisms → Viruses → Predicted Viral | 1224 | Open in IMG/M |
3300005416|Ga0068880_1007387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1108 | Open in IMG/M |
3300005417|Ga0068884_1045698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1131 | Open in IMG/M |
3300005421|Ga0068882_1047760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1195 | Open in IMG/M |
3300005421|Ga0068882_1055551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1226 | Open in IMG/M |
3300005525|Ga0068877_10267595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 998 | Open in IMG/M |
3300005527|Ga0068876_10080800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1951 | Open in IMG/M |
3300005527|Ga0068876_10330475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 860 | Open in IMG/M |
3300005565|Ga0068885_1927655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 768 | Open in IMG/M |
3300005583|Ga0049085_10307213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 515 | Open in IMG/M |
3300005662|Ga0078894_10306392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1440 | Open in IMG/M |
3300005662|Ga0078894_10861662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 788 | Open in IMG/M |
3300005662|Ga0078894_10878166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 779 | Open in IMG/M |
3300005662|Ga0078894_11376104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 590 | Open in IMG/M |
3300005805|Ga0079957_1197393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 974 | Open in IMG/M |
3300006378|Ga0075498_1362110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1121 | Open in IMG/M |
3300007165|Ga0079302_1036243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1177 | Open in IMG/M |
3300007171|Ga0102977_1050926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1095 | Open in IMG/M |
3300007319|Ga0102691_1094842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 782 | Open in IMG/M |
3300007319|Ga0102691_1139218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 663 | Open in IMG/M |
3300007321|Ga0102692_1144833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1254 | Open in IMG/M |
3300007321|Ga0102692_1599267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1182 | Open in IMG/M |
3300007534|Ga0102690_1212312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1048 | Open in IMG/M |
3300007600|Ga0102920_1082537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1017 | Open in IMG/M |
3300007600|Ga0102920_1163874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 713 | Open in IMG/M |
3300007600|Ga0102920_1191131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 657 | Open in IMG/M |
3300007603|Ga0102921_1158777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 818 | Open in IMG/M |
3300007632|Ga0102894_1102033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 755 | Open in IMG/M |
3300007658|Ga0102898_1079344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 752 | Open in IMG/M |
3300007716|Ga0102867_1115968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 717 | Open in IMG/M |
3300007718|Ga0102852_1099251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 575 | Open in IMG/M |
3300007861|Ga0105736_1009193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1631 | Open in IMG/M |
3300007992|Ga0105748_10138790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 991 | Open in IMG/M |
3300008107|Ga0114340_1152953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 847 | Open in IMG/M |
3300008107|Ga0114340_1161166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 812 | Open in IMG/M |
3300008110|Ga0114343_1102823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 986 | Open in IMG/M |
3300008111|Ga0114344_1184440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 679 | Open in IMG/M |
3300008113|Ga0114346_1121204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1164 | Open in IMG/M |
3300008114|Ga0114347_1097593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1143 | Open in IMG/M |
3300008448|Ga0114876_1002825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11990 | Open in IMG/M |
3300008510|Ga0110928_1109239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 551 | Open in IMG/M |
3300009009|Ga0105105_11008755 | Not Available | 517 | Open in IMG/M |
3300009057|Ga0102892_1082230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 620 | Open in IMG/M |
3300009152|Ga0114980_10789526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 529 | Open in IMG/M |
3300009158|Ga0114977_10362688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 814 | Open in IMG/M |
3300009159|Ga0114978_10439731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 775 | Open in IMG/M |
3300009183|Ga0114974_10286778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 973 | Open in IMG/M |
3300009183|Ga0114974_10598356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 608 | Open in IMG/M |
3300009185|Ga0114971_10017650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4656 | Open in IMG/M |
3300009233|Ga0103856_10042393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 798 | Open in IMG/M |
3300009233|Ga0103856_10091936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 571 | Open in IMG/M |
3300009243|Ga0103860_10019605 | All Organisms → Viruses → Predicted Viral | 1210 | Open in IMG/M |
3300009243|Ga0103860_10033387 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300009247|Ga0103861_10026677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 814 | Open in IMG/M |
3300009249|Ga0103862_1019935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 846 | Open in IMG/M |
3300009252|Ga0103863_10005868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1230 | Open in IMG/M |
3300009257|Ga0103869_10046906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 967 | Open in IMG/M |
3300009337|Ga0103864_1001599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 994 | Open in IMG/M |
3300009384|Ga0103868_1004449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 949 | Open in IMG/M |
3300009419|Ga0114982_1244838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 558 | Open in IMG/M |
3300010354|Ga0129333_10000567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 30739 | Open in IMG/M |
3300010354|Ga0129333_10427944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1168 | Open in IMG/M |
3300010354|Ga0129333_10486805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1083 | Open in IMG/M |
3300010354|Ga0129333_11238074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 619 | Open in IMG/M |
3300010370|Ga0129336_10320901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 857 | Open in IMG/M |
3300010370|Ga0129336_10535426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 629 | Open in IMG/M |
3300010388|Ga0136551_1034232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 951 | Open in IMG/M |
3300010388|Ga0136551_1046409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 795 | Open in IMG/M |
3300011011|Ga0139556_1002836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2603 | Open in IMG/M |
3300011381|Ga0102688_1184534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 764 | Open in IMG/M |
3300011381|Ga0102688_1680241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1236 | Open in IMG/M |
3300012013|Ga0153805_1000828 | Not Available | 6402 | Open in IMG/M |
3300012346|Ga0157141_1043946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 553 | Open in IMG/M |
3300012666|Ga0157498_1023764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 953 | Open in IMG/M |
3300012666|Ga0157498_1071397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 535 | Open in IMG/M |
3300012702|Ga0157596_1015226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 549 | Open in IMG/M |
3300012702|Ga0157596_1121522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1184 | Open in IMG/M |
3300012712|Ga0157598_1203114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1023 | Open in IMG/M |
3300012714|Ga0157601_1043944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1190 | Open in IMG/M |
3300012715|Ga0157599_1138820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 910 | Open in IMG/M |
3300012717|Ga0157609_1108415 | Not Available | 502 | Open in IMG/M |
3300012717|Ga0157609_1247467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 678 | Open in IMG/M |
3300012724|Ga0157611_1097278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1096 | Open in IMG/M |
3300012724|Ga0157611_1211326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 854 | Open in IMG/M |
3300012726|Ga0157597_1272563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 614 | Open in IMG/M |
3300012731|Ga0157616_1091019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 685 | Open in IMG/M |
3300012731|Ga0157616_1110060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1116 | Open in IMG/M |
3300012733|Ga0157606_1144032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 927 | Open in IMG/M |
3300012734|Ga0157615_1182415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 900 | Open in IMG/M |
3300012752|Ga0157629_1038332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 784 | Open in IMG/M |
3300012757|Ga0157628_1034832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 751 | Open in IMG/M |
3300012773|Ga0138290_1037706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1182 | Open in IMG/M |
3300012779|Ga0138284_1239614 | Not Available | 951 | Open in IMG/M |
3300012959|Ga0157620_1035983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 604 | Open in IMG/M |
3300012968|Ga0129337_1049130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 726 | Open in IMG/M |
3300012968|Ga0129337_1229572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1128 | Open in IMG/M |
3300012968|Ga0129337_1345936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 611 | Open in IMG/M |
3300012968|Ga0129337_1464711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 691 | Open in IMG/M |
3300012970|Ga0129338_1007662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1122 | Open in IMG/M |
3300012970|Ga0129338_1096625 | All Organisms → Viruses → Predicted Viral | 1252 | Open in IMG/M |
3300012970|Ga0129338_1134541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 963 | Open in IMG/M |
3300012970|Ga0129338_1204677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1189 | Open in IMG/M |
3300012970|Ga0129338_1405360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 615 | Open in IMG/M |
3300013004|Ga0164293_10053205 | All Organisms → Viruses → Predicted Viral | 3254 | Open in IMG/M |
3300013004|Ga0164293_10287159 | All Organisms → Viruses → Predicted Viral | 1146 | Open in IMG/M |
3300013005|Ga0164292_10081814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2466 | Open in IMG/M |
3300013005|Ga0164292_10548390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 752 | Open in IMG/M |
3300013076|Ga0157551_1141889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 877 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10246291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1182 | Open in IMG/M |
3300014962|Ga0134315_1060375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 583 | Open in IMG/M |
3300016681|Ga0180043_106508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 608 | Open in IMG/M |
3300016686|Ga0180056_1015976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 723 | Open in IMG/M |
3300016686|Ga0180056_1054028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1098 | Open in IMG/M |
3300016686|Ga0180056_1059464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 510 | Open in IMG/M |
3300016691|Ga0180055_1060939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 585 | Open in IMG/M |
3300016691|Ga0180055_1168365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 556 | Open in IMG/M |
3300016695|Ga0180059_1161842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1139 | Open in IMG/M |
3300016697|Ga0180057_1174177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1108 | Open in IMG/M |
3300016699|Ga0180058_1053184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 713 | Open in IMG/M |
3300017761|Ga0181356_1225320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 544 | Open in IMG/M |
3300017766|Ga0181343_1116218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 754 | Open in IMG/M |
3300017774|Ga0181358_1076953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1224 | Open in IMG/M |
3300018619|Ga0188877_1014040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 670 | Open in IMG/M |
3300018633|Ga0188879_1005786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 977 | Open in IMG/M |
3300018665|Ga0188882_1015261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 668 | Open in IMG/M |
3300019146|Ga0188881_10024299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 753 | Open in IMG/M |
3300019200|Ga0180036_1087741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 546 | Open in IMG/M |
3300019201|Ga0180032_1000887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1293 | Open in IMG/M |
3300020151|Ga0211736_10528928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4197 | Open in IMG/M |
3300020172|Ga0211729_11016235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1018 | Open in IMG/M |
3300020578|Ga0194129_10211668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1168 | Open in IMG/M |
3300020578|Ga0194129_10281229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 947 | Open in IMG/M |
3300021140|Ga0214168_1020579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1836 | Open in IMG/M |
3300021141|Ga0214163_1046953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1137 | Open in IMG/M |
3300021963|Ga0222712_10033672 | All Organisms → Viruses → Predicted Viral | 4015 | Open in IMG/M |
3300021963|Ga0222712_10259209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1108 | Open in IMG/M |
3300021963|Ga0222712_10614815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 625 | Open in IMG/M |
3300024343|Ga0244777_10676386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 619 | Open in IMG/M |
3300024346|Ga0244775_10024383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 5446 | Open in IMG/M |
3300024352|Ga0255142_1008133 | All Organisms → Viruses | 1749 | Open in IMG/M |
3300024480|Ga0255223_1034289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 851 | Open in IMG/M |
3300024480|Ga0255223_1037954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 812 | Open in IMG/M |
3300024482|Ga0255265_1041603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 912 | Open in IMG/M |
3300024485|Ga0256318_1024461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 1261 | Open in IMG/M |
3300024485|Ga0256318_1083792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 682 | Open in IMG/M |
3300024495|Ga0255164_1028107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 928 | Open in IMG/M |
3300024507|Ga0255176_1082814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 557 | Open in IMG/M |
3300024513|Ga0255144_1053282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 678 | Open in IMG/M |
3300024531|Ga0255228_1040100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 935 | Open in IMG/M |
3300024531|Ga0255228_1072813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 694 | Open in IMG/M |
3300024536|Ga0256338_1029628 | All Organisms → Viruses → Predicted Viral | 1235 | Open in IMG/M |
3300024546|Ga0256356_1077061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 612 | Open in IMG/M |
3300024552|Ga0256345_1023710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1216 | Open in IMG/M |
3300024553|Ga0255301_1054820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 721 | Open in IMG/M |
3300024557|Ga0255283_1033043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1147 | Open in IMG/M |
3300024560|Ga0256306_1109117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 644 | Open in IMG/M |
3300024563|Ga0255236_1037988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1133 | Open in IMG/M |
3300024565|Ga0255273_1032134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1206 | Open in IMG/M |
3300024567|Ga0256307_1056650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 930 | Open in IMG/M |
3300024569|Ga0255243_1034092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1314 | Open in IMG/M |
3300024571|Ga0256302_1048592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 995 | Open in IMG/M |
3300024572|Ga0255268_1034289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1270 | Open in IMG/M |
3300024572|Ga0255268_1037425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1217 | Open in IMG/M |
3300024849|Ga0255230_1016500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1282 | Open in IMG/M |
3300024849|Ga0255230_1018989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1205 | Open in IMG/M |
3300024852|Ga0255295_1033259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1006 | Open in IMG/M |
3300024852|Ga0255295_1045400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 853 | Open in IMG/M |
3300024854|Ga0255287_1036649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1177 | Open in IMG/M |
3300024854|Ga0255287_1039689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1121 | Open in IMG/M |
3300024864|Ga0255271_1122140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 569 | Open in IMG/M |
3300024867|Ga0255267_1031042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1238 | Open in IMG/M |
3300025747|Ga0255247_1013801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 985 | Open in IMG/M |
3300025872|Ga0208783_10049912 | All Organisms → Viruses → Predicted Viral | 1923 | Open in IMG/M |
3300026409|Ga0255307_1013206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1180 | Open in IMG/M |
3300026415|Ga0256298_1013000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1085 | Open in IMG/M |
3300026415|Ga0256298_1020020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 884 | Open in IMG/M |
3300026415|Ga0256298_1050035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 570 | Open in IMG/M |
3300026425|Ga0256300_1062111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 537 | Open in IMG/M |
3300026435|Ga0256297_1015903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1128 | Open in IMG/M |
3300026435|Ga0256297_1036195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 768 | Open in IMG/M |
3300026569|Ga0255277_1041914 | All Organisms → Viruses → Predicted Viral | 1198 | Open in IMG/M |
3300026569|Ga0255277_1092017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 763 | Open in IMG/M |
3300026572|Ga0255270_1194004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 504 | Open in IMG/M |
3300027121|Ga0255074_1004440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1975 | Open in IMG/M |
3300027123|Ga0255090_1003052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3978 | Open in IMG/M |
3300027131|Ga0255066_1018008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1034 | Open in IMG/M |
3300027141|Ga0255076_1048336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 730 | Open in IMG/M |
3300027156|Ga0255078_1093675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 573 | Open in IMG/M |
3300027160|Ga0255198_1011899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1728 | Open in IMG/M |
3300027186|Ga0208797_1045431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 558 | Open in IMG/M |
3300027231|Ga0208172_1053341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 712 | Open in IMG/M |
3300027239|Ga0208807_1058766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 518 | Open in IMG/M |
3300027247|Ga0208679_1056669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 727 | Open in IMG/M |
3300027305|Ga0208168_1076871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 686 | Open in IMG/M |
3300027337|Ga0255087_1065958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 659 | Open in IMG/M |
3300027503|Ga0255182_1086262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 748 | Open in IMG/M |
3300027581|Ga0209651_1088120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 885 | Open in IMG/M |
3300027601|Ga0255079_1024015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1393 | Open in IMG/M |
3300027621|Ga0208951_1154063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 597 | Open in IMG/M |
3300027631|Ga0208133_1010196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2590 | Open in IMG/M |
3300027631|Ga0208133_1035432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1237 | Open in IMG/M |
3300027679|Ga0209769_1208154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 605 | Open in IMG/M |
3300027756|Ga0209444_10321881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 510 | Open in IMG/M |
3300027762|Ga0209288_10323039 | Not Available | 515 | Open in IMG/M |
3300027769|Ga0209770_10020146 | All Organisms → Viruses → Predicted Viral | 2942 | Open in IMG/M |
3300027785|Ga0209246_10116308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1050 | Open in IMG/M |
3300027798|Ga0209353_10110818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1236 | Open in IMG/M |
3300027804|Ga0209358_10469194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 579 | Open in IMG/M |
3300027805|Ga0209229_10417822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 580 | Open in IMG/M |
3300027816|Ga0209990_10070687 | All Organisms → Viruses → Predicted Viral | 1735 | Open in IMG/M |
3300027816|Ga0209990_10182394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 981 | Open in IMG/M |
3300027892|Ga0209550_10161695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1580 | Open in IMG/M |
3300027892|Ga0209550_10342633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 945 | Open in IMG/M |
3300027892|Ga0209550_10718212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 572 | Open in IMG/M |
3300028103|Ga0255172_1087937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 554 | Open in IMG/M |
3300028108|Ga0256305_1059805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 942 | Open in IMG/M |
3300028112|Ga0256335_1062701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 983 | Open in IMG/M |
3300028113|Ga0255234_1061284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 991 | Open in IMG/M |
3300028113|Ga0255234_1186198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 544 | Open in IMG/M |
3300028117|Ga0255290_100743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1203 | Open in IMG/M |
3300028178|Ga0265593_1176371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 539 | Open in IMG/M |
3300028266|Ga0255227_1060087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 589 | Open in IMG/M |
3300028266|Ga0255227_1064420 | Not Available | 569 | Open in IMG/M |
3300028530|Ga0255279_1020471 | All Organisms → Viruses → Predicted Viral | 1159 | Open in IMG/M |
3300029697|Ga0256301_1015128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1264 | Open in IMG/M |
3300029697|Ga0256301_1074943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 582 | Open in IMG/M |
3300029699|Ga0255233_1022370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1229 | Open in IMG/M |
3300031758|Ga0315907_10393040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1119 | Open in IMG/M |
3300031758|Ga0315907_10760929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 728 | Open in IMG/M |
3300031758|Ga0315907_10982225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 611 | Open in IMG/M |
3300031857|Ga0315909_10433133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 931 | Open in IMG/M |
3300031951|Ga0315904_10609610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 937 | Open in IMG/M |
3300031951|Ga0315904_10903567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 712 | Open in IMG/M |
3300031963|Ga0315901_10687906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 760 | Open in IMG/M |
3300031963|Ga0315901_10807041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 679 | Open in IMG/M |
3300032116|Ga0315903_10312433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1321 | Open in IMG/M |
3300033981|Ga0334982_0189444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1023 | Open in IMG/M |
3300033992|Ga0334992_0507288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 521 | Open in IMG/M |
3300034061|Ga0334987_0591299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 657 | Open in IMG/M |
3300034068|Ga0334990_0037293 | All Organisms → Viruses → Predicted Viral | 2599 | Open in IMG/M |
3300034068|Ga0334990_0346087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 805 | Open in IMG/M |
3300034071|Ga0335028_0195115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1258 | Open in IMG/M |
3300034092|Ga0335010_0605104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 555 | Open in IMG/M |
3300034103|Ga0335030_0248586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1214 | Open in IMG/M |
3300034112|Ga0335066_0458629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 684 | Open in IMG/M |
3300034118|Ga0335053_0076787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2343 | Open in IMG/M |
3300034122|Ga0335060_0565710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 576 | Open in IMG/M |
3300034168|Ga0335061_0036411 | All Organisms → Viruses → Predicted Viral | 2633 | Open in IMG/M |
3300034272|Ga0335049_0418805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 873 | Open in IMG/M |
3300034279|Ga0335052_0220703 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
3300034284|Ga0335013_0594681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 647 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 23.53% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 20.22% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.28% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.25% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.04% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 3.68% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.31% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.94% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.21% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.21% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.10% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.10% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.10% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.10% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.10% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.74% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.74% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.74% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.74% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.74% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.74% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.74% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.37% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.37% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.37% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.37% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.37% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.37% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.37% |
Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.37% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.37% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.37% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300003684 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA - 2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300003754 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
3300004765 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004768 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004794 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004810 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005416 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005417 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005421 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006378 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007319 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007321 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007534 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
3300007632 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 | Environmental | Open in IMG/M |
3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
3300007718 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 | Environmental | Open in IMG/M |
3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008510 | Microbial Communities in Water bodies, Singapore - Site RA | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009057 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
3300009247 | Microbial communities of water from Amazon river, Brazil - RCM14 | Environmental | Open in IMG/M |
3300009249 | Microbial communities of water from Amazon river, Brazil - RCM15 | Environmental | Open in IMG/M |
3300009252 | Microbial communities of water from Amazon river, Brazil - RCM16 | Environmental | Open in IMG/M |
3300009257 | Microbial communities of water from Amazon river, Brazil - RCM22 | Environmental | Open in IMG/M |
3300009337 | Microbial communities of water from Amazon river, Brazil - RCM17 | Environmental | Open in IMG/M |
3300009384 | Microbial communities of water from Amazon river, Brazil - RCM21 | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012712 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012726 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012752 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012757 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012773 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012959 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES150 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013076 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES042 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300016681 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES152 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016686 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES143 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016691 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES124 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016695 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES164 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016697 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES156 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016699 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES160 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300018619 | Metatranscriptome of marine microbial communities from Baltic Sea - GS855_ls4 | Environmental | Open in IMG/M |
3300018633 | Metatranscriptome of marine microbial communities from Baltic Sea - GS857_ls5 | Environmental | Open in IMG/M |
3300018665 | Metatranscriptome of marine microbial communities from Baltic Sea - LD30M_ls2 | Environmental | Open in IMG/M |
3300019146 | Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5 | Environmental | Open in IMG/M |
3300019200 | Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019201 | Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024482 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024485 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024495 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d | Environmental | Open in IMG/M |
3300024507 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d | Environmental | Open in IMG/M |
3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024536 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024546 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024552 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024553 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024560 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024563 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024565 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024567 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024569 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024849 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024852 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024854 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024864 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024867 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025747 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026409 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026415 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026425 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026435 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
3300027156 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027160 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepC_8h | Environmental | Open in IMG/M |
3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
3300027231 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027239 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027247 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027305 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
3300027503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028112 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028113 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028117 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
3300028266 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028530 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029697 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029699 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
FwDRAFT_103348291 | 3300000882 | Freshwater And Marine | NNLSETVKGIRETIGSVEKRIDAVEGETAIKKSADLGGSTEFVKKSKWSGAFLGSVNDILN* |
B570J29032_1098865834 | 3300002408 | Freshwater | KRVDAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVQEIFN* |
B570J40625_1000568598 | 3300002835 | Freshwater | EKRVDAVESDTAIKKSSDLGGSTGVTIKKSKWNGTFLGSVSELTK* |
JGI25907J50239_10962341 | 3300003394 | Freshwater Lake | DTVEKRVDAVESDTAIKKSSDLGGSTGVTIKKSKWNGTFLGSVSELTK* |
JGI25921J50272_100202721 | 3300003430 | Freshwater Lake | VQKQVDAVEGDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN* |
JGI25925J51416_100752942 | 3300003497 | Freshwater Lake | SDAVADIKNTISGVQKRVDAVEGSTAIKKSSDLGGSVGSTIKKSKWNGTFLGSVNEIFN* |
JGI25930J51415_10182111 | 3300003499 | Freshwater Lake | IKSIMDTVEKRVDAVESDTAIKKSSDLGGSTGVTIKKSKWNGTFLGSVSELTK* |
Ga0005851_10125501 | 3300003684 | Freshwater And Sediment | EKRVDAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN* |
Ga0005853_10632011 | 3300003754 | Freshwater And Sediment | VEGDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN* |
Ga0065166_103540811 | 3300004112 | Freshwater Lake | QKRVDAVEGETAIKKSSDLGGSEVVTKSKSKWNGSFLGSVNEIFN* |
Ga0066179_101806822 | 3300004126 | Freshwater Lake | KRVDAVESETAIKKSSDLGGSQEVVMKKSKWNGSFLGSVNELFN* |
Ga0066180_103216271 | 3300004128 | Freshwater Lake | AVESETAIKKSSDLGGSQEVSTIKKSKWNGSFLGSVNELIR* |
Ga0007745_10154031 | 3300004765 | Freshwater Lake | KNTISGVQKRVDAVEGSTAIKKSSDLGGSVGSTIKKSKWNGTFLGSVNEIFN* |
Ga0007762_15990142 | 3300004768 | Freshwater Lake | EKHSTLSDAVADIKNTISGVQKRVDAVEGSTAIKKSSDLGGSVGSTIKKSKWNGTFLGSVNEIFN* |
Ga0007748_100638972 | 3300004769 | Freshwater Lake | VESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN* |
Ga0007748_100779201 | 3300004769 | Freshwater Lake | KRVDAVEGDTAIKKSSDLGGSAVLATNKSKWNGSFLGSVNEIFN* |
Ga0007748_115853271 | 3300004769 | Freshwater Lake | KRVDAVESETAIKKSSDLGGSQGVTIKKSKWNGSFLGSVNDIIN* |
Ga0007751_114841051 | 3300004794 | Freshwater Lake | AVESETAIKKSSDLGGSQEVMIKKSKWNGSFLGSVNEIFN* |
Ga0007756_101455411 | 3300004795 | Freshwater Lake | TEIKGTIDGVQKQVDAVEGDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN* |
Ga0007756_115847491 | 3300004795 | Freshwater Lake | EKRVDAVESDTAIKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIR* |
Ga0007757_100425922 | 3300004810 | Freshwater Lake | DAVESETAIKKSSDLGGSQEVVMKKSKWNGSFLGSVNELFN* |
Ga0068880_10012621 | 3300005416 | Freshwater Lake | IKNTIEGVEKRVDAVESETAIKKSSDLGGSEGVTIKKSKWNGSFLGSVQEIFN* |
Ga0068880_10073872 | 3300005416 | Freshwater Lake | AVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN* |
Ga0068884_10456981 | 3300005417 | Freshwater Lake | VESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVTELIK* |
Ga0068882_10477601 | 3300005421 | Freshwater Lake | GVEKRVDAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVTELIK* |
Ga0068882_10555512 | 3300005421 | Freshwater Lake | KRVDAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN* |
Ga0068877_102675952 | 3300005525 | Freshwater Lake | KNTIDGVEKRVDAVESETAIKKSSDLGGSQEVIIKKSKWNGSFLGSVNEIFN* |
Ga0068876_100808004 | 3300005527 | Freshwater Lake | TAIKKSSDLGGSQEVITKSKSKWNGSFLGSVNELFN* |
Ga0068876_103304752 | 3300005527 | Freshwater Lake | ESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN* |
Ga0068885_19276552 | 3300005565 | Freshwater Lake | AVESETAIKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIK* |
Ga0049085_103072132 | 3300005583 | Freshwater Lentic | RVDAVESETAIKKSSDLGGSQEVMIKKSKWNGSFLGSVNEIFN* |
Ga0078894_103063921 | 3300005662 | Freshwater Lake | KRVDAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVTELIK* |
Ga0078894_108616621 | 3300005662 | Freshwater Lake | ESETAIKKSSDLGGSQGVTIKKSKWNGSFLGSVNDIIN* |
Ga0078894_108781661 | 3300005662 | Freshwater Lake | TAIKKSSDLGGSAGVTIKKSKWNGTFLGSVSELTK* |
Ga0078894_113761041 | 3300005662 | Freshwater Lake | AIKKSSDLGGSVAPAVNKSKWNGSFLGSVNEIFN* |
Ga0079957_11973931 | 3300005805 | Lake | SKAVEDIKSTIDGVEKRVVAVESDTAVKKSSDLGGSQEVTIKKSKWNGSFLGSVNELIK* |
Ga0075498_13621102 | 3300006378 | Aqueous | ETAIKKSLDLGGSQEVTIKKSKWNGSFLGSVNEIFN* |
Ga0079302_10362431 | 3300007165 | Deep Subsurface | VEKRVDAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVTELIK* |
Ga0102977_10509262 | 3300007171 | Freshwater Lake | TAIKKSSDLGGSQEVTIKKSKWNGSFLGSVQEIFN* |
Ga0102691_10948422 | 3300007319 | Freshwater Lake | ESETAIKKSSDLGGSQEVITKSKSKWNGSFLGSVNELFN* |
Ga0102691_11392182 | 3300007319 | Freshwater Lake | EDIKNTIDGVEKRVVAVESETAVKKSSDLGGSQEVTIKKSKWNGSFLGSVNELLK* |
Ga0102692_11448331 | 3300007321 | Freshwater Lake | KRVVAVESETAIKKSSDLGGSQEVITKSKSKWNGSFLGSVNELFN* |
Ga0102692_15992671 | 3300007321 | Freshwater Lake | TIDGVQKRVDAVEGDTAIKKSSDLGGSAVLATNKSKWNGSFLGSVNEIFN* |
Ga0102690_12123121 | 3300007534 | Freshwater Lake | AIKKSSDLGGSQEVTIKKSKWNGSFLSSVDQLLK* |
Ga0102920_10825372 | 3300007600 | Estuarine | SDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN* |
Ga0102920_11638742 | 3300007600 | Estuarine | ESETAIKKSSDLGRSEEVTIKKSKWNGSFLGSVNEIFN* |
Ga0102920_11911312 | 3300007600 | Estuarine | ESETAIKKSSDLGRSEEVTIRKSKWNGSFLGSVNEIFN* |
Ga0102921_11587771 | 3300007603 | Estuarine | TAIKKSSDLGRSEEVTIKKSKWNGSFLGSVNEIFN* |
Ga0102894_11020332 | 3300007632 | Estuarine | VDAVEGDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN* |
Ga0102898_10793442 | 3300007658 | Estuarine | ETAIKKSSDLGGSQEVTIKKSKWNGSSLGSVNEIFN* |
Ga0102867_11159682 | 3300007716 | Estuarine | GDTAIKKSSDLGGSAVQAVNKSKWNGSFLGSVNEIFN* |
Ga0102852_10992511 | 3300007718 | Estuarine | DAVEGDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN* |
Ga0105736_10091933 | 3300007861 | Estuary Water | DTAIKKSSDLGGSAVPAVNKSKWNGSFLGSVNEIFN* |
Ga0105748_101387901 | 3300007992 | Estuary Water | MLSTAVENIKNTIDGVQKRVDAVESETAIKKSSDLGGSQEVMIKKSKRNGSF |
Ga0114340_11529531 | 3300008107 | Freshwater, Plankton | RVDAVESETAIKKSSDLGGSQEVKIQKSKWNGSFLGSVNELFK* |
Ga0114340_11611661 | 3300008107 | Freshwater, Plankton | ETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN* |
Ga0114343_11028231 | 3300008110 | Freshwater, Plankton | VEKRVDAVESETAIKKSSDLGGSQEVKIQKSKWNGSFLGSVNELFK* |
Ga0114344_11844402 | 3300008111 | Freshwater, Plankton | TAFKKSSDLGGSQEITIKKSKWNGSFLGSVNELLK* |
Ga0114346_11212042 | 3300008113 | Freshwater, Plankton | ETAIKKSSDLGRSEEATIKKSKWNGSFLGSVNEIFN* |
Ga0114347_10975931 | 3300008114 | Freshwater, Plankton | RVDAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNELFN* |
Ga0114876_100282511 | 3300008448 | Freshwater Lake | SETAIKKSSDLGGSQEVKIQKSKWNGSFLGSVNELFK* |
Ga0110928_11092392 | 3300008510 | Water Bodies | VEKRVEAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNELFN* |
Ga0105105_110087551 | 3300009009 | Freshwater Sediment | LSKTVSDIRNTIDGVQKRVDAVEGETAIKKSSDLGGSQEVSTIKKSKWNGSFLGSVNELIR* |
Ga0102892_10822301 | 3300009057 | Estuarine | AVAEIKGTIDGVQKRVDAVEGDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN* |
Ga0114980_107895262 | 3300009152 | Freshwater Lake | AIKKSSDLGGSQEVSTIKKSKWNGSFLGSVENLIK* |
Ga0114977_103626881 | 3300009158 | Freshwater Lake | QKRVDAVESETAIKKSSDLGRSEEVTIKKSKWNGSFLGSVNEIFN* |
Ga0114978_104397312 | 3300009159 | Freshwater Lake | TAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFQN* |
Ga0114974_102867781 | 3300009183 | Freshwater Lake | VEKRVDAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVQEIFN* |
Ga0114974_105983561 | 3300009183 | Freshwater Lake | ETAIKKSSDLGRSEEVTIKKSKWNGSFLGSVNEIFN* |
Ga0114971_100176501 | 3300009185 | Freshwater Lake | AVENDTAIKKSSDLGGSKEATIKKSKWNGSFLGSVQEIFN* |
Ga0103856_100423931 | 3300009233 | River Water | AIKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIK* |
Ga0103856_100919362 | 3300009233 | River Water | AIKKSTDLGGSAEVTIKKSKWNGSFLGSVDELFN* |
Ga0103860_100196052 | 3300009243 | River Water | VDAVESDTAIKKSSDLGGSQEVIKKSKWGGTFLGSVNDLVR* |
Ga0103860_100333873 | 3300009243 | River Water | TIDGVEKRVVAVESETARKKSSDLGGSQEVITKSKSKWNGSFLGSVQEIFN* |
Ga0103861_100266771 | 3300009247 | River Water | KRVNAVESDTAIKKSLDLGGSQEVTIKKSKWNGSFLGSVNELFS* |
Ga0103862_10199351 | 3300009249 | River Water | ADIKDTINGVEKRVEAVESETAIKKSSDLGGSQEVTIKKSKWNGTFLGSVNELIR* |
Ga0103863_100058682 | 3300009252 | River Water | DTAIKKSSDLGGSDAVTIKKSKWNGSFLGSVNELVK* |
Ga0103869_100469061 | 3300009257 | River Water | SKAVENIKDTINGVEKRVEAVESDTAIKKSSDLGGSQEVIKKSKWNGSFLGSVSDLIR* |
Ga0103864_10015992 | 3300009337 | River Water | AVEGDTAFKKSSDLGGSQEVTIKKSKWNGSFLGSVNELFN* |
Ga0103868_10044492 | 3300009384 | River Water | NGIDVVEGDTAFKKSSDLGGSQEVTIKKSKWNGSFLGSVNELFN* |
Ga0114982_12448382 | 3300009419 | Deep Subsurface | AIKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN* |
Ga0129333_1000056727 | 3300010354 | Freshwater To Marine Saline Gradient | ETAIKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIK* |
Ga0129333_104279442 | 3300010354 | Freshwater To Marine Saline Gradient | VDAVESETAIKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIK* |
Ga0129333_104868052 | 3300010354 | Freshwater To Marine Saline Gradient | DAVESETAIKKSSDLGGSQEVITKSKSKWNGSFLGSVNELFN* |
Ga0129333_112380741 | 3300010354 | Freshwater To Marine Saline Gradient | SETAIKKSSDLGGSREVTIKKSKWNGTFLGSVSELIK* |
Ga0129336_103209011 | 3300010370 | Freshwater To Marine Saline Gradient | GVQKRVDAVESETAMKKSSDLGGSQEVKIQKSKWNGSFLGSVNELFK* |
Ga0129336_105354261 | 3300010370 | Freshwater To Marine Saline Gradient | RVDAVESETAIKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIK* |
Ga0136551_10342322 | 3300010388 | Pond Fresh Water | ETAIKKSSDLGGSQEVTIKKSKWNGTFLGSVNELFN* |
Ga0136551_10464091 | 3300010388 | Pond Fresh Water | TIDGVQKRVDAVEGDTAIKKSSDLGGSVVATTTKSKWNGSFLGSVNEIFN* |
Ga0139556_10028361 | 3300011011 | Freshwater | ETAIKKSSDLGGSQEVVIQKSKWNGSFLGSVNELFK* |
Ga0102688_11845341 | 3300011381 | Freshwater Lake | TAIKKSSDLGGSEGVTIKKSKWNGSFLGSVQEIFN* |
Ga0102688_16802412 | 3300011381 | Freshwater Lake | DGVEKRVVAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLSSVDQLLK* |
Ga0153805_10008285 | 3300012013 | Surface Ice | XXXTAIKKSSDLGGSQEVTIKKSKWNGSFLGSVTELIK* |
Ga0157141_10439461 | 3300012346 | Freshwater | KAVEDIRGTIDGVQKRVDAVEAETAIKKSLDLGGSQEVTIKKSRWNGSFLGSVNELVK* |
Ga0157498_10237642 | 3300012666 | Freshwater, Surface Ice | SETAIKKSSDLGGSQEVMIKKSKWNGSFLGSVNEIFN* |
Ga0157498_10713972 | 3300012666 | Freshwater, Surface Ice | SETAIKKSSDLGGSQEVKITKSKWNGSFLGSVNELFK* |
Ga0157596_10152261 | 3300012702 | Freshwater | ESDTAIKKSSDLGGSAGVTTIKKSKWNGTFLGSVSELTK* |
Ga0157596_11215222 | 3300012702 | Freshwater | AVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVQEIFN* |
Ga0157598_12031141 | 3300012712 | Freshwater | DAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVQEIFN* |
Ga0157601_10439442 | 3300012714 | Freshwater | VDAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVQEIFN* |
Ga0157599_11388201 | 3300012715 | Freshwater | LSKAVAEINTLINTVEKRVDAVESDTAIKKSSDLGGSQEVLQKSKSKWNGSFLGSVQELIK* |
Ga0157609_11084151 | 3300012717 | Freshwater | EKHSALSDAVSEIKGTIEGVQKQVDAVEGSTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFQN* |
Ga0157609_12474671 | 3300012717 | Freshwater | VESETAIKKSSDLGGSQEVMIKKSKWNGSFLGSVNEIFN* |
Ga0157611_10972782 | 3300012724 | Freshwater | TAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN* |
Ga0157611_12113261 | 3300012724 | Freshwater | AIKKSSDLGGSAGVTIKKSKWNGTFLGSVSELTK* |
Ga0157597_12725631 | 3300012726 | Freshwater | AIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN* |
Ga0157616_10910192 | 3300012731 | Freshwater | VDAVESDTAIKKSSDLGGSAGVTIKKSKWNGTFLGSVSELTK* |
Ga0157616_11100601 | 3300012731 | Freshwater | AVESETAIKKSSDLGGSQEVRTIKKSKWNGSFLGSVSDLVK* |
Ga0157606_11440321 | 3300012733 | Freshwater | VEKRVDAVESDTAIKKSSDLGGSAGVTIKKSKWNGTFLGSVSELTK* |
Ga0157615_11824151 | 3300012734 | Freshwater | SDTAIKKSSDLGGSQEVTIKKSKWDGSFLGSVSDLIR* |
Ga0157629_10383322 | 3300012752 | Freshwater | ETAIKKSSDLGGSQGVTIKKSKWNGSFLGSVQEIFN* |
Ga0157628_10348321 | 3300012757 | Freshwater | HSALSAAVTEIKGTIDGVQKQVDAVEGDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN* |
Ga0138290_10377061 | 3300012773 | Freshwater Lake | IDGVQKRVDAVESETAIKKSSDLGGSQEVMIKKSKWNGSFLGSVNEIFN* |
Ga0138284_12396141 | 3300012779 | Freshwater Lake | NTIDGVEKRVDAVESETAIKKSSDLGGSQEVVMKKSKWNGSFLGSVNELFN* |
Ga0157620_10359831 | 3300012959 | Freshwater | EKRVDAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVQEIFN* |
Ga0129337_10491301 | 3300012968 | Aqueous | VESETAVKKSSDLGGSQEVTIKKSKWNGSFLGSVNELLK* |
Ga0129337_12295722 | 3300012968 | Aqueous | GVEKRVVAVESETAIKKSYDLGGSQEVTIKKSKWNGSFLGSVSDLTR* |
Ga0129337_13459361 | 3300012968 | Aqueous | TAIKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIK* |
Ga0129337_14647111 | 3300012968 | Aqueous | ISTVEKRVDAVESDTAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN* |
Ga0129338_10076621 | 3300012970 | Aqueous | EKRVVAVESETAIKKSYDLGGSQEVTIKKSKWNGSFLGSVSDLTR* |
Ga0129338_10966251 | 3300012970 | Aqueous | KRVDAVESETAIKKSSDLGGSQEVITKSKSKWNGSFLGSVNEIFN* |
Ga0129338_11345411 | 3300012970 | Aqueous | TAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN* |
Ga0129338_12046771 | 3300012970 | Aqueous | KRVDAVESETAIKKSSDLGGSQEVITKSKSKWNGSFLGSVNELFN* |
Ga0129338_14053601 | 3300012970 | Aqueous | AALSKAVEDIKSTIDGVEKRVVAVESDTAVKKSSDLGGSQEVTIKKSKWNGSFLGSVNELIK* |
Ga0164293_100532056 | 3300013004 | Freshwater | EGDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN* |
Ga0164293_102871592 | 3300013004 | Freshwater | DIRNTIDGVQKRVDAVEGETAIKKSSDLGGSQEVSTIKKSKWNGSFLGSVNELIR* |
Ga0164292_100818141 | 3300013005 | Freshwater | ETAIKKSSDLGGSQEVMIKKSKWNGSFLGSVNEIFN* |
Ga0164292_105483901 | 3300013005 | Freshwater | TVSDIRNTIDGVQKRVDAVEGETAIKKSSDLGGSREVNTIKKSKWNGSFLGSVQELIR* |
Ga0157551_11418891 | 3300013076 | Freshwater | DTVEKRVDAVESETAIKKSSDLGGSQDVVVQKSKWNGSFLGSVNEIFN* |
(restricted) Ga0172373_102462912 | 3300013131 | Freshwater | SETAIKKSSDLGGSVGTTIKKSKWNGSFLGSVNDIIN* |
Ga0134315_10603752 | 3300014962 | Surface Water | VEGETAIKKSSDLGGSQEVKTIKKSKWNGSFLGSVNEIFN* |
Ga0180043_1065082 | 3300016681 | Freshwater | QKQVDAVEGSTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFQN |
Ga0180056_10159761 | 3300016686 | Freshwater | KRVDAVESETAIKKSSDLGGSREVKVQKSKWNGSFLGSVNELIK |
Ga0180056_10540282 | 3300016686 | Freshwater | TIDGVQKQVDAVEGDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFQN |
Ga0180056_10594642 | 3300016686 | Freshwater | VEKRVDAVESETAIKKSSDLGGSQEVKIQKSKWNGSFLGSVNELFK |
Ga0180055_10609391 | 3300016691 | Freshwater | TAIKKSSDLGGSQEVTIKKSKWDGSFLGSVSDLIR |
Ga0180055_11683651 | 3300016691 | Freshwater | ETAIKKSSDLGGSQEVMIKKSKWNGSFLGSVNEIFN |
Ga0180059_11618422 | 3300016695 | Freshwater | VDAVESDTAIKKSSDLGGSAGVTTIKKSKWNGTFLGSVSELTK |
Ga0180057_11741771 | 3300016697 | Freshwater | TIDGVEKRVDAVESETAIKKSSDLGGSREVKVQKSKWNGSFLGSVNELIK |
Ga0180058_10531842 | 3300016699 | Freshwater | AEINTIINTVEKRVDAVESDTAIKKSSDLGGSQEVLQKSKSKWNGSFLGSVQELIK |
Ga0181356_12253202 | 3300017761 | Freshwater Lake | ESETAIKKSSDLGRSEEVTIRKSKWNGSFLGSVNEIFN |
Ga0181343_11162181 | 3300017766 | Freshwater Lake | KRVDAVEGDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN |
Ga0181358_10769531 | 3300017774 | Freshwater Lake | VEKRVDAVESETAIKKSSDLGGSREVKVQKSKWNGSFLGSINELTK |
Ga0188877_10140402 | 3300018619 | Freshwater Lake | TAIKKSSDLGGSEVVTKSKSKWNGSFLGSVNEIFN |
Ga0188879_10057862 | 3300018633 | Freshwater Lake | VTEIKGTIDGVQKRVDAVEGETAIKKSSDLGGSEVVTKSKSKWNGSFLGSVNEIFN |
Ga0188882_10152611 | 3300018665 | Freshwater Lake | VESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVSELIK |
Ga0188881_100242993 | 3300019146 | Freshwater Lake | STAVTEIKGTIDGVQKRVDAVEGETAIKKSSDLGGSEVVTKSKSKWNGSFLGSVNEIFN |
Ga0180036_10877411 | 3300019200 | Estuarine | NVEKRVDAVEGDTAIKKSSDLGGSQEVLQKSKSTWNGSFLGSVHELIK |
Ga0180032_10008871 | 3300019201 | Estuarine | ITELAEQNATLSKSVADINNILNNVEKRVDAVEGDTAIKKSSDLGGSQEVLQKSKTTWNGSFLGSVHELIK |
Ga0211736_105289281 | 3300020151 | Freshwater | TAIKKSSDLGGSREVKVQKSKWNGSFLGSVNELTK |
Ga0211729_110162352 | 3300020172 | Freshwater | VEKRVDAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVQEIFN |
Ga0194129_102116682 | 3300020578 | Freshwater Lake | TAIKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIK |
Ga0194129_102812292 | 3300020578 | Freshwater Lake | ETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNELIK |
Ga0214168_10205794 | 3300021140 | Freshwater | VDAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVTELIK |
Ga0214163_10469532 | 3300021141 | Freshwater | DAVEGSTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFQN |
Ga0222712_100336721 | 3300021963 | Estuarine Water | AVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN |
Ga0222712_102592091 | 3300021963 | Estuarine Water | ETVKGIRESIGSVEKRIDAVEGETAIKKSADLGGSTEFVKKSKWSGAFLGSVNDILN |
Ga0222712_106148151 | 3300021963 | Estuarine Water | NKAVEEIKNTMDSVQKRVDAVEGETAIKKSSDLGGSQVVTKSKSKWNGSFLGSVNELFN |
Ga0244777_106763862 | 3300024343 | Estuarine | RGDAVESETAIKKSSDLGRSEEVTIRKSKWNGSFLGSVNEIFN |
Ga0244775_100243831 | 3300024346 | Estuarine | VNNIKNTIDGVQKRVDAVESETAFKKSSDLGRSEEATTIKKSKWNGSFLGSVNEIFN |
Ga0255142_10081331 | 3300024352 | Freshwater | AVESETAIKKSSDLGGSQEVTLKKSKWNGSFLGSVNELFN |
Ga0255223_10342891 | 3300024480 | Freshwater | NIKSTIDGVQKRVDAVESETAFKKSSDLGRSEEATTIKKSKWNGSFLGSVNEIFN |
Ga0255223_10379542 | 3300024480 | Freshwater | VEKRIDAVEGDTAIKKSADLGGSTEFVKKSKWSGAFLGSVNDILN |
Ga0255265_10416031 | 3300024482 | Freshwater | DNVEKRVDAVESETAIKMSSDLGGSQEVTLKKSKWNGSFLGSVNELFN |
Ga0256318_10244611 | 3300024485 | Freshwater | TIDGVQKRVDAVESETAIKKSSDLGGSQEVMIKKSKWNGSFLGSVNEIFN |
Ga0256318_10837922 | 3300024485 | Freshwater | AVESETAIKKSSDLGGSQEVVIKKSKWNGSFLLSVNELFN |
Ga0255164_10281072 | 3300024495 | Freshwater | NEVKSTLSGVQKRVDAVEAETAIKKSSDLGRSEEVTIKKSKWNGSFLGSVNEIFN |
Ga0255176_10828141 | 3300024507 | Freshwater | VEGETAIKKSSDLGRSEVVTKSNSKWHGAFLGSVNEIFN |
Ga0255144_10532821 | 3300024513 | Freshwater | IDNVEKRVDAVESETAIKKSSDLGGSQEVTLKKSKWNGSLLGSVNELFN |
Ga0255228_10401002 | 3300024531 | Freshwater | AFKKSSDLGRSEEATTIKKSKWNGSFLGSVNEIFN |
Ga0255228_10728132 | 3300024531 | Freshwater | GVQKRVDAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVTELIK |
Ga0256338_10296281 | 3300024536 | Freshwater | AVESDTAIKKSSDLGGSQEVKIQKSKWSGAFLGSVSDLIK |
Ga0256356_10770611 | 3300024546 | Freshwater | AVESETAIKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIN |
Ga0256345_10237101 | 3300024552 | Freshwater | VAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN |
Ga0255301_10548201 | 3300024553 | Freshwater | ESETAIKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIN |
Ga0255283_10330431 | 3300024557 | Freshwater | ETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN |
Ga0256306_11091172 | 3300024560 | Freshwater | VEKRVDAVESDTAIKKSSDLGGSTGVTIKKSKWNGTFLGSVSELTK |
Ga0255236_10379882 | 3300024563 | Freshwater | VDAVESETAIKKSSDLGRSEEVTIKKSKWNGSFLGSVNEIFN |
Ga0255273_10321341 | 3300024565 | Freshwater | ETAIKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIK |
Ga0256307_10566502 | 3300024567 | Freshwater | SETAIKKSSDLGGSQEVIIKKSKWNGSFLGSVNEIFN |
Ga0255243_10340921 | 3300024569 | Freshwater | TIDGVQKRVDAVEGDTAIKKSSDLGRSEVVTKKSTWNGSFLGSVNEIFSN |
Ga0256302_10485921 | 3300024571 | Freshwater | IKNTIDGVEKRVDAVESETAIKKSSDLGGSQEVIIKKSKWNGSFLGSVNEIFN |
Ga0255268_10342891 | 3300024572 | Freshwater | AVEEIKNTISTVEKRVDAVESDTAIKKSSDLGGSQEITIKKSRWNGSFLGSVNELFN |
Ga0255268_10374251 | 3300024572 | Freshwater | TIEGVEKRVDAVESETAIKKSSDLGGSEGVTIKKSKWNGSFLGSVQEIFN |
Ga0255230_10165002 | 3300024849 | Freshwater | AEQNATLSKSVADINNILNNVEKRVDAVEGDTAIKKSSDLGGSQEVLQKSKTTWNGSFLGSVHELIK |
Ga0255230_10189891 | 3300024849 | Freshwater | AVESETAIKKSSDLGRSEEVTIKKSKWNGSFLGSVNEIFN |
Ga0255295_10332591 | 3300024852 | Freshwater | TAIKKSSDLGGSQEVTIKKSKWNGSFLGSVTELIK |
Ga0255295_10454001 | 3300024852 | Freshwater | ETAIKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIN |
Ga0255287_10366491 | 3300024854 | Freshwater | TAIKKSSDLGGSQEVITKSKSKWNGSFLGSVNELFN |
Ga0255287_10396892 | 3300024854 | Freshwater | VEKRVDAVESDTAIKKSSDLGGSQEATIKKSKWNGSFLGSVQEIFN |
Ga0255271_11221401 | 3300024864 | Freshwater | TIDGVEKRVVAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNELLK |
Ga0255267_10310421 | 3300024867 | Freshwater | DGVEKRVVAVESETAIKKSSDLGGSQEITIKKSRWNGSFLGSVNELFN |
Ga0255247_10138011 | 3300025747 | Freshwater | EDVQKQVDAVEGSTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFQN |
Ga0208783_100499124 | 3300025872 | Aqueous | VDAVESDTAIKKSLDLGGSQEVTIKKSKWNGSFLGSVNEIFN |
Ga0255307_10132062 | 3300026409 | Freshwater | AVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNELLK |
Ga0256298_10130002 | 3300026415 | Freshwater | VESETAVKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN |
Ga0256298_10200201 | 3300026415 | Freshwater | TIDGVQKRVDAVESETAFKKSSDLGRSEEATTIKKSKWNGSFLGSVNEIFN |
Ga0256298_10500352 | 3300026415 | Freshwater | DTAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFSN |
Ga0256300_10621111 | 3300026425 | Freshwater | RVDAVESETAIKKSSDLGRSEEVTIKKSKWNGSFLGSVNEIFN |
Ga0256297_10159031 | 3300026435 | Freshwater | RVDAVESETAVKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN |
Ga0256297_10361951 | 3300026435 | Freshwater | KRVDAVEGDTAIKKSSDLGRSEVVTKKSTWNGSFLGSVNEIFSN |
Ga0255277_10419142 | 3300026569 | Freshwater | ETAIKKSSDLGRSEVVTKSNSKWHGAFLGSVNEIFN |
Ga0255277_10920171 | 3300026569 | Freshwater | EKRVDAVESETAIKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIK |
Ga0255270_11940041 | 3300026572 | Freshwater | AVESDTAIKKSSDLGGSQEATIKKSKWNGSFLGSVQEIFN |
Ga0255074_10044401 | 3300027121 | Freshwater | TAIKKSSDLGRSEEATTIKKSKWNGSFLGSVNEIFN |
Ga0255090_10030527 | 3300027123 | Freshwater | VESETAIKKSSDLGGSQEVMIKKSKWNGSFLGSVNEIFN |
Ga0255066_10180081 | 3300027131 | Freshwater | ESETAIKKSSDLGRSEEVTIKKSKWNGSFLGSVNEIFN |
Ga0255076_10483361 | 3300027141 | Freshwater | SETAVKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN |
Ga0255078_10936752 | 3300027156 | Freshwater | SVEKRIDAVEGETAIKKSADLGGSTEFVKKSKWSGAFLGSVNDILN |
Ga0255198_10118993 | 3300027160 | Freshwater | ETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNELLK |
Ga0208797_10454312 | 3300027186 | Estuarine | ETAIKKSSDLGRSEEVTIRKSKWNGSFLGSVNEIFN |
Ga0208172_10533411 | 3300027231 | Estuarine | TAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN |
Ga0208807_10587661 | 3300027239 | Estuarine | QKRVDAVEGDTAIKKSSDLGGFEVFTKSKSKWSGAFLGSVNEIFN |
Ga0208679_10566692 | 3300027247 | Estuarine | ETAIKKSSDLGRSEEVTIKKSKWNGSFLGSVNEIFN |
Ga0208168_10768712 | 3300027305 | Estuarine | SALSDAVAEIKGTIDGVQKRVDAVEGDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN |
Ga0255087_10659581 | 3300027337 | Freshwater | IKNTIDGVQKRVDAVESETAFKKSSDLGRSEEATTIKKSKWNGSFLGSVNEIFN |
Ga0255182_10862622 | 3300027503 | Freshwater | GDTAIKKSADLGGSTEFVKKSKWSGAFLGSVNDILN |
Ga0209651_10881201 | 3300027581 | Freshwater Lake | IDGVEKRVDAVESETAIKKSSDLGGSQEVVMKKSKWNGSFLGSVNELFN |
Ga0255079_10240153 | 3300027601 | Freshwater | ESETAFKKSSDLGRSEEATTIKKSKWNGSFLGSVNEIFN |
Ga0208951_11540631 | 3300027621 | Freshwater Lentic | KSTIDGVQKQVDAVEGDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN |
Ga0208133_10101961 | 3300027631 | Estuarine | VQKRVDAVESETAFKKSSDLGRSEEATTIKKSKWNGSFLGSVNEIFN |
Ga0208133_10354322 | 3300027631 | Estuarine | VQKQVDAVEGDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN |
Ga0209769_12081541 | 3300027679 | Freshwater Lake | IKNTIDGVEKRVDAVESETAIKKSSDLGGSQEVVMKKSKWNGSFLGSVNELFN |
Ga0209444_103218812 | 3300027756 | Freshwater Lake | ESETAIKKSSDLGGSQEVVMKKSKWNGSFLGSVNELFN |
Ga0209288_103230391 | 3300027762 | Freshwater Sediment | LSKTVSDIRNTIDGVQKRVDAVEGETAIKKSSDLGGSQEVSTIKKSKWNGSFLGSVNELI |
Ga0209770_100201465 | 3300027769 | Freshwater Lake | EIKGTIDGVQKQVDAVEGDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN |
Ga0209246_101163082 | 3300027785 | Freshwater Lake | GDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN |
Ga0209353_101108182 | 3300027798 | Freshwater Lake | EGSTAIKKSSDLGGSVGSTIKKSKWNGTFLGSVNEIFN |
Ga0209358_104691942 | 3300027804 | Freshwater Lake | ENIKNTIDGVEKRVDAVEGDTAIKKSLDLGGSQEVTIKKSKWDGSFLGSVNEIFSN |
Ga0209229_104178221 | 3300027805 | Freshwater And Sediment | AVEGDTAIKKSSDLGGSAVLATNKSKWNGSFLGSVNEIFN |
Ga0209990_100706871 | 3300027816 | Freshwater Lake | DAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVNEIFN |
Ga0209990_101823941 | 3300027816 | Freshwater Lake | ESETAVKKSSDLGGSQEVTIKKSKWNGSFLGSVNELLK |
Ga0209550_101616951 | 3300027892 | Freshwater Lake | DAVESETAIKKSSDLGGSREVKVQKSKWNGSFLGSINELTK |
Ga0209550_103426331 | 3300027892 | Freshwater Lake | DAVESETAIKKSSDLGGSQEVVMKKSKWNGSFLGSVNELFN |
Ga0209550_107182121 | 3300027892 | Freshwater Lake | QKRVDAVEGDTAIKKSSDLGRSEGARQSKSKWNGSFLGSVNEIFSN |
Ga0255172_10879372 | 3300028103 | Freshwater | KRIDAVEGDTAIKKSADLGGSTEFVKKSKWSGAFLGSVNDILN |
Ga0256305_10598051 | 3300028108 | Freshwater | KRVDAVESETAIKKSSDLGGSQEVMIKKSKWNGSFLGSVNEIFN |
Ga0256335_10627011 | 3300028112 | Freshwater | AVEDIKNTIDGVEKRVGAVESETAVKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIK |
Ga0255234_10612841 | 3300028113 | Freshwater | RVDAVESDTAIKKSSDLGGSTGVTIKKSKWNGTFLGSVSELTK |
Ga0255234_11861982 | 3300028113 | Freshwater | VDAVESETAIKKSSDLGGSQEVIIKKSKWNGSFLGSVNEIFN |
Ga0255290_1007431 | 3300028117 | Freshwater | RVDAVESETAIKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIK |
Ga0265593_11763712 | 3300028178 | Saline Water | TFSKSVDARISELAEQHTVLSSAVNDIKSTIDGVQKRVDAVESETAIKKSSDLGRSEEVTIKKSKWNGSFLGSVNEIFN |
Ga0255227_10600872 | 3300028266 | Freshwater | IDGVQKRVDAVEGDTAIKKSSDLGGSEVFTKSKSKWSGAFLGSVNEIFN |
Ga0255227_10644201 | 3300028266 | Freshwater | TIDGVQKRVDAVEGETAIKKSSDLGGSQEVSTIKKSKWNGSFLGSVNEIFN |
Ga0255279_10204711 | 3300028530 | Freshwater | AIKKSSDLGGSQEVVQKSKSKWNGSFLGSVNELFN |
Ga0256301_10151281 | 3300029697 | Freshwater | NNLSETVKGIRETIGSVEKRIDAVEGETAIKKSADLGGSTEFVKKSKWSGAFLGSVNDIL |
Ga0256301_10749431 | 3300029697 | Freshwater | KNTIDTVQKRVDAVESETAIKKSSDLGGSQGVTIKKSKWNGSFLGSVNEIFSN |
Ga0255233_10223701 | 3300029699 | Freshwater | KQVDAVEGDTAIKKSSDLGGSQEVLQKSKSTWNGSFLGSVHELIK |
Ga0315907_103930401 | 3300031758 | Freshwater | TAIKKSSDLGGSEGVTIKKSKWNGSFLGSVQEIFN |
Ga0315907_107609292 | 3300031758 | Freshwater | KRVDAVESDTAFKKSSDLGGSQEVVINKSKWNGSFLGSVNELFK |
Ga0315907_109822252 | 3300031758 | Freshwater | EKRVDAVESETAIKKSSDLGGSQEVIIKKSKWNGSFLGSVNEIFN |
Ga0315909_104331331 | 3300031857 | Freshwater | VAEIRNTIDGVQKRVDAVEGETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVQEIFN |
Ga0315904_106096102 | 3300031951 | Freshwater | AVESETAIKKSSDLGGSQEVTIKKSKWNGTFLGSVSELIK |
Ga0315904_109035672 | 3300031951 | Freshwater | EKRVVAVESETAIKKSSDLGGSQEVITKSKSKWNGSFLGSVNELFN |
Ga0315901_106879062 | 3300031963 | Freshwater | AVESETAIKKSSDLGGSQELTIKKSKWNGSFLGSVTELIK |
Ga0315901_108070412 | 3300031963 | Freshwater | KRVVAVESETAIKKSSDLGGSQEVITKSKSKWNGSFLGSVNELFN |
Ga0315903_103124331 | 3300032116 | Freshwater | EGETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVSDLIK |
Ga0334982_0189444_889_1023 | 3300033981 | Freshwater | KRVDAVESETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVTELIK |
Ga0334992_0507288_371_520 | 3300033992 | Freshwater | MDTVEKRVDAVESDTAIKKSSDLGGSTGVTIKKSKWNGTFLGSVSELTK |
Ga0334987_0591299_3_134 | 3300034061 | Freshwater | RVDAVEGDTAIKKSSDLGGSAVVATNKSKWNGSFLGSVNEIFN |
Ga0334990_0037293_2_151 | 3300034068 | Freshwater | DGVQKRVDAVEGETAIKKSSDLGGSREVNTIKKSKWNGSFLGSVQELIR |
Ga0334990_0346087_626_796 | 3300034068 | Freshwater | VTEIRNTINGVEKRVDAVENETAIKKSSDLGGSQEVTIKKSKWNGSFLGSVQEIFN |
Ga0335028_0195115_1115_1258 | 3300034071 | Freshwater | GVEKRVDAVESETAIKKSSDLGGSQEVKIQKSKWNGSFLGSVNELFK |
Ga0335010_0605104_438_554 | 3300034092 | Freshwater | ESETAIKKSSDLGGSAGVTIKKSKWNGTFLGSVSELTK |
Ga0335030_0248586_1088_1213 | 3300034103 | Freshwater | AVESDTAIKKSSDLGGSVGVTTIKKSKWNGTFLGSVSELTK |
Ga0335066_0458629_507_683 | 3300034112 | Freshwater | AVEDIRNTIDGVQKRVDAVEGETAIKKSSDLGGSQEVSTIKKSKWNGSFLGSVNELIR |
Ga0335053_0076787_3_152 | 3300034118 | Freshwater | IDGVEKRVDAVESETAIKKSSDLGGSREVKVQKSKWNGSFLGSVNELIK |
Ga0335060_0565710_410_562 | 3300034122 | Freshwater | MDTVEKRVDAVESDTAIKKSSDLGGSVGVTTIKKSKWNGTFLGSVSELTK |
Ga0335061_0036411_2521_2631 | 3300034168 | Freshwater | TAIKKSSDLGGSREVNTIKKSKWNGSFLGSVQELIR |
Ga0335049_0418805_702_872 | 3300034272 | Freshwater | SDIRNTIDGVQKRVDAVEGETAIKKSSDLGGSQEVNTIKKSKWNGSFLGSVQELIR |
Ga0335052_0220703_1_114 | 3300034279 | Freshwater | DTAIKKSSDLGGSVGVTTIKKSKWNGTFLGSVSELTK |
Ga0335013_0594681_460_630 | 3300034284 | Freshwater | VTEIKGTIDGVQKRVDAVEGDTAIKKSSDLGGSVVPAVNKSKWNGSFLGSVNEIFN |
⦗Top⦘ |